| Basic Information | |
|---|---|
| Family ID | F064393 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNKWTTWYDSLPEHTKQYLKTQPVWHDSDMWKAGLFGLVIGLILGLAF |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 91.87 % |
| % of genes near scaffold ends (potentially truncated) | 13.28 % |
| % of genes from short scaffolds (< 2000 bps) | 63.28 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (68.750 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.094 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.062 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (87.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 5.47 |
| PF14235 | DUF4337 | 4.69 |
| PF05226 | CHASE2 | 3.91 |
| PF00211 | Guanylate_cyc | 3.91 |
| PF00147 | Fibrinogen_C | 3.91 |
| PF00578 | AhpC-TSA | 2.34 |
| PF00313 | CSD | 2.34 |
| PF00487 | FA_desaturase | 2.34 |
| PF11351 | GTA_holin_3TM | 1.56 |
| PF12850 | Metallophos_2 | 1.56 |
| PF00574 | CLP_protease | 1.56 |
| PF00355 | Rieske | 1.56 |
| PF09825 | BPL_N | 1.56 |
| PF01192 | RNA_pol_Rpb6 | 0.78 |
| PF00768 | Peptidase_S11 | 0.78 |
| PF03783 | CsgG | 0.78 |
| PF12849 | PBP_like_2 | 0.78 |
| PF02915 | Rubrerythrin | 0.78 |
| PF05488 | PAAR_motif | 0.78 |
| PF01467 | CTP_transf_like | 0.78 |
| PF00848 | Ring_hydroxyl_A | 0.78 |
| PF04773 | FecR | 0.78 |
| PF01738 | DLH | 0.78 |
| PF13439 | Glyco_transf_4 | 0.78 |
| PF09694 | Gcw_chp | 0.78 |
| PF02627 | CMD | 0.78 |
| PF01541 | GIY-YIG | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 3.91 |
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 3.91 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.12 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 3.12 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 2.34 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 2.34 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.56 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.56 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.78 |
| COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.78 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.78 |
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.88 % |
| Unclassified | root | N/A | 28.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002447|JGI24768J34885_10000552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11199 | Open in IMG/M |
| 3300002447|JGI24768J34885_10005388 | Not Available | 4195 | Open in IMG/M |
| 3300002447|JGI24768J34885_10110645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300002835|B570J40625_100073856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4488 | Open in IMG/M |
| 3300002835|B570J40625_100578861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300002835|B570J40625_101763412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300003277|JGI25908J49247_10001233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8111 | Open in IMG/M |
| 3300003395|JGI25917J50250_1119384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300003411|JGI25911J50253_10220398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300003430|JGI25921J50272_10118320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300003754|Ga0005853_1041578 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300004112|Ga0065166_10122384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300004112|Ga0065166_10496314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300004240|Ga0007787_10527439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300005527|Ga0068876_10014079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5170 | Open in IMG/M |
