NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F064344

Metagenome Family F064344

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064344
Family Type Metagenome
Number of Sequences 128
Average Sequence Length 129 residues
Representative Sequence VVRGKLVKVSYFQEQGLEVFLEKLKAQGWFELFTNTQMGCSQPDVAEFYANVSLSGGVLSSTVNGVLIEVNARALGVILGVPATGFDLYVREDKSLLSRARLLELAQHLSQ
Number of Associated Samples 6
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 60.16 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 92.97 %
Associated GOLD sequencing projects 3
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.312 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave
(100.000 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(100.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.78%    β-sheet: 13.67%    Coil/Unstructured: 57.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.09 %
UnclassifiedrootN/A3.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009144|Ga0058702_10013782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2979Open in IMG/M
3300009144|Ga0058702_10158285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha878Open in IMG/M
3300009144|Ga0058702_10191246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha800Open in IMG/M
3300009144|Ga0058702_10215782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha755Open in IMG/M
3300009144|Ga0058702_10230704All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha731Open in IMG/M
3300009144|Ga0058702_10234849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha725Open in IMG/M
3300009144|Ga0058702_10303209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha641Open in IMG/M
3300009144|Ga0058702_10357678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha593Open in IMG/M
3300009144|Ga0058702_10427805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha546Open in IMG/M
3300009144|Ga0058702_10459146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha528Open in IMG/M
3300009144|Ga0058702_10492777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha511Open in IMG/M
3300010395|Ga0058701_10095286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2321Open in IMG/M
3300010395|Ga0058701_10107797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2126Open in IMG/M
3300010395|Ga0058701_10109709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha2100Open in IMG/M
3300010395|Ga0058701_10130416All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1852Open in IMG/M
3300010395|Ga0058701_10132920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1827Open in IMG/M
3300010395|Ga0058701_10149667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1673Open in IMG/M
3300010395|Ga0058701_10171704All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1510Open in IMG/M
3300010395|Ga0058701_10179163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1463Open in IMG/M
3300010395|Ga0058701_10200374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1344Open in IMG/M
3300010395|Ga0058701_10201805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1337Open in IMG/M
3300010395|Ga0058701_10212234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1287Open in IMG/M
3300010395|Ga0058701_10220429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1251Open in IMG/M
3300010395|Ga0058701_10224906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1232Open in IMG/M
3300010395|Ga0058701_10234203All Organisms → Viruses → Predicted Viral1195Open in IMG/M
3300010395|Ga0058701_10241060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1170Open in IMG/M
3300010395|Ga0058701_10244084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1159Open in IMG/M
3300010395|Ga0058701_10256262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1117Open in IMG/M
3300010395|Ga0058701_10264244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1092Open in IMG/M
3300010395|Ga0058701_10265253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1088Open in IMG/M
3300010395|Ga0058701_10272990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1065Open in IMG/M
3300010395|Ga0058701_10274556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1061Open in IMG/M
3300010395|Ga0058701_10288933All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1021Open in IMG/M
