| Basic Information | |
|---|---|
| Family ID | F064427 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKK |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.15 % |
| % of genes near scaffold ends (potentially truncated) | 93.75 % |
| % of genes from short scaffolds (< 2000 bps) | 75.78 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.125 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (15.625 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.625 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.281 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF03793 | PASTA | 3.12 |
| PF00041 | fn3 | 0.78 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.78 |
| PF00534 | Glycos_transf_1 | 0.78 |
| PF02867 | Ribonuc_red_lgC | 0.78 |
| PF04519 | Bactofilin | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.78 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.12 % |
| All Organisms | root | All Organisms | 46.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10006365 | All Organisms → cellular organisms → Bacteria | 4655 | Open in IMG/M |
| 3300001836|RCM27_1034469 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300001968|GOS2236_1087183 | All Organisms → Viruses → Predicted Viral | 3026 | Open in IMG/M |
| 3300002298|B570J29599_1007568 | Not Available | 677 | Open in IMG/M |
| 3300002408|B570J29032_108937490 | Not Available | 545 | Open in IMG/M |
| 3300003493|JGI25923J51411_1005275 | All Organisms → cellular organisms → Bacteria | 2845 | Open in IMG/M |
| 3300003499|JGI25930J51415_1077546 | Not Available | 553 | Open in IMG/M |
| 3300004112|Ga0065166_10124519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae | 962 | Open in IMG/M |
| 3300005525|Ga0068877_10668285 | Not Available | 559 | Open in IMG/M |
| 3300005525|Ga0068877_10709884 | Not Available | 538 | Open in IMG/M |
| 3300005527|Ga0068876_10249859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
| 3300005528|Ga0068872_10009963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6789 | Open in IMG/M |
| 3300005528|Ga0068872_10570975 | Not Available | 601 | Open in IMG/M |
| 3300005565|Ga0068885_1813440 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005580|Ga0049083_10037685 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300005662|Ga0078894_10523866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1062 | Open in IMG/M |
| 3300005662|Ga0078894_10625569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae | 956 | Open in IMG/M |
| 3300005805|Ga0079957_1007064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8881 | Open in IMG/M |
| 3300005805|Ga0079957_1016471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5314 | Open in IMG/M |
| 3300006030|Ga0075470_10009517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2991 | Open in IMG/M |
| 3300007169|Ga0102976_1081745 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300007171|Ga0102977_1066307 | Not Available | 1772 | Open in IMG/M |
| 3300007177|Ga0102978_1004552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9673 | Open in IMG/M |
| 3300007177|Ga0102978_1034019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7430 | Open in IMG/M |
| 3300007177|Ga0102978_1064631 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300008055|Ga0108970_10381025 | Not Available | 734 | Open in IMG/M |
| 3300008107|Ga0114340_1113710 | Not Available | 1060 | Open in IMG/M |
| 3300008107|Ga0114340_1114854 | Not Available | 1052 | Open in IMG/M |
| 3300008108|Ga0114341_10002637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21865 | Open in IMG/M |
| 3300008108|Ga0114341_10222144 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300008110|Ga0114343_1089136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae | 1091 | Open in IMG/M |