| 3300005527|Ga0068876_10084154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1906 | Open in IMG/M |
| 3300005581|Ga0049081_10003700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5766 | Open in IMG/M |
| 3300005581|Ga0049081_10147835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300005582|Ga0049080_10027272 | Not Available | 1994 | Open in IMG/M |
| 3300005582|Ga0049080_10084523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
| 3300005582|Ga0049080_10279509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300005585|Ga0049084_10314909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300005662|Ga0078894_10111874 | Not Available | 2421 | Open in IMG/M |
| 3300005662|Ga0078894_10157095 | All Organisms → Viruses → Predicted Viral | 2046 | Open in IMG/M |
| 3300005662|Ga0078894_10235512 | Not Available | 1659 | Open in IMG/M |
| 3300005662|Ga0078894_10240489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1641 | Open in IMG/M |
| 3300005662|Ga0078894_10319611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
| 3300005662|Ga0078894_10485727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
| 3300005662|Ga0078894_10486097 | Not Available | 1110 | Open in IMG/M |
| 3300005662|Ga0078894_10767237 | Not Available | 846 | Open in IMG/M |
| 3300005662|Ga0078894_11118248 | Not Available | 672 | Open in IMG/M |
| 3300005662|Ga0078894_11629404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300005662|Ga0078894_11726814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300007992|Ga0105748_10205979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300008107|Ga0114340_1103613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1855 | Open in IMG/M |
| 3300008113|Ga0114346_1002142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28007 | Open in IMG/M |
| 3300008113|Ga0114346_1221458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300008259|Ga0114841_1288662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300009068|Ga0114973_10430538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300009151|Ga0114962_10132887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1512 | Open in IMG/M |
| 3300009151|Ga0114962_10352600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300009152|Ga0114980_10015811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4758 | Open in IMG/M |
| 3300009152|Ga0114980_10189636 | Not Available | 1211 | Open in IMG/M |
| 3300009158|Ga0114977_10081567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1975 | Open in IMG/M |
| 3300009159|Ga0114978_10121502 | Not Available | 1704 | Open in IMG/M |
| 3300009159|Ga0114978_10722384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300009160|Ga0114981_10038634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2704 | Open in IMG/M |
| 3300009164|Ga0114975_10207185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1107 | Open in IMG/M |
| 3300009164|Ga0114975_10354309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300009164|Ga0114975_10362790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300009185|Ga0114971_10621680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300009419|Ga0114982_1000012 | Not Available | 88324 | Open in IMG/M |
| 3300011184|Ga0136709_1001589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3853 | Open in IMG/M |