3300010395|Ga0058701_10302011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha988Open in IMG/M
3300010395|Ga0058701_10311858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha964Open in IMG/M
3300010395|Ga0058701_10318789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha948Open in IMG/M
3300010395|Ga0058701_10322666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha940Open in IMG/M
3300010395|Ga0058701_10334201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha916Open in IMG/M
3300010395|Ga0058701_10336420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha912Open in IMG/M
3300010395|Ga0058701_10344837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha895Open in IMG/M
3300010395|Ga0058701_10346341All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha892Open in IMG/M
3300010395|Ga0058701_10367221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha855Open in IMG/M
3300010395|Ga0058701_10380871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha833Open in IMG/M
3300010395|Ga0058701_10386123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha825Open in IMG/M
3300010395|Ga0058701_10398683All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha806Open in IMG/M
3300010395|Ga0058701_10399678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha804Open in IMG/M
3300010395|Ga0058701_10424246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha771Open in IMG/M
3300010395|Ga0058701_10425709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha769Open in IMG/M
3300010395|Ga0058701_10429854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha764Open in IMG/M
3300010395|Ga0058701_10432129All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha761Open in IMG/M
3300010395|Ga0058701_10441531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha750Open in IMG/M
3300010395|Ga0058701_10444216All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha747Open in IMG/M
3300010395|Ga0058701_10460626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha728Open in IMG/M
3300010395|Ga0058701_10463006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha725Open in IMG/M
3300010395|Ga0058701_10483379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha704Open in IMG/M
3300010395|Ga0058701_10504671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha684Open in IMG/M
3300010395|Ga0058701_10508304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha680Open in IMG/M
3300010395|Ga0058701_10508325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha680Open in IMG/M
3300010395|Ga0058701_10529258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha663Open in IMG/M
3300010395|Ga0058701_10529330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha663Open in IMG/M
3300010395|Ga0058701_10551051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha645Open in IMG/M
3300010395|Ga0058701_10555610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha642Open in IMG/M
3300010395|Ga0058701_10588945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha619Open in IMG/M
3300010395|Ga0058701_10589449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha618Open in IMG/M
3300010395|Ga0058701_10612546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha603Open in IMG/M
3300010395|Ga0058701_10619738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha599Open in IMG/M
3300010395|Ga0058701_10624297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha596Open in IMG/M
3300010395|Ga0058701_10626497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha595Open in IMG/M
3300010395|Ga0058701_10661103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha576Open in IMG/M
3300010395|Ga0058701_10668025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha572Open in IMG/M
3300010395|Ga0058701_10682056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha565Open in IMG/M
3300010395|Ga0058701_10682746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha565Open in IMG/M
3300010395|Ga0058701_10741001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha538Open in IMG/M
3300010395|Ga0058701_10776490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha524Open in IMG/M
3300010395|Ga0058701_10785565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha520Open in IMG/M
3300010395|Ga0058701_10805127All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha513Open in IMG/M