| 3300008110|Ga0114343_1103613 | Not Available | 981 | Open in IMG/M |
| 3300008110|Ga0114343_1125465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
| 3300008113|Ga0114346_1243898 | Not Available | 675 | Open in IMG/M |
| 3300008114|Ga0114347_1056487 | Not Available | 2599 | Open in IMG/M |
| 3300008114|Ga0114347_1056516 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300008114|Ga0114347_1251094 | Not Available | 542 | Open in IMG/M |
| 3300008116|Ga0114350_1013070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3626 | Open in IMG/M |
| 3300008116|Ga0114350_1095771 | Not Available | 949 | Open in IMG/M |
| 3300008117|Ga0114351_1447603 | Not Available | 523 | Open in IMG/M |
| 3300008120|Ga0114355_1116884 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300008120|Ga0114355_1139091 | Not Available | 881 | Open in IMG/M |
| 3300008262|Ga0114337_1163591 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300008262|Ga0114337_1329031 | Not Available | 531 | Open in IMG/M |
| 3300008264|Ga0114353_1312027 | Not Available | 643 | Open in IMG/M |
| 3300008266|Ga0114363_1196709 | Not Available | 623 | Open in IMG/M |
| 3300009056|Ga0102860_1184945 | Not Available | 595 | Open in IMG/M |
| 3300009058|Ga0102854_1219770 | Not Available | 545 | Open in IMG/M |
| 3300010354|Ga0129333_10071528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3222 | Open in IMG/M |
| 3300010354|Ga0129333_10234038 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300010354|Ga0129333_10317271 | Not Available | 1392 | Open in IMG/M |
| 3300010370|Ga0129336_10043350 | Not Available | 2700 | Open in IMG/M |
| 3300012663|Ga0157203_1012678 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300012731|Ga0157616_1304390 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300012970|Ga0129338_1003943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2958 | Open in IMG/M |
| 3300013004|Ga0164293_10275137 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300013005|Ga0164292_10473168 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300013087|Ga0163212_1074039 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300013087|Ga0163212_1134934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae | 783 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10159400 | Not Available | 1477 | Open in IMG/M |
| 3300013372|Ga0177922_10530708 | Not Available | 640 | Open in IMG/M |
| 3300013372|Ga0177922_10695308 | Not Available | 1331 | Open in IMG/M |
| 3300013372|Ga0177922_11255610 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300020159|Ga0211734_11282099 | Not Available | 2425 | Open in IMG/M |
| 3300020200|Ga0194121_10281514 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 855 | Open in IMG/M |
| 3300020204|Ga0194116_10391282 | Not Available | 691 | Open in IMG/M |
| 3300020514|Ga0208202_1026890 | Not Available | 652 | Open in IMG/M |
| 3300020547|Ga0208361_1022362 | Not Available | 877 | Open in IMG/M |
| 3300021376|Ga0194130_10242648 | Not Available | 1035 | Open in IMG/M |
| 3300021962|Ga0222713_10607465 | Not Available | 637 | Open in IMG/M |
| 3300021963|Ga0222712_10069649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2548 | Open in IMG/M |
| 3300024355|Ga0255157_1012507 | Not Available | 1527 | Open in IMG/M |
| 3300024495|Ga0255164_1061754 | Not Available | 592 | Open in IMG/M |
| 3300024496|Ga0255151_1076519 | Not Available | 532 | Open in IMG/M |
| 3300024866|Ga0255272_1054004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
| 3300024867|Ga0255267_1137890 | Not Available | 561 | Open in IMG/M |
| 3300025585|Ga0208546_1085617 | Not Available | 716 | Open in IMG/M |
| 3300026573|Ga0255269_1005450 | All Organisms → Viruses → Predicted Viral | 3265 | Open in IMG/M |