| 3300012352|Ga0157138_1010683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1508 | Open in IMG/M |
| 3300012663|Ga0157203_1000425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13227 | Open in IMG/M |
| 3300012663|Ga0157203_1000575 | Not Available | 10891 | Open in IMG/M |
| 3300012665|Ga0157210_1001156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8660 | Open in IMG/M |
| 3300012665|Ga0157210_1003075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3970 | Open in IMG/M |
| 3300012665|Ga0157210_1007222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2112 | Open in IMG/M |
| 3300012665|Ga0157210_1007433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2070 | Open in IMG/M |
| 3300012665|Ga0157210_1018134 | Not Available | 1155 | Open in IMG/M |
| 3300012665|Ga0157210_1063682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300013004|Ga0164293_10303763 | Not Available | 1105 | Open in IMG/M |
| 3300013285|Ga0136642_1003495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5813 | Open in IMG/M |
| 3300013285|Ga0136642_1009889 | Not Available | 2998 | Open in IMG/M |
| 3300013286|Ga0136641_1123643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300013295|Ga0170791_12336945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300017780|Ga0181346_1224965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300019093|Ga0187843_10151405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
| 3300020141|Ga0211732_1185230 | Not Available | 2670 | Open in IMG/M |
| 3300020141|Ga0211732_1434993 | Not Available | 1940 | Open in IMG/M |
| 3300020151|Ga0211736_10448380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3492 | Open in IMG/M |
| 3300020151|Ga0211736_10662071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
| 3300020151|Ga0211736_10890628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300020151|Ga0211736_10972491 | Not Available | 3335 | Open in IMG/M |
| 3300020159|Ga0211734_10473581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2327 | Open in IMG/M |
| 3300020160|Ga0211733_10032813 | Not Available | 2261 | Open in IMG/M |
| 3300020160|Ga0211733_11150240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2711 | Open in IMG/M |
| 3300020160|Ga0211733_11233968 | Not Available | 2293 | Open in IMG/M |
| 3300020162|Ga0211735_11163731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300020162|Ga0211735_11336462 | Not Available | 1193 | Open in IMG/M |
| 3300020172|Ga0211729_10243479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300020527|Ga0208232_1003073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2892 | Open in IMG/M |
| 3300020571|Ga0208723_1039424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300021963|Ga0222712_10313662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
| 3300022179|Ga0181353_1137287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300024346|Ga0244775_10223916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1573 | Open in IMG/M |
| 3300024346|Ga0244775_10248192 | Not Available | 1484 | Open in IMG/M |
| 3300025091|Ga0209616_1002604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2937 | Open in IMG/M |
| 3300027132|Ga0255110_1005350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2605 | Open in IMG/M |
| 3300027146|Ga0255104_1059602 | Not Available | 631 | Open in IMG/M |