3300010395|Ga0058701_10819327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha508Open in IMG/M
3300027766|Ga0209796_10167512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha692Open in IMG/M
3300030495|Ga0268246_10021512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1903Open in IMG/M
3300030495|Ga0268246_10053493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1179Open in IMG/M
3300030495|Ga0268246_10090462All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha895Open in IMG/M
3300030495|Ga0268246_10100578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha846Open in IMG/M
3300030495|Ga0268246_10105286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha826Open in IMG/M
3300030495|Ga0268246_10129951All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha740Open in IMG/M
3300030495|Ga0268246_10134849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha726Open in IMG/M
3300030495|Ga0268246_10142875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha705Open in IMG/M
3300030495|Ga0268246_10181313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha624Open in IMG/M
3300030495|Ga0268246_10203292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha589Open in IMG/M
3300030495|Ga0268246_10211190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha578Open in IMG/M
3300030495|Ga0268246_10238953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha544Open in IMG/M
3300030495|Ga0268246_10254496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha528Open in IMG/M
3300030495|Ga0268246_10256933All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha525Open in IMG/M
3300030495|Ga0268246_10262907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha519Open in IMG/M
3300030498|Ga0268247_10061432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1594Open in IMG/M
3300030498|Ga0268247_10101345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1289Open in IMG/M
3300030498|Ga0268247_10129288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1151Open in IMG/M
3300030498|Ga0268247_10158985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1041Open in IMG/M
3300030498|Ga0268247_10161487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1033Open in IMG/M
3300030498|Ga0268247_10163436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1027Open in IMG/M
3300030498|Ga0268247_10170776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha1004Open in IMG/M
3300030498|Ga0268247_10172717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha998Open in IMG/M
3300030498|Ga0268247_10173437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha996Open in IMG/M
3300030498|Ga0268247_10203682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha917Open in IMG/M
3300030498|Ga0268247_10233659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha851Open in IMG/M
3300030498|Ga0268247_10237192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha844Open in IMG/M
3300030498|Ga0268247_10351565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha675Open in IMG/M
3300030498|Ga0268247_10361618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha664Open in IMG/M
3300030498|Ga0268247_10376992All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha648Open in IMG/M
3300030498|Ga0268247_10387800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha638Open in IMG/M
3300030498|Ga0268247_10398297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha628Open in IMG/M
3300030498|Ga0268247_10403282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha623Open in IMG/M
3300030498|Ga0268247_10428639All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha601Open in IMG/M
3300030498|Ga0268247_10434210All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha596Open in IMG/M
3300030498|Ga0268247_10471941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha567Open in IMG/M
3300030498|Ga0268247_10479489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha562Open in IMG/M
3300030498|Ga0268247_10484812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha558Open in IMG/M
3300030498|Ga0268247_10484967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha558Open in IMG/M
3300030498|Ga0268247_10499801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha548Open in IMG/M
3300030498|Ga0268247_10514835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha538Open in IMG/M