| 3300027121|Ga0255074_1004026 | Not Available | 2086 | Open in IMG/M |
| 3300027123|Ga0255090_1030382 | Not Available | 880 | Open in IMG/M |
| 3300027126|Ga0255098_1051227 | Not Available | 616 | Open in IMG/M |
| 3300027134|Ga0255069_1010651 | Not Available | 960 | Open in IMG/M |
| 3300027139|Ga0255082_1025029 | Not Available | 981 | Open in IMG/M |
| 3300027142|Ga0255065_1000258 | Not Available | 13841 | Open in IMG/M |
| 3300027396|Ga0255146_1051839 | Not Available | 861 | Open in IMG/M |
| 3300027508|Ga0255072_1000490 | Not Available | 8705 | Open in IMG/M |
| 3300027563|Ga0209552_1185882 | Not Available | 522 | Open in IMG/M |
| 3300027571|Ga0208897_1177991 | Not Available | 519 | Open in IMG/M |
| 3300027597|Ga0255088_1007817 | All Organisms → Viruses → Predicted Viral | 2920 | Open in IMG/M |
| 3300027644|Ga0209356_1135690 | Not Available | 696 | Open in IMG/M |
| 3300027659|Ga0208975_1036053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1562 | Open in IMG/M |
| 3300027710|Ga0209599_10183906 | Not Available | 562 | Open in IMG/M |
| 3300027759|Ga0209296_1099520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1391 | Open in IMG/M |
| 3300027769|Ga0209770_10369415 | Not Available | 535 | Open in IMG/M |
| 3300027793|Ga0209972_10025555 | Not Available | 3516 | Open in IMG/M |
| 3300027793|Ga0209972_10179863 | Not Available | 993 | Open in IMG/M |
| 3300027793|Ga0209972_10495424 | Not Available | 503 | Open in IMG/M |
| 3300027805|Ga0209229_10132558 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300027816|Ga0209990_10092331 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300027892|Ga0209550_10327604 | Not Available | 974 | Open in IMG/M |
| 3300028025|Ga0247723_1061003 | Not Available | 1043 | Open in IMG/M |
| 3300028086|Ga0255201_1057530 | Not Available | 595 | Open in IMG/M |
| 3300029930|Ga0119944_1017227 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300031758|Ga0315907_10016180 | All Organisms → cellular organisms → Bacteria | 7063 | Open in IMG/M |
| 3300031758|Ga0315907_10072225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2987 | Open in IMG/M |
| 3300031758|Ga0315907_10269992 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300031758|Ga0315907_11078312 | Not Available | 573 | Open in IMG/M |
| 3300031758|Ga0315907_11226528 | Not Available | 523 | Open in IMG/M |
| 3300031857|Ga0315909_10370021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae | 1039 | Open in IMG/M |
| 3300031857|Ga0315909_10550012 | Not Available | 784 | Open in IMG/M |
| 3300031951|Ga0315904_10077266 | All Organisms → cellular organisms → Bacteria | 3580 | Open in IMG/M |
| 3300031951|Ga0315904_10369317 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300031951|Ga0315904_11101851 | Not Available | 619 | Open in IMG/M |
| 3300032050|Ga0315906_10077021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 3374 | Open in IMG/M |
| 3300032050|Ga0315906_10454919 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300032050|Ga0315906_10484799 | Not Available | 1050 | Open in IMG/M |
| 3300032093|Ga0315902_10515743 | Not Available | 1034 | Open in IMG/M |
| 3300032093|Ga0315902_10856537 | Not Available | 707 | Open in IMG/M |
| 3300032116|Ga0315903_10028846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5971 | Open in IMG/M |
| 3300032116|Ga0315903_10121267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2453 | Open in IMG/M |
| 3300032116|Ga0315903_10244722 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300032116|Ga0315903_10451484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1030 | Open in IMG/M |
| 3300034063|Ga0335000_0519051 | Not Available | 684 | Open in IMG/M |