| 3300027150|Ga0255112_1041267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300027295|Ga0255126_1057227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300027299|Ga0255124_1024267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
| 3300027336|Ga0255128_1109142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300027594|Ga0255120_1014890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1655 | Open in IMG/M |
| 3300027608|Ga0208974_1000890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11905 | Open in IMG/M |
| 3300027608|Ga0208974_1051460 | Not Available | 1183 | Open in IMG/M |
| 3300027708|Ga0209188_1005859 | Not Available | 7765 | Open in IMG/M |
| 3300027708|Ga0209188_1085278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
| 3300027710|Ga0209599_10000009 | Not Available | 192832 | Open in IMG/M |
| 3300027710|Ga0209599_10204069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300027720|Ga0209617_10302897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300027733|Ga0209297_1040444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2140 | Open in IMG/M |
| 3300027734|Ga0209087_1101109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
| 3300027736|Ga0209190_1191940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300027772|Ga0209768_10444761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300027793|Ga0209972_10212280 | Not Available | 891 | Open in IMG/M |
| 3300027798|Ga0209353_10001342 | Not Available | 13993 | Open in IMG/M |
| 3300027836|Ga0209230_10000472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15821 | Open in IMG/M |
| 3300027836|Ga0209230_10014233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3680 | Open in IMG/M |
| 3300027836|Ga0209230_10040132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2403 | Open in IMG/M |
| 3300027969|Ga0209191_1080257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1425 | Open in IMG/M |
| 3300027969|Ga0209191_1136302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300028025|Ga0247723_1017389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2516 | Open in IMG/M |
| 3300028103|Ga0255172_1070587 | Not Available | 631 | Open in IMG/M |
| 3300031857|Ga0315909_10109105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2367 | Open in IMG/M |
| 3300033992|Ga0334992_0000160 | Not Available | 58591 | Open in IMG/M |
| 3300033992|Ga0334992_0511914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300033994|Ga0334996_0345828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300034071|Ga0335028_0330625 | Not Available | 893 | Open in IMG/M |
| 3300034105|Ga0335035_0634710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300034121|Ga0335058_0374053 | Not Available | 820 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.06% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 7.03% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.25% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.25% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 5.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.91% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.91% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.34% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.56% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.56% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.78% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.78% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027150 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027295 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027299 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027336 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24768J34885_100005523 | 3300002447 | Freshwater And Sediment | MNKWTAWYDSLPEHTKQYLKAQPVWHDSDMWRVGLLGCAIGLVIGLTL* |