3300030498|Ga0268247_10547900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha519Open in IMG/M
3300030498|Ga0268247_10555256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha514Open in IMG/M
3300030515|Ga0268254_10184636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha680Open in IMG/M
3300030515|Ga0268254_10226831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha613Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave100.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009144Agave microbial communities from Guanajuato, Mexico - Or.Sf.eHost-AssociatedOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300027766Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300030495Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2)Host-AssociatedOpen in IMG/M
3300030498Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300030515Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (v2)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058702_1001378263300009144AgaveVGYFREQELEVFLDKLRAQGWLELFTNTPMGCSQPDLAEFYANVMVSEGLQTSTVNGVLIELDARALGVILGFPATDFDLYVQEDKSLLSKAKLLELAQHSSQQPGLKHPQAVKKGDM*
Ga0058702_1015828513300009144AgaveVAPSPKLEKFQKRGVVRGKLIKVSYFQEQGLEVFLDKLKAQGWFELFINTQMGCSQPDVVEFYANVSLFGDVLTSTVNEVLIEVNAQVLGVILRVLITGFDSYVREDKSLLSKARLLELAQHLSQQPG
Ga0058702_1019124613300009144AgaveVTPSSKLEKFQKRGVVRGKFVRVKFFQDQGLELFLDKIKAQGWYELFTNTKMVCSPSDVAEFYANVSLHGDVITSTVNGVLIEVNAQALGVILGVPSTGFDLYVKEDRSLLSRERL
Ga0058702_1021578213300009144AgaveVAPSAKLEKFQRRGIVRGKIVKASYFHDQGLGVFLDKLQAQGWFQLFANTELGCSQPNVVEFYANVALYGEVLSSTVNGVLIEVDAQALGMILGVPATGFDLYVREDKGLLGRDRLLELSRHLGQQSGLRSPQAVKKGDMQPLHQLLFWFLIKNVIPRAQGRNQAD
Ga0058702_1023070413300009144AgaveLEKFLKRGVVRGKIVKVGYFQEQGLEVFLDKMKAQGWFKLFTNTQLRCCQPDVAEFYANVSVSEGVLTSTVNRVLIEVDVRTLRVILGIPATGFDLYVREDKSLLGKARLLKLAQRLSQQLGLKNP*
Ga0058702_1023484923300009144AgaveLEKFQKRGVVRGKLVRIRYFQEQGLQVFLEKLRMQGWLELFTNTQMGCSQPDVVEFYANVALSGHVLCSTINGVEIQVNAQALGVILGVPATGFDLYVREDKSLLSRDRLLELSRHLSQQPGLRSPQAVKKEDIQPLQQLLFWFIIKNIIPRAQGR
Ga0058702_1028875423300009144AgaveVRGKIVKVGYSREQGLEVFLDKLRAQGWLELFTNTQLGCSQPDLAEFYANVTVSQGLLTSTVNGVLIEVDARAHGVILGVLATGFDLYVPEDKSLLGKEKLPELAQQLSQEPGLKQAQAVKKGDM*
Ga0058702_1030320913300009144AgaveVAPSPKLEKFQKRGVERGKLVKVSYFQELGLKVFLDKLRAQGWYELFTNTQMGCSQSDVAEFYANMALSGDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVQEDKSLLSKARLLELAQHLSQQPGLKS
Ga0058702_1035767823300009144AgavePSAKRPKSEVAPSPKLEKFQKRSVVRGKLIKVSYFQKQGLEVFLDKLKAQGWYELFTNTQMGCSQADVTEFYANVALAGDVLSSTVNGVLIEVNAQALGVILGVPATGFDLYICEDKSLLGRDRLLELAQQLSQQPGLRSPQAVKKGDMQPLH*
Ga0058702_1042780513300009144AgaveLVQVRYFQEQGLKVFLDKLKAQGWFELFTNTQMGCSQPDVAKFYANVSLSGDVLTSTMNGVLLEVDARALGVILGVPATGFNLYVREDKPLLSRARLLELAQHLSQQPGLRSP
Ga0058702_1045914613300009144AgaveVAPSPKLEKFQKRGVVKGKIVRVKFFQDQGLELFLAKLKAQGWYELFLNTQLGCSQPDVAEFYANVSLHGDVISSSVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRERLVELSWHLSQQPGLRNPQAVKKGDMQPLHQ
Ga0058702_1049277713300009144AgaveEVAPSPKLEKFLKRGVVRGKIVKVSYFQELGLEVFLDKLKAQGWFELFRNTQLGCSQPDVVKFYANVSVSEGMLTSMVNGVLIEVDARALGVILGVPATGFNLYVREDKSLLGKAKLLELAQDLS*
Ga0058701_1009528613300010395AgaveMSYFQEQGLQVFLEKLRVQGWLELFTNTQMGCSQPDVAEFYANVALSGHVLCSTINGVEIQVNAQALGVILGVPATGFDLYVREDKCLMSRDRLLELSRHLSQQPGLRSPQAVKKEDMQPLQQLLFWFIIKNIIPRAQGRNQVDSMDQC
Ga0058701_1010779743300010395AgaveVREKLVKVSYFQEQGLEVFLQKLKAQGWFELFTNTQMGYSQPDVAEFYVNVSLSGGVLSSTVNGVLIEVDARALGVILRVPATGFDLYIREDKSLLGRDRLLELAQHLSQ*
Ga0058701_1010970913300010395AgaveMWCGEGKLVKVSYFQEQGLDVFLEKLKAQVWFELFTNTQMGCSQPDVAEFYANVSLSGAVLSSTVNEVLIEVDARALGVILGVPATGFDLYVREDKSLLSRARLLELAQHLSQQPGLR
Ga0058701_1013041613300010395AgaveVRGKIVKVGYFQEQGLEVLLDKQAQGWFELFTNTQMGCSQPGVAESYANVSVSEGVLTSTVNGVLIEVDARALGMIFGVPATGFDLYVREDKSLLGKARLLKLAQHLSQQPGLKNPQAVKKGDMQPLH
Ga0058701_1013292043300010395AgaveVTPSAKLEKFQKRGVVRGKVVKASYFHDQGLEVFLDKLRAQGWYELFVNTQLGCSQPDIAEFYANVSLHGEVISSTLNGVLIEVNAQALGVILGVPTAGFELYVREDKSLLSRDRLLELSQHFSQQPGLRTPQAVKKG
Ga0058701_1014966723300010395AgaveVAPSSKLEKFQKRGVVRGKLIKVSYFQEQGLEVLLDKLKAQGWYELFTNTQMGCSQPDVAEFYANVALSRDVLSSTANEVLIEVNAQALGVILEVPATEFDLYVREDKSLLSKARLLELA
Ga0058701_1017170423300010395AgaveVVRGKLVKVSYFQEQGLEVFLEKLKAQGWFELFTNTQMGCSQPDVAEFYANVSLSGGVLSSTVNGVLIEVNARALGVILGVPATGFDLYVREDKSLLSRARLLELAQHLSQ*
Ga0058701_1017916313300010395AgaveVSYFQEQGLQVFLDKLKAQGWYELFTNTQLGRSQPDMAEFYANVTLHGDVITSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRDRLLELSRHLSQQPGLRSPQAVKKGDMQPLHQLL