| 3300034071|Ga0335028_0261032 | Not Available | 1044 | Open in IMG/M |
| 3300034101|Ga0335027_0076517 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300034118|Ga0335053_0240796 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300034166|Ga0335016_0336603 | Not Available | 907 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 15.62% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 14.84% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 12.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.12% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.12% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.34% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.34% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.56% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.78% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.78% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.78% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.78% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.78% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.78% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.78% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.78% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027126 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028086 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100063656 | 3300001282 | Freshwater | NTDPGDLIKGGIAACLPVILKALNPNEPTFGFTKKA* |
| RCM27_10344694 | 3300001836 | Marine Plankton | MNGDTNPGDLIKGGIAAVAPVLLKALNPNDSSFGFKSHK* |
| GOS2236_10871831 | 3300001968 | Marine | AALASYGRHFLGAAIALYMTGNTDPGDLVKGGIAACLPVILKALNPNETAFGFTKK* |
| B570J29599_10075681 | 3300002298 | Freshwater | RHFLGAAIALYMTGNTSPRDLMLGGFAATAPVILKALNPNEPSFGFTKN* |
| B570J29032_1089374901 | 3300002408 | Freshwater | ASYGRHFLGAAIALYMTGNTDPGDLLKGGIAACLPVILKALNSNEPAFGFTKK* |
| JGI25923J51411_10052751 | 3300003493 | Freshwater Lake | YGRHFLGAAIALYMTGNTSPRDLLLGGFAATAPVILKALNPNEPSFGFTKK* |
| JGI25930J51415_10775461 | 3300003499 | Freshwater Lake | LSSYGRHFLGATIALYMTGNTDPGDLIKGGLAAVLPVILKALNTNEPAFGFTKK* |
| Ga0065166_101245191 | 3300004112 | Freshwater Lake | ALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0068877_106682851 | 3300005525 | Freshwater Lake | IALYMTGNTDPGDLIKGGIAAVLPVILKALNSNEPAFGFTKK* |
| Ga0068877_107098842 | 3300005525 | Freshwater Lake | MQEKILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESS |
| Ga0068876_102498591 | 3300005527 | Freshwater Lake | ALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFIKKA* |
| Ga0068872_100099637 | 3300005528 | Freshwater Lake | HFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFIKKA* |
| Ga0068872_105709751 | 3300005528 | Freshwater Lake | TDPGDLIKGGLAAVLPVILKALNTNEPSFGFTKK* |
| Ga0068885_18134403 | 3300005565 | Freshwater Lake | IALYMTGNTDPGDLIKGGLAAVLPVILKALNTNEPSFGFTKK* |
| Ga0049083_100376851 | 3300005580 | Freshwater Lentic | SIALYMTGNTDPSDLIKGGIAACLPVILKALNSNEPAFGFTKK* |
| Ga0078894_105238663 | 3300005662 | Freshwater Lake | RHFLGAAIALYMTGNTDPGDLLKGGIAAVLPVILKALNSNEPAFGFTKK* |
| Ga0078894_106255691 | 3300005662 | Freshwater Lake | TGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0079957_100706414 | 3300005805 | Lake | ALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA* |
| Ga0079957_10164719 | 3300005805 | Lake | LYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0075470_100095171 | 3300006030 | Aqueous | ALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA* |
| Ga0102976_10817451 | 3300007169 | Freshwater Lake | GNTDPGDLIKGGIAACLPVILKALNPNETAFGFTKK* |
| Ga0102977_10663071 | 3300007171 | Freshwater Lake | TDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA* |
| Ga0102978_100455210 | 3300007177 | Freshwater Lake | GAAIALYMTGNTDPGDLIKGGIAATLPVILKALNPNEPSFGFTKKA* |