| JGI24768J34885_100053883 | 3300002447 | Freshwater And Sediment | MNKWDVWYDSLPEHTKQYLKTQPLWHXIDLVKAFAVGALLGFFIGWIM* |
| JGI24768J34885_101106452 | 3300002447 | Freshwater And Sediment | MNKWTAWYDSLPEHTKQYIKSQPVWHDSDMWKAGLFGLFIGIILGAML* |
| B570J40625_1000738566 | 3300002835 | Freshwater | MDKWTNWYDSLPEHTREYLKNQPLWHDIDLVKAGLVGFVIGLIFGLTV* |
| B570J40625_1005788613 | 3300002835 | Freshwater | MNKWESWWDSLSPTTQAYIKSQPIWHDSDMWRAGLFGLVIGFILGVML* |
| B570J40625_1017634121 | 3300002835 | Freshwater | MNKWESWYDSLPEHTKQYLKAQPLWHDIDLAKALGIGLVIGFI |
| JGI25908J49247_100012338 | 3300003277 | Freshwater Lake | MSKFQSWYDSLPDHTKQYLKSQPIWHDRDMWKAGLLGLAIGLILGSAF* |
| JGI25917J50250_11193842 | 3300003395 | Freshwater Lake | MSKFQTWYDSLPEHTKTYLKSQPVWHDRDMWKAGLLGLSIGLILGLAF* |
| JGI25911J50253_102203983 | 3300003411 | Freshwater Lake | MNKWTTWYDSLPEHTKQYLKTQPVWHDSDMWKAGLFGLVIGLILGVTL* |
| JGI25921J50272_101183203 | 3300003430 | Freshwater Lake | MNKWTAWYDSLPENTKQYLKSQPVWHDXDMWKAGLLGLSIGLILGLAF* |
| Ga0005853_10415781 | 3300003754 | Freshwater And Sediment | DNLPLNTQEYLKNQPIWHDSDMWRAGLVGFVIGLIFGLAF* |
| Ga0065166_101223843 | 3300004112 | Freshwater Lake | MSKFQAWYDSLPEHTKTYLKSQPVWHDIDMWKAGLLGCAIGLIIGAMA* |
| Ga0065166_104963141 | 3300004112 | Freshwater Lake | MSKFQTWYDSLPEHTKTYLKSQPVWHDRDMWKAGLLGCAIGVLIGLAV* |
| Ga0007787_105274391 | 3300004240 | Freshwater Lake | DSLSPTTQAYIKSQPIWHDSDMWRAGLFGLVIGFILGVML* |
| Ga0068876_100140799 | 3300005527 | Freshwater Lake | MDKWIKWYDSLPEHTREYLKHQPLWHDSDLAKAGLVGFVIGLILGLTV* |
| Ga0068876_100841543 | 3300005527 | Freshwater Lake | MSEWTKWYDSLPNHTKQYLKNQPLWHDSDLVKAGLVGFIIGLILGLAF* |
| Ga0049081_100037006 | 3300005581 | Freshwater Lentic | MNKWESWYDGLPEHTKQYLKAQPLWHDIDLAKALGIGLVIGFIIGWLT* |
| Ga0049081_101478353 | 3300005581 | Freshwater Lentic | MDKWTNWYDSLPENTKQYLKSQPVWHDRDMWKAGLLGLSIGLILGLAF* |
| Ga0049080_100272724 | 3300005582 | Freshwater Lentic | MNKWDSWYDSLPEHTKQYLKAQPLWHDSDMWRAGLVGFVIGLIFGLAF* |
| Ga0049080_100845232 | 3300005582 | Freshwater Lentic | MNKWDSWYDSLPEHTKQYLKAQPLWHDIDLAKALGIGLVIGFIIGWLT* |
| Ga0049080_102795092 | 3300005582 | Freshwater Lentic | MNKWTAWYDSLPEHTRQYLKTQPIWHDSDMWKAGLLGLSIGLILGLAF* |
| Ga0049084_103149091 | 3300005585 | Freshwater Lentic | MNKWDSWYDRLPEHTKQYLKAQPLWHDIDLAKALGIGLVIGFIIGWLT* |
| Ga0078894_101118743 | 3300005662 | Freshwater Lake | MNKWFDSLPEHTKEYLRNQPIWHDSDMWRAGMFGLVVGFILGVIL* |
| Ga0078894_101570952 | 3300005662 | Freshwater Lake | MSKFQAWYDSLPEHTKTYLKNQPVWHDRDMAKALTLGMAIGLVIGVMI* |
| Ga0078894_102355125 | 3300005662 | Freshwater Lake | MNKWTAWYDSLPEHTKQYLKTQPVWHDRDMWKAGLLGCAIGVLIGLAV* |
| Ga0078894_102404894 | 3300005662 | Freshwater Lake | MNKWTAWYDSLPENTKQYLKSQPVWHDRDMWKAGLLGLSIGLILGLAF* |
| Ga0078894_103196114 | 3300005662 | Freshwater Lake | MSKLQAWYDSLPEHTKQYLKSQPLWHDSDMWRAGIFGLVVGFILGAML* |
| Ga0078894_104857274 | 3300005662 | Freshwater Lake | MNKWTAWYDSLPEHTKQYLKRQPVWHDKDMWKAGLLGLSIGLILGLAF* |
| Ga0078894_104860972 | 3300005662 | Freshwater Lake | MNKWDTWWDSLNPSTQEYLKSQPIWHDSDMWRAGIFGLVIGFILGVIL* |
| Ga0078894_107672374 | 3300005662 | Freshwater Lake | MSKFQTWYDSLPEHTKTYLKNQPIWHDSDMWKAGLLGCAIGVLIGLAV* |
| Ga0078894_111182481 | 3300005662 | Freshwater Lake | MSKFQAWYDNLPEHTKTYLKSQPIWHDRDMWKAGIFGLVIGVLIGLAV* |