Ga0058701_1020037413300010395AgaveKPEVAPSAKLEKFQRRGIVRGKIVKASYFHDQGLGVFLDKLQAQGWFELFANTQLGCSQPDVVEFYANVVLHGEVLSSTINGVLIEVDAQALGVILGVPATGFDLYVREDKGLLAETGYWTCLVT*
Ga0058701_1020180533300010395AgaveEVAPSPKLEKFQKRGVVRGKLVKVSYFQEQGLEVFLDKLKAQGWYELFTNTQMGCSQPDVAEFYANVALSGDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLSSKPRLPELAQHLSQQPRLRSPQAVKKGDMQALHQLLFWFVIKNIIPRA*
Ga0058701_1021223423300010395AgaveVAPSSKLEKFQKRGVVRGKLIKVSYFQGQGLEVFLDKLKAQGWYELFTNTQMGCSQPDVAEFYANVALSGDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVQEDKSLLSKVRLLELAQRLSQQPGLRSP*
Ga0058701_1022042913300010395AgavePKLEKFLKRGVVRGKIVKVGYFQEQGLEVFLDKLKAQRWFELFTNTQLGCSQPDVAKFYANVSVSEGVLTSTVNGVLIEVDARALGVILGVPGTRFYLYVREDKSLLSKAKLLELAQHLS
Ga0058701_1022490623300010395AgaveLKNLLPKKAKTSVAPSPKLEKFLKRGVVRGKIVKVGFFREHGLEVFLDKLRAQGWLELFTNTQLGCSEPDLAEFYANVTVSDGLMTNTVNGVLIEVDARALGVILGVPATGFDLYVREDKSC*
Ga0058701_1023420323300010395AgaveVVRGKLFRVSDFQEQGLEVFLEKLRAQGWLELFINTQMGCSQPDVAEFYANVSLSGDVLYSNVNGVEIQVDAQALGVILRVPSTGFDLYIREDKSLLGRDRLLELS*
Ga0058701_1024106023300010395AgaveVAPSPKLEKFLKRSVVRGKIVKASYFREQGLEVFLDKVKAQGWFELFTNTPMGCSQPDVVEFYANVTVSEGLLTSTVNGVLIEVDARALGAILGVPATSFDLYVREDKSLLSKERLLELAQHLS*
Ga0058701_1024408423300010395AgaveVAPSPKLEKFQKRGVVRGKLVKVSYFQEQGLEVFLDKLKAQGWYELFTNTQMGCSQSDVAEFYVNVALAGDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLVSKARLLELANI*
Ga0058701_1025626223300010395AgaveVTPSAKLEKFQRRGIVRGKIVKASYFQDQGLEVFLDKLQTQGWFELFANTELGCSQPDVVEFYANVALHGEVLSSTVNGVLIEVDDQALGVILGVPATGFALYVREDKSLLGRDRLLELSCHLSQQPGLRSPQSVKKGDIQPLHQLLFWFLIKNVIPRAQGRNQAD
Ga0058701_1026424413300010395AgaveVAPSPKLEKFQKRGVVRGKLVKVRYFQEQGLEVFLDKLKPQGSYELFTNTEMGCSQPDVAEFYANVALFMDVLTSTMNGVLIEVNAQALGVILGVPATEFDLYVREDKSLLSK
Ga0058701_1026525313300010395AgaveVKVGYFREQGLEVFLDKLKAQGWLELFTNTQLGCSQPDIAEFYANVTVSEGLLTSTVNGVLIEVDARALGVILGIPAMGFDLYVREDKSLLGKAKLLELAQRLSQRPGLKPSMKARMR*
Ga0058701_1027299023300010395AgaveVAPSPKLEKFQKRGVVRGKLVKVSYFQEQGLEVFLDKLKAQGWYELFTNTQMGCSQLDVAEFYANVALSGDVLTSTVNGVLIEVNAQALGVIMGVPATGFDLYVREVKSLLSKARLLELAQHSSQQPRLRSPQAVKKGDI*
Ga0058701_1027455633300010395AgaveLKKFLKRGVVRGKIVKVGYFREQGLEVFFDKLRDQGWLELFTNTPMGCSQPDLAEFYANVTILDGLLTSTVNGVLLEVDTRALGVILGVPATGFDLYVREHKSLLGKVKLLELAQHLSQQPGLKHPQAVKKGDMQPLH*
Ga0058701_1028893313300010395AgaveVAPSPKREKFQKRGVVRGKLVKVSYFQEQGMKVFLDKLKAQEWYELFTNTQMGCSQPDVTEFYVNVALSGGVLSSTVNGVLIEVDAQALGVILGVPATSFDLYVREDKSLLSKAWLLELGQQLSQQPGLTSPQAVRKGDMQPLHQLLF*
Ga0058701_1030201113300010395AgaveVVRGKIVKASYFHDQGLGVFLEKLRAQGWFELFANTQLGCSQPDIAEFYANVSLHGEVISSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLGRDRLLELSRHLSQQPGLRSPQAVKKGDMQPLHQLLFWFIIKN
Ga0058701_1030761323300010395AgaveVVRGKLVKVSYFQEQGLEVFLEKLKAQGWYELFTNTQMGCSQPDVTEFYANVALSGDVLTSTVNGMLIEVNAQALGVILGVPATRFDLHVRKDKSLLSKARLLELAQQLSQQPGLRSPQAVKKGDMQ
Ga0058701_1031185813300010395AgaveMVRVSYFQDQGLEVFLDKLRAQGWYELFTNTQLGCSQPDVAEFYANVALHGDVLSSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRDRLLELSQHLS*
Ga0058701_1031878913300010395AgaveVPPSSKLEKFLKRGVVRGKIVKAGYFREQGLEVFLDKLRTQGWLELFTNSQLGCSQPDLAEFYANVSVSEGLLTSTVNGVLIEVDAKVLGVILGVPATGFDLNVREDKSLLGKAKLLELAKHLSQQPGLKHPQV
Ga0058701_1032266613300010395AgaveLVKVSYFQEQGLEDKLKAQGWYELFTNTYMGCSQPDVAEFYANMTLSRDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVWVDKSLLSKARMLELAQHLSQ*
Ga0058701_1033420113300010395AgaveVDRVVGVDLLPGLSEVAPSPKLEKFLKRVMVRGKIIKVGYFQEQGLEVFLDQLKAQRWFELVTNTQMGCSQPDVAEFYANMSVSEGVLTSIVNGVLIEVDARALVVLLGVPATGFDLHIREDKSLLGKARLLKLAQHLSQQPGLKNPQAVKKRDMQPLH
Ga0058701_1033642013300010395AgaveVKFFQDQGLEVFLERLKAQGWYELFANTQLGCSQPDVAEFYANVTLHGDVLSSSVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRERLVDLSRHLSQQPGLRSPQAVKKGDMQPLHQLLFWFII
Ga0058701_1034483723300010395AgaveMVSYFQEQGLEVFLDEIKAQGWYELFTNTQMGCSQPDMAEFYANVALCGDVLTSTVNGVLIKVNAQTLGVILGVPATGFDLYVREDKSLLSKARLLELAQRLSQQPGLRSPQVVKKGDMQFVQ*
Ga0058701_1034634113300010395AgaveVASSPKLKKFQKRGEVRGKLVRVSYFQEQGLEMFLEKVRAHGWLELFTNTQMGCSQPDVAEFYANVSLSGGVLCSTVDAVLIEVDAQALGVILGVPSTGFDLYFREDKSLLGKDRLLELS
Ga0058701_1036722113300010395AgaveLEKFQKSGVVREKLVRMSYFQEQRMQVFLEKLKAQGWLELFTNTQMGCSQPDVAEFYANVALSGDVLCSVVNGVEIQVDAQGLGVILGVPSTGFDLYVREDKSLLGRDRLLELSQHLSQQPGLRSPQSVKKGDMQPLHQLIFWFIIKNIIPRAQGRN
Ga0058701_1038087113300010395AgaveVVRGKLVRVSYFQEQGLEVFLKKLRAQGWLELFTNTQMACSQPDVAEFYANVALSGDVLCSTVNGVEIQVDAQAIGVILGVPSTGFDLYIREDKSLLGRDRLLELSQHLSQQPGLRSPQSVKKGDMQPLHQ