| Ga0102978_103401910 | 3300007177 | Freshwater Lake | HFLGAAIALYMTGNTNPGDLVKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0102978_10646313 | 3300007177 | Freshwater Lake | KILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKKA |
| Ga0102865_11951181 | 3300007639 | Estuarine | YMTGNTSPRDLLLGGFAATAPVILKALNPNEPSFGFTKK* |
| Ga0108970_103810253 | 3300008055 | Estuary | YMTGNTDPSDLLKGGIAACLPVILKALNSNEPAFGFTKK* |
| Ga0114340_11137103 | 3300008107 | Freshwater, Plankton | ILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0114340_11148543 | 3300008107 | Freshwater, Plankton | SYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0114341_1000263724 | 3300008108 | Freshwater, Plankton | MTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0114341_102221441 | 3300008108 | Freshwater, Plankton | YMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0114343_10891363 | 3300008110 | Freshwater, Plankton | LAALASYGRHFLGAPIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0114343_11036131 | 3300008110 | Freshwater, Plankton | TDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0114343_11254651 | 3300008110 | Freshwater, Plankton | GAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNENSFGFTKK* |
| Ga0114346_12438983 | 3300008113 | Freshwater, Plankton | GRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0114347_10564873 | 3300008114 | Freshwater, Plankton | LGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKK* |
| Ga0114347_10565161 | 3300008114 | Freshwater, Plankton | TDPGDLIKGGIAACLPVILKALNPNETAFGFTKKA* |
| Ga0114347_12510941 | 3300008114 | Freshwater, Plankton | ILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNENSFGFTKK* |
| Ga0114350_10130701 | 3300008116 | Freshwater, Plankton | LASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA* |
| Ga0114350_10957713 | 3300008116 | Freshwater, Plankton | NTDPGDLIKGGIAAVLPVILKALNSNEPAFGFTKK* |
| Ga0114351_14476032 | 3300008117 | Freshwater, Plankton | EKILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0114355_11168841 | 3300008120 | Freshwater, Plankton | GAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0114355_11390911 | 3300008120 | Freshwater, Plankton | HFLGASIALYMTGNTDPGDLIKGGIAAVLPVILKALNSNEPAFGFTKK* |
| Ga0114337_11635913 | 3300008262 | Freshwater, Plankton | MTGNTDPGDLIKGGIAACLPVILKALNPNETAFGFTKKA* |
| Ga0114337_13290312 | 3300008262 | Freshwater, Plankton | MTGNTDPGDLIKGGIAACLPVILKALNPNETAFGFTKK* |
| Ga0114353_13120271 | 3300008264 | Freshwater, Plankton | IALYMTGNTDPGDLVKGGIAACLPVILKALNPNESSFGFTKKV* |
| Ga0114363_11967091 | 3300008266 | Freshwater, Plankton | LASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFIKKA* |
| Ga0102860_11849451 | 3300009056 | Estuarine | GRHFLGASIALYMTGNTDPSDLIKGGIAACLPVILKALNSNEPAFGFTKK* |
| Ga0102854_12197701 | 3300009058 | Estuarine | NTDPSDLLKGGIAACLPVILKALNSNEPAFGFTKK* |
| Ga0129333_100715285 | 3300010354 | Freshwater To Marine Saline Gradient | LAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA* |
| Ga0129333_102340384 | 3300010354 | Freshwater To Marine Saline Gradient | NTDPGDLIKGGIAACLPVILKALNPNEASFGFTKKA* |
| Ga0129333_103172711 | 3300010354 | Freshwater To Marine Saline Gradient | AALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA* |
| Ga0129336_100433501 | 3300010370 | Freshwater To Marine Saline Gradient | ALSSYGRHFLGATIALYMTGNTDPGDLIKGGLAAVLPVILKALNTNEPSFGFTKK* |
| Ga0157203_10126781 | 3300012663 | Freshwater | TGNTDPGDLLKGGLAAILPVILKALNTNEPAFGFTKK* |
| Ga0157616_13043903 | 3300012731 | Freshwater | LGAAIALYMTGNTDPGDLLKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0129338_10039436 | 3300012970 | Aqueous | MTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA* |