| Ga0078894_116294041 | 3300005662 | Freshwater Lake | MSKFQTWYDSLPEHTKTYLKSQPIWHDRDMWKAGLLGCAIGLVIGLAF* |
| Ga0078894_117268143 | 3300005662 | Freshwater Lake | MSKFQAWYDSLPDHTKQYLKSQPIWHDSDMWRAGIFGLVIGFLLGVML* |
| Ga0105748_102059793 | 3300007992 | Estuary Water | VSDWDKWYDSLPEHTKQWLKTQPLWHDGDMWRAGIFGLVIGVILGKFIL* |
| Ga0114340_10763851 | 3300008107 | Freshwater, Plankton | EHTKTYLKSQPVWHDRDMWKAGLLGLSIGLILGLAF* |
| Ga0114340_11036134 | 3300008107 | Freshwater, Plankton | MSKFQAWYDSLPEHTKTYLKSQPVWHDRDMWKAGLLGCAIGLLIGSLF* |
| Ga0114346_100214215 | 3300008113 | Freshwater, Plankton | MSKFQAWYDSLPEHTKTYLKSQPVWHDSDMWRAGLFGALIGLLIGLLF* |
| Ga0114346_12214582 | 3300008113 | Freshwater, Plankton | MSKFQTWYDSLPEHTKTYLKNQPVWHDRDMWKAGLLGLAIGLILGSAF* |
| Ga0114841_12886621 | 3300008259 | Freshwater, Plankton | MSKFQAWYDSLPEHTKTYLKSQPVWHDRDMWKAGLLGCAIGLL |
| Ga0114973_104305382 | 3300009068 | Freshwater Lake | MNKWESWYDSLPENTKQYLKAQPLWHDIDLAKALGIGLVIGFIIGWLT* |
| Ga0114962_101328872 | 3300009151 | Freshwater Lake | MNKWTEWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGALIGVFIGVMLVWH* |
| Ga0114962_103526002 | 3300009151 | Freshwater Lake | MNKWTEWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGAFIGIIIGVALAWH* |
| Ga0114980_100158113 | 3300009152 | Freshwater Lake | MNKWTAWYDSLPEHTKQYLKTQPLWHDIDLAKAFVVGVLVGFFIGFMI* |
| Ga0114980_101896362 | 3300009152 | Freshwater Lake | MNKWTVWYDSLPENTKTYLKSQPVWHDRDMWKAGMVGLVLGLIVGVMI* |
| Ga0114977_100815672 | 3300009158 | Freshwater Lake | MSKWTEWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGAVIGIIIGVLL* |
| Ga0114978_101215024 | 3300009159 | Freshwater Lake | MNKWESWYDSLPEHTKQYLKAQPLWHDIDLFKAFAIGAFVGFIIGWLT* |
| Ga0114978_107223844 | 3300009159 | Freshwater Lake | MNKWTEWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGAVIGIIIGVLL* |
| Ga0114981_100386343 | 3300009160 | Freshwater Lake | MNKWTAWYDNLPEHTKQYLKTQPLWHDIDLAKAFVVGVLVGFFIGFMI* |
| Ga0114975_102071852 | 3300009164 | Freshwater Lake | MSKLQEWHDSLSPSTKEYLKNQPIWHDSDMWKAGLFGAFIGLIIGAMLVWH* |
| Ga0114975_103543092 | 3300009164 | Freshwater Lake | MSKFQDWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGAFIGIIIGVAVAWH* |
| Ga0114975_103627903 | 3300009164 | Freshwater Lake | MNKWTEWYDSLSPSTKEYLKNQPLWHDSDMWRAGLFGAVVGIIIGLAL* |
| Ga0114971_106216803 | 3300009185 | Freshwater Lake | IEKMNKWTAWYDSLPEHTKQYLKTQPLWHDIDLAKAFVVGVLVSFFIGFMI* |
| Ga0114982_100001238 | 3300009419 | Deep Subsurface | MSKWNTWYDNLPEHTKQYLKSQPIWHDIDMWKAGILGAVVGFILGVIL* |
| Ga0136709_10015894 | 3300011184 | Freshwater | MSKFQAWYDSLPEHTKTYLKNQPVWHDRDMWKAGLLGFAIGLIIGAIF* |
| Ga0157138_10106833 | 3300012352 | Freshwater | MNKWTAWYDSLPEHTKQYLKTQPIWHDSDMWKAGIFGLVIGIIIGAML* |
| Ga0157203_10004256 | 3300012663 | Freshwater | MDKWTTWYDSLPEHTKQYLKSQPVWHDRDMWKAGLLGCAIGVLIGLAV* |
| Ga0157203_10005751 | 3300012663 | Freshwater | MNKWDAWWDNLPLNTQEYLKNQPIWHDGDMWRAGLVGFVIGLIFGLAF* |
| Ga0157210_10011564 | 3300012665 | Freshwater | MSKFQAWYDSLPEHTKTYLKSQPVWHDRDMFKALAVGFAIGLVVGLVV* |
| Ga0157210_10030757 | 3300012665 | Freshwater | MSKFQAWYDSLPEHTKTYLKSQPVWHDRDMWKAGLLGCAIGVLIGLAV* |
| Ga0157210_10072223 | 3300012665 | Freshwater | MSKFQTWYDSLPENTKIYLKSQPVWHDRDMWKAGLLGCAIGLIIGVFSTWH* |
| Ga0157210_10074333 | 3300012665 | Freshwater | MSKYEAWWDSLNPSTKEYLKNQPIWHDSDMWRAGIFGLVIGVLIGLIF* |
| Ga0157210_10181344 | 3300012665 | Freshwater | MNKWTAWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGAVVGIIIGIII* |