Ga0058701_1038612313300010395AgaveVKASYFHDQGLGVFLDKLQAQGWFELFANTQLGCSQPDIAEFYANVALHGEVLSSTVNGILIEVNAQALGVILGVPATGFELYVREDKSLLGRDRLLELSRHLSQQPGLRSPQSVKKGDM
Ga0058701_1039868313300010395AgaveVAPSPKLEKFQKRRVVRGKIVRVKFFQDQGLELFLAKLKAQGWYELFSNTQLGCSQPDVAEFYANVSLHGDVISSSVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRERLVELSRHLSQQPGLRSPQAVKKGDMQPLHQLLF
Ga0058701_1039967813300010395AgaveVAPSPKLEKFQKRGVVRGKIVRVKFFQDQGLEVFLAKLKAQGWYELFRNTQLGCSQPDIAEFYANVSLHGDVISSKVNGVLVEVNAQALGVILGVPATGFDLYVREDKSLLSRER
Ga0058701_1042424613300010395AgaveVTPSPKLEKFQKRGVVRGKVVRVQFFEDQGLEVFLHKIKAQGWFDLFTNTQMVCSPPDLAEFYANVTLHGEVITSTVNGVLVEVNAQALGVILGVPSTGFDLYLKEDRSLLSRERLVELS
Ga0058701_1042570913300010395AgaveVAPSPKLEKFQKRGVVRGKLVKVSYFQEQGLEMFLDKLKAQEWFELFTNTQMGCSQPDVAEFYANVSLSGDVRSSTVNGVLIEVNARALGVILGVPATGLDLYVREDKSLLGKAQLLEFAQKLSQQLGLKSPQAVKKGDMQPLHQLLF*
Ga0058701_1042985413300010395AgavePSPKLEKFLKRGVVRGKIVKVGYFRKQGLEVFLDKLRAQGWFELFTNTPIGCSQPDVAEFYANVTVSASLMTSTVNRVLIEVDARVLGVVLGVPAMGFNIYVRQDCLGSNLAEFWTLSPNL*
Ga0058701_1043212913300010395AgaveVAPSPKLEKFQKRGVVRGKIVRVSYFQDQGLEVFLDKLRAQGWYELFKNTQLGCSQPDVAEFYANVALHGDVLSSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSR
Ga0058701_1044153123300010395AgaveVTPSARLEKFQRRGIVRGKVVKASYFQDQGLEVFLDKLQTQGWFELFANTEMGCSQADVVEFYANVALDGEVLSSTVNGVLIEVDAQALGVILGVPATGFDLYVREDKSLLGRDRLLELSRHLSQQPGLRSPISVKKE*
Ga0058701_1044421623300010395AgaveVVREKLVRVSYFQEQGMEVFLEKLRAQGWLELFTNTQMGCSQPDVAELYANVALFGDVLCSTVNGVEIQVDAQAIGVILGVPSSGFDLYVREDKSLLGRDRLLELSQHLS*
Ga0058701_1046062613300010395AgaveVVPSPKLEKFQKRGVVRGKIVRVSYLQDQGLEVFLDKLRAQGWYELFTNTQLGCSQPDVAEFYANVALHGDVLSSTVNGVLIEVNAQALGGILGVPATGFDLYVREDKSLLSRDRLLELSQHLSQQPGLRS
Ga0058701_1046300613300010395AgaveVTPSAKLEKFQRRGIVRGKIVKASYFHDQGLGVFLDKLQDQGWFELFANTELGCSQPDVVEFYANVALHEEVLSSTVNGVLIEVDAQALGVILGVSATGFDLYVWEDKGLLGRDRLLELSRHLSQQPGLRSPQSVKKGDMQPLHQL
Ga0058701_1048337923300010395AgavePSAKRAKSEVAPSPKLEKFQKRGVVRGKLVKVSHFQEQGLEVFLDKLKAQGWFELFTNTQMGCSQPNVAEFYANVLLSGDVLSSTVNGVLIKVDARALGVILGVPATGFDLYVREDKSLLSKARLLELAQHLSQ*
Ga0058701_1050467123300010395AgaveLVQVRYFQEQGLKVFLDKLKAQGWFELFTNTQMGCSQPDVAKFYANVSLSGDVLTSTMNGVLLEVDARALGVILEVPATGFNLYVREDKPLLSRARLLELAQHLSQQPGLRSP
Ga0058701_1050830423300010395AgaveMRGKIVKVGYFREQGLEVFLDKLRAQGWLELFTNTPMGCSQPDLAEFYANVTVSEGLLTSKVNGVLIEVDARALGVILGVPATGFDLYVRQDKSLLGKAKLLELAQHLSEQPGLKHPQDVKKGDIQPLHQL
Ga0058701_1050832523300010395AgaveGVVRGKLVKVSYFQEQGLEVFLDKLKPQGWYELFTNTQMGCSQPDVAEFYANVVLSGGVLSSIVNGVLIEVDTQALGAILGVPAKDFDLYVREDKSLLIKARLLELAQQLSQ*
Ga0058701_1052925813300010395AgaveMVRGKIVRVSYFQDQGLEVFLDKLKAQGWYELFTNTQLGCSQPDAAEFYANVTLHGDVSTSTVNGVLIEVNAQAFGVILGVPVTGFDLYVREDKSLLSRDRMLELSRHLSQQP
Ga0058701_1052933023300010395AgaveLEKFLKRGVVMGKIVKVGYFQEQGLEMFLDKLKAQRWFELFTNTQLGCSQPDVAEFYANVSVSDDVLTGTLNGVLIEVDARALGVILGIPVTGFDLYIREEKSLLGKARLLQLAQQLSQQPWLKNSQAVKKGDMQPLHQLIFWLTIKNIIP
Ga0058701_1055105123300010395AgaveVVRGKLVKVSYFQEQGLDVFLDKLKAQGLFELFTNTQMGCSQPDVAKFYANVSLSEGVLSSTVNGVLIEVNARALGVILGVPTTGFDLYVREDKSLLGKERLLELAQRLSQ*
Ga0058701_1055561013300010395AgaveMFQKRGVVRGKLVKVSYFQEQGLEVFLEKLKAQGWFELFSNTQMGCSQSDVVEFYANVALSGDVLTSTVNGMPIEVNAQALGVILGVPATGFDLYVREDKFLLSKARMLELAQHLSQQPGLRTPQSVKKGDIQPLHQLLFWFIIKNIIPRAQGRNQ
Ga0058701_1058894513300010395AgaveVVRGKLVKVSYFQEPRLEVFLDKLKAQGWYELFTNTQMGCSQPDVAEFYANVALFGDVLTSTVNRVLIEMNAQALGVILGVPATGFDLYVREDKFLLSKARLLELAQYLSQQPGLRSPQVVKKGNMQPLHQLLFWFIIKNIIPRA
Ga0058701_1058944913300010395AgaveLEKFLKRGVVTGKIVKVGYFREQGLEVFLDELKAQRWFELFINTPMGCSQPNVTEFYANVTVSEGLLTSTVNGVLIEDDARALGVILEVPVTCFDLYVREDKSLLGKTKPLVLAQHLSQQPGLKQP*
Ga0058701_1061254623300010395AgaveVVRGKLVRVSYFQDQGLEVFLETLRAQGWYELFTNTQLGCSQPDVVEFYANVALHGDVLSSIVNEVLIEVNAQALGVILRVPSTGFDLYVREDKSLLGRDRLLELSQHLSQQPGL*
Ga0058701_1061973813300010395AgaveEAQPTKSSVEPSVKQAKSEVAPSPKLEKFQKRGVVRGKLVKVSYFQEQGLEVFLDKLKAQGWFELFTNTQMGCSPPDVAEFYANVSLSGDVLSSTMNGVLIEVDARALGVILGVPATRFDLCVREDKSLLSKLELAQHLHQ*
Ga0058701_1062429713300010395AgaveRPKSAVAPSPKLEKFQKRGVVRGKLVRVSYFHDQGLEVFLDKLKAQGWYELFTNTQLGCSQPNVAEFYANVSMHGDVLSSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRDRLLELSQHLSQQPGLRSPQAVKKGDM*
Ga0058701_1062649713300010395AgaveGLEVFLEKLKAQGWFELFTNTQMGCSQLDVAEFYTNVSLSGGVLSNTVNRLLIEVDAQALGVILGVPATGFDLYIREDKSLLSRARLLELAQHLSQQSWLRSPQAVKILWNI*
Ga0058701_1066110313300010395AgaveLEKFQKRGVVKVKLVKVSYFQEQGLEVFLDKLKAQGWFELFTNTQMGCSQSDVAEFYANVSLSRGVLSSTVNGVLIEVDARTLGVILRVPATDFDLYIREDKSLLGRDRLLELAQHLSQQPGLRSPQSVKK