| Ga0164293_102751371 | 3300013004 | Freshwater | AIALYMTGNTDPGDLIKGGIAAILPVVLKALNSNEPAFGFTKK* |
| Ga0164292_104731683 | 3300013005 | Freshwater | NTDPADLIKGGIAACLPVILKALNSNEPAFGFTKK* |
| Ga0163212_10740391 | 3300013087 | Freshwater | KILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKKS |
| Ga0163212_11349341 | 3300013087 | Freshwater | KILAALASYGRHFLGAAIALYMTGNTDPGDLVKGGIAACLPVILKALNPNENSFGFTKKS |
| (restricted) Ga0172367_101594004 | 3300013126 | Freshwater | ASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNSNESSFGFTKK* |
| Ga0177922_105307081 | 3300013372 | Freshwater | ALYMTGNTDPGDLLKGGIAAVLPVILKALNTNEPAFGFTKKS* |
| Ga0177922_106953084 | 3300013372 | Freshwater | GRHFLGAAIALYMTGNTDPGDLLKGGIAACLPVILKALNPNESSFGFTKK* |
| Ga0177922_112556101 | 3300013372 | Freshwater | NTDPSDLIKGGIAACLPVILKALNSNEPAFGFTKK* |
| Ga0211734_112820995 | 3300020159 | Freshwater | GNTDPSDLIKGGIAACLPVILKALNSNEPAFGFTKK |
| Ga0194121_102815143 | 3300020200 | Freshwater Lake | LGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKKA |
| Ga0194116_103912823 | 3300020204 | Freshwater Lake | ALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNENSFGFTKKV |
| Ga0208202_10268901 | 3300020514 | Freshwater | ASIALYMTGNTDPGDLLKGGIAACLPVILKALNSNEPAFGFTKK |
| Ga0208361_10223623 | 3300020547 | Freshwater | ALYMTGNTSPRDLLLGGFAATAPVILKALNPNEPSFGFTNK |
| Ga0194130_102426483 | 3300021376 | Freshwater Lake | ALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEASFGFTKKA |
| Ga0222713_106074652 | 3300021962 | Estuarine Water | KILAALASYGRHFLGAAIALYMTGNTDPGDLVKGGIAACLPVILKALNPNESSFGFTKKA |
| Ga0222712_100696494 | 3300021963 | Estuarine Water | KILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0255157_10125071 | 3300024355 | Freshwater | GAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA |
| Ga0255164_10617542 | 3300024495 | Freshwater | LYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKV |
| Ga0255151_10765191 | 3300024496 | Freshwater | LAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA |
| Ga0255272_10540041 | 3300024866 | Freshwater | IALYMTGNTDPGDLIKGGIAACLPVILKALNPNETAFGFTKKA |
| Ga0255267_11378902 | 3300024867 | Freshwater | AIALYMTGNTDPGDLVKGGIAAVLPVILKALNTNEPAFGFTKKS |
| Ga0208546_10856171 | 3300025585 | Aqueous | ALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA |
| Ga0255269_10054501 | 3300026573 | Freshwater | TDPGDLIKGGIAACLPVILKALNPNEPAFGFQKKA |
| Ga0255074_10040264 | 3300027121 | Freshwater | MTGNTDPGDLVKGGLAAVLPVILKALNTNEPSFGFTKK |
| Ga0255090_10303821 | 3300027123 | Freshwater | SSYGRHFLGATIALYMTGNTDPGDLVKGGLAAVLPVILKALNTNEPSFGFTKK |
| Ga0255098_10512273 | 3300027126 | Freshwater | TGNTDPGDLIKGGIAACLPVILKALNPNEPAFGFTKK |
| Ga0255069_10106511 | 3300027134 | Freshwater | GATIALYMTGNTDPGDLVKGGLAAVLPVILKALNTNEPSFGFTKK |
| Ga0255082_10250291 | 3300027139 | Freshwater | YGRHFLGATIALYMTGNTDPGDLVKGGLAAVLPVILKALNTNEPSFGFTKK |
| Ga0255065_10002581 | 3300027142 | Freshwater | LYMTGNTDPGDLVKGGLAAVLPVILKALNTNEPSFGFTKK |
| Ga0255146_10518393 | 3300027396 | Freshwater | KILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA |
| Ga0255072_10004901 | 3300027508 | Freshwater | IALYMTGNTDPGDLIKGGLAAVLPVILKALNTNEPSFGFTKK |
| Ga0209552_11858822 | 3300027563 | Freshwater Lake | NTNPRDLLMGGIAACAPVILKALNPNEPAFGFTKK |
| Ga0208897_11779911 | 3300027571 | Estuarine | GNTDPGDLLKGGIAAVLPVILKALNSNEPAFGFTKK |
| Ga0255088_10078171 | 3300027597 | Freshwater | FLGATIALYMTGNTDPGDLVKGGLAAVLPVILKALNTNEPSFGFTKK |
| Ga0209356_11356903 | 3300027644 | Freshwater Lake | FLGASIALYMTGNTDPSDLIKGGIAACLPVILKALNSNEPAFGFTKK |
| Ga0208975_10360534 | 3300027659 | Freshwater Lentic | FLGAAIALYMTGNTDPGDLLKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0209599_101839061 | 3300027710 | Deep Subsurface | YGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0209296_10995201 | 3300027759 | Freshwater Lake | ILAALASYGRHFLGASIALYMTGNTDPADLIKGGIAACLPVILKALNSNEPAFGFTKK |