| Ga0157210_10636822 | 3300012665 | Freshwater | MNKWAHWYENLPENTKRYIDAQPVWHDRDMWKAGLIGFAFGLIIGVISKWH* |
| Ga0164293_103037632 | 3300013004 | Freshwater | MSKYEAWWDSLPQSTKIYLKSQPIWHDSDMWRAGMFGLVVGFILGVIL* |
| Ga0136642_10034955 | 3300013285 | Freshwater | MNKWTTWYDSLPDHTKQYLKTQPLWHNSDMAKAALFGAFVGFIIGVVVAWH* |
| Ga0136642_10098895 | 3300013285 | Freshwater | MNKWSEWYDSLNPSTKEYLKNQPIWHDSDLLKAGLFGAVIGIIIGIML* |
| Ga0136641_11236431 | 3300013286 | Freshwater | NWYDSLPASTKAFLKTQPIWHDSDMFKAVLFGAVIGIIIGIML* |
| Ga0170791_123369453 | 3300013295 | Freshwater | MSKWTEWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGALIGVFIGVMLVWH* |
| Ga0181346_12249651 | 3300017780 | Freshwater Lake | MSKFQSWYDSLPDHTKQYLKSQPIWHDRDMWKAGLLGLAI |
| Ga0187843_101514053 | 3300019093 | Freshwater | MNKWTAWYDSLPEHTKQYLKTQPLWHDIDLAKAFVVGVLVGFFIGFMI |
| Ga0211732_11852305 | 3300020141 | Freshwater | MNKWTTWYDSLPEHTKQYLKTQPVWHDSDMWKAGLFGLVIGLILGLAF |
| Ga0211732_14349933 | 3300020141 | Freshwater | MNKWESWYDSLPEHTKQYLKAQPLWHDIDLAKALGIGLVIGFIIGVIL |
| Ga0211736_104483804 | 3300020151 | Freshwater | MDKWIKWYNSLPEHTREYLKHQPLWHDSDLAKAGLVGFVIGLILGLTV |
| Ga0211736_106620713 | 3300020151 | Freshwater | MNKWDSWYDSLPEHTKQYLKAQPLWHDIDLAKALGIGLVIGFIIGVIL |
| Ga0211736_108906283 | 3300020151 | Freshwater | MSKFQTWYDSLPDHTKQYLKSQPIWHDRDMWKAGLLGLAIGLILGLAF |
| Ga0211736_109724913 | 3300020151 | Freshwater | MSKYETWYESLPESTKIYLKSQPIWHDSDMWRAGMFGLVVGFILGVIL |
| Ga0211734_104735811 | 3300020159 | Freshwater | MDKWIKWYNSLPEHTREYLKHQPLWHDSDLAKAGLVGFV |
| Ga0211733_100328132 | 3300020160 | Freshwater | MSKYETWYDSLPESTKIYLKSQPIWHDSDMWRAGMFGLVVGFILGVIL |
| Ga0211733_111502401 | 3300020160 | Freshwater | MNKWTAWYDSLPEHTKQYLKSQPVWHDSDMWRTGLFGLSIGLILGLAF |
| Ga0211733_112339685 | 3300020160 | Freshwater | MNKWDAWWDNLPLNTQEYLKNQPIWHDGDMWRAGLVGFVIGLIFGLAF |
| Ga0211735_111637313 | 3300020162 | Freshwater | MNKWTAWYDSLPEHTKQYLKSQPVWHDSDMWRAGLFGLVIGVVIGLAV |
| Ga0211735_113364623 | 3300020162 | Freshwater | MNKWDSWYDSLPEHTKEYLKSQPIWHDSDMWRAGLFGLVIGLIFGLAF |
| Ga0211729_102434792 | 3300020172 | Freshwater | MSKFQLWYNSLPEHTKTYLKNQPLWHDRDMAKALVLGMAIGLVIGAIV |
| Ga0208232_10030733 | 3300020527 | Freshwater | MDKWTNWYDSLPEHTREYLKNQPLWHDIDLVKAGLVGFVIGLIFGLTV |
| Ga0208723_10394242 | 3300020571 | Freshwater | MNKWDSWYDSLPEHTKQYLKAQPLWHDIDLAKALGIGLVIGFIIGWLT |
| Ga0222712_103136622 | 3300021963 | Estuarine Water | MSKWFDSLPEHTKVYLKNQAIWHDSDMLKAGMFGLVIGFILGVIL |
| Ga0181353_11372873 | 3300022179 | Freshwater Lake | MNKWDAWRDSLSPTTQAYIKSQPIWHDSDMWRAGLFGLVIGFILGVML |
| Ga0244775_102239163 | 3300024346 | Estuarine | VSDWDKWYDSLPEHTKQWLKTQPLWHDGDMWRAGIFGLVIGVILGKFIL |
| Ga0244775_102481923 | 3300024346 | Estuarine | MNKWTAWYDSLPEHTKQYLKTQPVWHDRDMWKAGLLGCAIGLVIGLAF |
| Ga0209616_10026043 | 3300025091 | Freshwater | MSKFQAWYDSLPEHTKTYLKNQPVWHDRDMWKAGLLGFAIGLIIGAIF |
| Ga0255110_10053502 | 3300027132 | Freshwater | MSKFQAWYDSLPEHTKTYLKSQPVWHDRDMWKAGLLGCAIGLLIGSLF |
| Ga0255104_10596021 | 3300027146 | Freshwater | MNKWDSWYDSLPEHTKQYLKAQPLWHDIDLAKALGIGLVIGFIIG |
| Ga0255112_10412672 | 3300027150 | Freshwater | ITMSKFQAWYDSLPEHTKTYLKSQPVWHDRDMWKAGLLGCAIGLLIGSLF |
| Ga0255126_10572273 | 3300027295 | Freshwater | EKMNKWTAWYDSLPENTKQYLKRQPVWHDRDMWKAGLLGLSIGLILGLAF |
| Ga0255124_10242674 | 3300027299 | Freshwater | MSKFQAWYDSLPENTKQYLKTQPVWHDKDMWKAGLLGLSIGLILGLAF |
| Ga0255128_11091422 | 3300027336 | Freshwater | MNKWTVWYDSLPENTKTYLKSQPVWHDRDMWKAGLLGLSIGLILGLAF |