Ga0058701_1066802513300010395AgaveAEEPSSKRAKSAVAPSAKLEKFLKRGVVRGKLVKVGYFREQGLEVFLDKLRAQGWLELFTNTQLGCSQPDLAEFHANVSVSEGLLTIMVNGVLIEVDGRALGVILGVLATSFDLYVQEDKSLLSKARLLELAQHLSQQLGLKNPQAVKKGDM*
Ga0058701_1067774523300010395AgaveKLVKVSYFQEQGLEVFLDKLKAQGWFGLFTNTQMGCSQPDVAEFYANVSLSGDVLTSTVNGVLIEVDARALGVILGVPATGFDLYVREDKSLLSKLELAQHLHQQPGLTSPQAVKKGDMQPLHQLLF*
Ga0058701_1068205623300010395AgaveVTPSARLEKFQRRGIVRGKVVKASYFQDQGLEVFLDKLQAQGWFELFANTELGCSQLDVVEFYANVALHGEVLSSTVNGVLIVVDDQALGVILGVSATGFDLYVRQDKSLLGRDRLLELSRHLSQQPGLRSPISVKK
Ga0058701_1068274613300010395AgaveVVPSPKLEKFEKRGVVRGKVVKASYFHDQGLEVFLDKLRAQGWYELFANTQLGCSQPDVAEFYANVALHGKVISSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRDRLLELSQHLSQQPGLRSPQAVKK
Ga0058701_1074100123300010395AgaveVTPSAKLEKFQRRGIVRGKIVKASYFQDQGLEVFLDKLQTQGWFELFANTELGCSQADVVEFYANVALHGEVLSSTVNGVLILGVPATGFDLYVREDKSLLGRDRLLELSRHLSQQPGLRSPISVKK
Ga0058701_1077649013300010395AgaveSPATKSPAKPSGKRVKTAVAPSPKLEKFQKRGVVRGKLVRVSYFQEQGLAVFLEKLRAQGWLELFTNTQMGCSQPNVAEFYANVYLSGDVLCSTVNGVEIQVAAHALGVILGVPSTGFDLYVREDKSLLGRDRLL*
Ga0058701_1078556513300010395AgaveKVSYFQEQGLEVFLDKLKAQGWYELFTNTQMGCSQPDVAEFYANVALVGDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLMSKARLLELAQHLSQQPGLRSPQAVKKGDMQPLH*
Ga0058701_1080512713300010395AgaveGKIVREKFFQDQGLEVFLAKLKAQGWYELFTNTQLVCSQPDVAEFYANVSLHGDVISSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRERLVELSRHLSQQPGLRSPQAVKKGDMQPLHQLLF*
Ga0058701_1081932713300010395AgaveLIKVSYFQEQGLEVFLDKIKAQGWYEPFTNTQMGCSQPDVAEFYANVVLSGDVLTSTVNGVLVEVNAQALGVILGVPAIGFDLYVREDKSLLSKARMLELAQHLSQQP
Ga0209796_1016751213300027766AgaveVAPSPKLEKFQKRGVVRGKIVRVSYFQDQGLEVFLKKLRAQGWYELFTNTQLGCSQPDVAEFYANVALHRDVLSSTVNGVLIEVNAQALGVILGVPATGFDLYVRQDKSLLSRDRLLELSQHLSQQPGLR
Ga0268246_1002151223300030495AgaveVGYFREQELEVFLDKLRAQGWLELFTNTPMGCSQPDLAEFYANVMVSEGLQTSTVNGVLIELDARALGVILGFPATDFDLYVQEDKSLLSKAKLLELAQHSSQQPGLKHPQAVKKGDM
Ga0268246_1005349333300030495AgaveVRGKIVKASYFHDQGLGVFLDKLQAQGWFELFANTELGCSQADVVEFYANVALHGEVLSSTVNEVLIEVDAQALGVILGVPPTGFDLYVQEDKGLLGRDRLLELSRHLSQQPGL
Ga0268246_1009046213300030495AgaveLVQVRYFQEQGLKVFLDKLKAQGWFELFTNTQMGCSQPDVAKFYANVSLSGDVLTSTMNGVLLEVDARALGVILGVPATGFNLYVREDKPLLSRARLLELAQHLSQQPGLRSPQ
Ga0268246_1010057813300030495AgaveVRGKLVRVSYFQEQGLKVFLEKLRAQGWLKLFTNTQMGCSQPDVVEFYANVSLSGGVLCSTVNGVMIEVDAQALGVILGVPSTGFDLYVREDKSLLGRDRLLELSQHLSQQPG
Ga0268246_1010528613300030495AgaveVAPSPKLEKFQKRGVVRGKLIKVSYFQEQGLEVFLDKLKAQGWFELFINTQMGCSQPDVVEFYANVSLFGDVLTSTVNEVLIEVNAQVLGVILRVLITGFDSYVREDKSLLSKARLLELAQHLSQQPGLRSP
Ga0268246_1012995123300030495AgaveVAPSPKLEKFQKRGVVRGKLVKVSYFQEQGLEVFLDKLKAQGWYELFTNTQMGCSQPDVAEFYANVALSGDVLTSTVNGVLIEVNAQALGVIFGVPATGFDLYVREDKSLLSKARLLELA
Ga0268246_1013484913300030495AgaveVKGKIVRVKFFQDQGLELFLAKLKAQGWYELFLNTQLGCSQPDVAEFYANVSLHGDVISSSVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRERLVELSRHLS
Ga0268246_1014287513300030495AgaveVAPSPKLEKFQKRGVVRGELVKVSYFQEQGLEVFLNKLKAQGWFELFTNTQMGCFQPDVAEFYANVSLSGDVLTSTVNRVLIEVNTQALGVILRVSATGFDLYVREDKSLLSKARLLELAQHLSQQPGLRSPQVVKKGICNRSISCCSGS
Ga0268246_1018131323300030495AgaveVRGKLIKVSYFQEQGLEVFLDKLKAQGWYELFTNTQMGCSQPDVTEFYANVALAGNVLSSTVNGVLIEVNAQTLGVILGVPATGFDLYVREDKSLLGRDRLLELAQRLSQQPGLRSPQAVKKGDMQPLH
Ga0268246_1020329213300030495AgaveVALSPKLEKFQKRGVVRGKLVKVSYFQEQGLEVFLDKLKAQGWFELSTNTQMGCSQPDVAEFYANVSLSEGVLSSTVNGVLIEVDARALGVILGVPATGFDLYVREDKSLLRKAKLLELAQHLS
Ga0268246_1021119013300030495AgaveVAPSPKLEKFQKRGVVRAKLVKVSYFQEQGLEVFLDTLKAQDWYELFTNTQMGCSQPDVAEFYANVVLAGDVLTSTVNGVLIEVNAQALRVILGVPATGFDLYVQEDKCLVSKARLLELAQHLSQQPGFRSPQVVKKGHMQPLHQLLFWFVIKNIILRAQ
Ga0268246_1023895313300030495AgaveVAPSPKLEKFLKRGVVRGKIVKVGYFQEQGLEVFLDKMKAQGWFKLFTNTQLRCCQPDVAEFYANVSVSEGVLTSTVNRVLIEVDVRTLRVILGIPATGFDLYVREDKSLLGKARLLKLAQRL
Ga0268246_1025449613300030495AgaveVVRGKIVKAGYFREHGLEVFLDKLKAQGWLELFTNNPMGCSQPDVVEFYANVSVSERLLSSTVNEVLIEVDDRAPGVILGVPVIGFNLYVREDKSLLGKARLLELAQHLSQQPELKHPQVVNKGDMQPLHQLIFWFI
Ga0268246_1025693313300030495AgaveSEVAPSPKLKKFQKRGVVRGKLVKVSHFQEQGLEVFLDKLKAQGWFELFTNTQMGCSQPDVAEFYANVLLSGDVLSSTVNGVLIKVDARALGVILGVPATGFDLYVREDKSLLSKARLLELAQHLSQ
Ga0268246_1026290713300030495AgaveLTPSDKLDKFQRRGIVRGKIIRASYFHDQGLEVFLDKVQTQGWFELFANTELGCSPADVVEFYANVALHGDVLSSTVNGVLIEVDAQALGVILGVPATGFDLYVREDKSLLGRDRLLELSRNLSQQPGLRSPISVKKSDMQPIHQLLF
Ga0268247_1006143223300030498AgaveVTPSAKLEKFQKRGIVRGKILKASYFHDQGLGVFLDKLQAQGWFELFTNTQLGCSQPDVVEFYANVALHGEVLSSTVNGVLIDVDVQALGVILGVPATGFDLYVREDKGLLGRDRLLELSRHLSQQPEL