| Ga0209770_103694152 | 3300027769 | Freshwater Lake | AAIALYMTGNTDPGDLIKGGIAAILPVILKALNTNEPAFGFTKK |
| Ga0209972_100255551 | 3300027793 | Freshwater Lake | GRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0209972_101798633 | 3300027793 | Freshwater Lake | LASYGRHFLGASIALYMTGNTDPGDLIKGGIAAVLPVILKALNSNEPAFGFTKK |
| Ga0209972_104954241 | 3300027793 | Freshwater Lake | ALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA |
| Ga0209229_101325583 | 3300027805 | Freshwater And Sediment | KILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAAILPVILKALNTNEPAFGFTKK |
| Ga0209990_100923311 | 3300027816 | Freshwater Lake | NTDPADLLKGGLAAILPVILKALNTNEPAFGFTKK |
| Ga0209550_103276043 | 3300027892 | Freshwater Lake | IALYMTGNTDPSDLIKGGIAACLPVILKALNSNEPAFGFTKK |
| Ga0247723_10610033 | 3300028025 | Deep Subsurface Sediment | FLGATIALYMTGNTDPGDLIKGGLAAVLPVILKALNTNEPSFGFTKK |
| Ga0255201_10575301 | 3300028086 | Freshwater | RHFLGAAIALYMTGNTDPGDLVKGGIAACLPVILKALNPNETSFGFTKKA |
| Ga0119944_10172271 | 3300029930 | Aquatic | FLGAAIALYMTGNTDPGDLLKGGIAAVLPVILKALNTNEPAFGFTKKS |
| Ga0315907_100161809 | 3300031758 | Freshwater | LYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFIKKA |
| Ga0315907_100722255 | 3300031758 | Freshwater | ALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0315907_102699921 | 3300031758 | Freshwater | AIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA |
| Ga0315907_110783122 | 3300031758 | Freshwater | NTDPSDLIKGGIAATLPVILKALNPNEKSFGFTNSK |
| Ga0315907_112265281 | 3300031758 | Freshwater | HFLGAAIALYMTGNTDPGDLLKGGIAATLPVILKALNPNETSFGFTKKA |
| Ga0315909_103700213 | 3300031857 | Freshwater | GRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKK |
| Ga0315909_105500123 | 3300031857 | Freshwater | HFLGASIALYMTGNTDPADLIKGGIAACLPVILKALNSNEPAFGFTKK |
| Ga0315904_100772661 | 3300031951 | Freshwater | ILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA |
| Ga0315904_103693174 | 3300031951 | Freshwater | GNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0315904_111018512 | 3300031951 | Freshwater | FLGAAIALYMTGNTDPADLLKGGLAAILPVILKALNTNEPAFGFTKK |
| Ga0315906_100770213 | 3300032050 | Freshwater | MTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFIKKA |
| Ga0315906_104549191 | 3300032050 | Freshwater | ASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNETAFGFTKK |
| Ga0315906_104847993 | 3300032050 | Freshwater | IALYMTGNTDPGDLIKGGIAACLPVILKALNPNETAFGFTKK |
| Ga0315902_105157433 | 3300032093 | Freshwater | AIALYMTGNTDPGDLIKGGIAACLPVILKALNPNETSFGFTKK |
| Ga0315902_108565371 | 3300032093 | Freshwater | ILAALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFIKKA |
| Ga0315903_100288461 | 3300032116 | Freshwater | AALASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0315903_101212671 | 3300032116 | Freshwater | NTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0315903_102447224 | 3300032116 | Freshwater | GRHFLGAAIALYMTGNTDPGDLVKGGIAACLPVILKALNPNESSFGFTKKV |
| Ga0315903_104514843 | 3300032116 | Freshwater | SIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0335000_0519051_40_159 | 3300034063 | Freshwater | MTGNTDPGDLIKGGIAACLPVILKALNPNEPSFGFTKKA |
| Ga0335028_0261032_882_1043 | 3300034071 | Freshwater | ASYGRHFLGAAIALYMTGNTDPGDLIKGGIAACLPVILKALNPNESSFGFTKK |
| Ga0335027_0076517_2504_2614 | 3300034101 | Freshwater | GNTDPGDLIKGGIAACLPVILKALNPNETAFGFTKK |
| Ga0335053_0240796_1051_1164 | 3300034118 | Freshwater | TGNTDPGDLIKGGIAAVLPVILKALNSNEPAFGFTKK |
| Ga0335016_0336603_781_897 | 3300034166 | Freshwater | MTGNTDPGDLIKGGIAACLPVILKALNPNENSFGFTKK |
| ⦗Top⦘ |