| Ga0255120_10148905 | 3300027594 | Freshwater | IVMSKFQTWYDSLPEHTKTYLKSQPVWHDRDMWKAGLLGLSIGLILGLAF |
| Ga0208974_100089017 | 3300027608 | Freshwater Lentic | MDKWTNWYDSLPENTKQYLKSQPVWHDRDMWKAGLLGLSIGLILGLAF |
| Ga0208974_10514603 | 3300027608 | Freshwater Lentic | MNKWDSWYDSLPEHTKQYLKAQPLWHDSDMWRAGLVGFVIGLIFGLAF |
| Ga0209188_10058595 | 3300027708 | Freshwater Lake | MNKWTEWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGALIGVFIGVMLVWH |
| Ga0209188_10852781 | 3300027708 | Freshwater Lake | MNKWTEWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGAFIGIIIGVALAWH |
| Ga0209599_10000009220 | 3300027710 | Deep Subsurface | MSKWNTWYDNLPEHTKQYLKSQPIWHDIDMWKAGILGAVVGFILGVIL |
| Ga0209599_102040693 | 3300027710 | Deep Subsurface | MSKYEAWYDSLSPSMKTYLSNQAVWHDRDMWKAGIFGLFIGIIIGIIL |
| Ga0209617_103028973 | 3300027720 | Freshwater And Sediment | MNKWDSWYDSLPEHTKQYLKTQPVWHDSDMWKAGLFGLVIGLILGVTL |
| Ga0209297_10404444 | 3300027733 | Freshwater Lake | MSKWTEWYDSLSPSTKEYLKNQPIWHDSDLLKAGLFGAVIGIIIGVLL |
| Ga0209087_11011094 | 3300027734 | Freshwater Lake | MNKWTVWYDSLPENTKTYLKSQPVWHDRDMWKAGMVGLVLGLIVGVMI |
| Ga0209190_11919402 | 3300027736 | Freshwater Lake | MNKWESWYDSLPENTKQYLKAQPLWHDIDLAKALGIGLVIGFIIGWLT |
| Ga0209770_102407113 | 3300027769 | Freshwater Lake | PEHTKQYLKRQPVWHDKDMWKAGLLGLSIGLILGLAF |
| Ga0209768_104447612 | 3300027772 | Freshwater Lake | MNKWTAWYDSLPEHTRQYLKTQPIWHDKDMWKAGLLGLSIGLILGLAF |
| Ga0209972_102122804 | 3300027793 | Freshwater Lake | MDKWIKWYDSLPEHTREYLKHQPLWHDSDLAKAGLVGFVIG |
| Ga0209353_100013421 | 3300027798 | Freshwater Lake | MNKWDAWWDNLPLNTQEYLKNQPIWHDSDMWRAGLVGFVIGLIFGLAF |
| Ga0209230_1000047210 | 3300027836 | Freshwater And Sediment | MNKWTAWYDSLPEHTKQYLKAQPVWHDSDMWRVGLLGCAIGLVIGLTL |
| Ga0209230_100142338 | 3300027836 | Freshwater And Sediment | MNKWDVWYDSLPEHTKQYLKTQPLWHDIDLVKAFAVGALLGFFIGWIM |
| Ga0209230_100401324 | 3300027836 | Freshwater And Sediment | MNKWTAWYDSLPEHTKQYIKSQPVWHDSDMWKAGLFGLFIGIILGAML |
| Ga0209230_104042051 | 3300027836 | Freshwater And Sediment | PEHTKQYLKTQPVWHDSDMWKAGLFGLVIGLILGVTL |
| Ga0209550_100830091 | 3300027892 | Freshwater Lake | YDSLPDHTKQYLKSQPIWHDRDMWKAGLLGLAIGLILGSAF |
| Ga0209191_10802572 | 3300027969 | Freshwater Lake | MSKLQEWHDSLSPSTKEYLKNQPIWHDSDMWKAGLFGAFIGLIIGAMLVWH |
| Ga0209191_11363022 | 3300027969 | Freshwater Lake | MNKWTEWYDSLSPSTKEYLKNQPLWHDSDMWRAGLFGAVVGIIIGLAL |
| Ga0247723_10173894 | 3300028025 | Deep Subsurface Sediment | MSKFQAWYDSLPENTKTYLKSQPVWHDRDMWKAGLLGLSIGLILGLAF |
| Ga0255172_10705873 | 3300028103 | Freshwater | MKFFGPSKWEQWYDSLPEHTKQYLKKQPVWHDKDMFQVGVLFFFVGLVFGLMF |
| Ga0315900_105165921 | 3300031787 | Freshwater | LPEHTKTYLKSQPVWHDRDMWKAGLLGCAIGLLIGSLF |
| Ga0315909_101091056 | 3300031857 | Freshwater | MGSEKMSKYEAWWDSLSPSTKEYLKNQPIWHDSDMWKAGIVGLCFGILIGLSF |
| Ga0334992_0000160_5945_6091 | 3300033992 | Freshwater | MSKYEAWWDSLPQSTKIYLKSQPIWHDSDMWRAGMFGLVVGFILGVIL |
| Ga0334992_0511914_47_193 | 3300033992 | Freshwater | MNKWTAWYDSLPEHTKQYLKAQPIWHDSDMWRAGIFGLAIGMIIGVML |
| Ga0334996_0345828_494_640 | 3300033994 | Freshwater | MSKFQAWYDSLPEHTKTYLKNQPVWHDRDMWKAGLLGCAIGLVIGLAF |
| Ga0335028_0330625_148_294 | 3300034071 | Freshwater | MSKYEAWWDSLNPSTREYLKNQPIWHDSDMWRAGMFGLVIGVLIGLVV |
| Ga0335035_0634710_3_128 | 3300034105 | Freshwater | MSKFQTWYDSLPEHTKTYLKSQPVWHDRDMWKAGLLGLSIGL |
| Ga0335058_0374053_2_139 | 3300034121 | Freshwater | MDKWTNWYDSLPEHTREYLKNQPLWHDIDLVKAGLVGFVIGLIFGL |
| ⦗Top⦘ |