Ga0268247_1010134513300030498AgaveKSEVSPSPKLEKFQKRGVVRGKLVKVSYFQEQGLEVFLDKLKAQGWYELFTNTQMGCSQPDVAEFYANVALSGDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLSSKPRLPELAQHLSQQPRLRSPQAVKKGDMQALHQLLFWFVIKNIIPRA
Ga0268247_1012928823300030498AgaveVAPSPKLEKFQKRGVVRGKLVKVSYIQEQGLDVFLDKLKAQGWFELFTNTQLGCSQPDVAEFYANVSLSGDVLSSIVNGVLIEVDARALGVILGVPAIGFDLYVREDKSLLSKARLLELAQHLSQRPGLRSP
Ga0268247_1015898533300030498AgaveVVRGKLVKVSYFQEQGLEVFLDKLKAQGWYELFTNTQMGCSQSDVAEFYVNVALAGDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLVSKARLLELANI
Ga0268247_1016148723300030498AgaveVRVKFFQDQGLEVFLAKLKAQGWYELFTNTQLGCSQPDIAEFYANMTLHGDVISSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRERLVELSRHLSQQPGLRSP
Ga0268247_1016343623300030498AgaveVVRGKLVKVSYFQEQGLEDKLKAQGWYELFTNTYMGCSQPDVAEFYANMTLSRDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVWVDKSLLSKARMLELAQHLSQ
Ga0268247_1017077613300030498AgaveVRGKLVKVSYFQEQGMKVFLDKLKAQEWYELFTNTQMGCSQPDVTEFYVNVALSGGVLSSTVNGVLIEVDAQALGVILGVPATSFDLYVREDKSLLSKAWLLELGQQLSQQPGLTSPQAVRKGDMQPLHQLLF
Ga0268247_1017271723300030498AgaveVGYFREQELEVFLDKLRAQGWLELFTNTPMGCSQPDLAEFYANVMVSEGLQTSTVNGVLIELDARALGVILGFPATDFDLYVQEDKSLLSKAKLLELAQHSSQQPGLKHPQAVNKGDM
Ga0268247_1017343723300030498AgaveVAPSAKLEKFQKRGIVRGKIVKASYFHDQGLGVFLDKLQTQGWFELFANTELGCSQPDVVEFYANVALHGEVLSSTVNGVLIEVDDQALGVILGVPATGFDLYVREDKSLLGRDRLLELSRHLSQQPGLRSPISVKKSD
Ga0268247_1020368223300030498AgaveGVVRGKLVKVSYFQEQGLEVFLDKLKPQGWYELFTNTQMGCSQPDVAEFYANVVLSGGVLSSIVNGVLIEVDTQALGAILGVPAKDFDLYVREDKSLLIKARLLELAQQLSQ
Ga0268247_1023365913300030498AgaveVRGKIVRVSYFQDQGLEVFLGKLRAQGWYKLFTNTQLWCSQPGVTEFYANMALHGDVLSSIVNGVLIEVNAQALGVILGVPTTGFDLYVREDKSLLSRDRLLELSQHLSQQPGLRSPQAVKKGDMQRLHQLLF
Ga0268247_1023719213300030498AgaveLEKFQKWGVVREKLVKVSNFQEQGLEVFLEKLKARGWFELFTNTQMGCSQPNVAEFYANVLLSGGVLSSIVNGVLIEVDAQALEVILGVPATGFDLYVREDKFLLGRDRLLALAQHLSQQPRLRSPQSVKKGDMQPLHQLIFWFIIKNIIPRAQGRNQA
Ga0268247_1035156523300030498AgaveLVKVSYFQEQGLEVFLDKLKAQGWYELFTNTHMGCSQPDVAEFYANVALSGDVLTSTVNGVLIEVNAQVLGVILGVPAIGFDLYVREEKSLLSKARLLELTQHLSQQPGLRSPQAVKKGDMQPLYQLLL
Ga0268247_1036161813300030498AgaveVAPSPKLEQFQKRGVVRGKLVKVRYFQEQGLEVFLDKLKPQGSYELFTNTEMGCSQPDVAEFYANVALFMDVLTSTMNGVLIEVNAQALGVILGVPATEFDLYVREDKSLLSKERLLELAQGLSQQPGLRSPQAVKKGDM
Ga0268247_1037699213300030498AgaveVRVKFFQDQGLEVFLAKLKAQGWYELFTNTQLVCSQPDVAEFYANVSLHEDVISSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRERLVELSRHLSQQSELRSPQAVKKGDMQPLHQLLFWFIIKNI
Ga0268247_1038780023300030498AgaveRGKIVMVRYFQEQVLEVFFGKLKAQGWFELFTNTQLGCPQPDVAEFYANVLTSTVNGVLIEVDVRALGVILGVPTTGFDLYIQEEKSVIGKTRLLGLAQHLSQQPGLKHPQAVRRAICNCFIS
Ga0268247_1039829713300030498AgaveLERFLKRGVVRGKIVKVGYFQAQGLEVFLDKLKAQGWFELFTNTQLGCSQSDVAEFYANVSLSEGVLTSTVNGVLIEVDSRALGVILGVLAATGFDLYVREDKSLLGKAKLLELAQHLSQQPGLKSP
Ga0268247_1040328223300030498AgaveLVRVSYFQEQGLEVFLEKLRAQRWLELFTNTQMGCSQPDVAKFYANVYLSGDVLCSTVNGVEIQVDAQALGVILGVPSSGFDLYVREDKCLLGRDGLLELSQHLSQQSRLRSP
Ga0268247_1042863913300030498AgaveVAPSPKLEKFLKRGVVRGKIVKVGYFQEQGLEVSLDKLTAQGWFELFTNTQLGCSQPDVAEFYVNVSVSEGVLISMVNGVLLEVDARALGVILGIPATEFDLYVREDKFLL
Ga0268247_1043421013300030498AgaveVAPSSKLEKFQKRGVVRGKLIKVSYFQGQGLEVFLDKLKAQGWYELFTNTQMGCSQPDVAEFYANVALSGDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVQEDKSLLSKVRLLELAQRLSQQPGLRSP
Ga0268247_1047194113300030498AgaveVAPSPKLDKFLKRGVVRGKLIKVSYFQEQGLEVFLDKLKAQRWFELFTNSQLGCSQLDVAKFYANVSLSEGVLSSTVNGVLIEVDARALGVILEVPATGFDLYVREDKSLLGKAKLLELAQHLSQQPWLKSPQAVKK
Ga0268247_1047948913300030498AgaveVRVKFFQDQGLEVFLTKLKAQGWYELFSNTQLGCSQPDVAEFYVNVSLHGDVISSSVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRERLVELSRHLS
Ga0268247_1048481213300030498AgaveVREKLVRVSYFQEQGMEVFLEKLRAQGWLELFTNTQMGCSQPDVAELYANVALFGDVLCSTVNGVEIQVDAQAIGVILGVPSSGFDLYVREDKSLLGRDRLLELSQHLS
Ga0268247_1048496723300030498AgavePSAKRSKSEVALSPKLEKFQKRGVVRGKMVRVSYFQDQGLEVFLDKLRAQGWYELFTNTQLGCSQPDVAEFYANVALHGDVLSSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRDRLLELSQHLS
Ga0268247_1049980113300030498AgaveEPSAKRAKSEVAPSPKLEKFKKRGVVRGKLVKVSYFQEQGLEVFLNKLKAQGWYELFTNTQMGCSQPDVAEFYANVALSGDVLTSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSKARLLELNQHLSQQPGLRSSQAVKKGDMQLLHQLLFWFITENIIPRAQGRNQADAMDHCL
Ga0268247_1051218513300030498AgaveTQPAAERSVERAKPEVAPSPKLEKFLKRGVVRGKVVKVSYVQEQGLEVFLDKLKAQGWFELFTNTQLGCSQPNVAEFYANVSLSEGVLSSTVNGVLIEVDSRALGVILGVPATGFDLYVREDKPLLGKAKLLKLAQRLSQQLGLKSPQVVKKGDMQPLL
Ga0268247_1051483513300030498AgaveMVSYFQEQGLEVFLDEIKAQGWYELFTNTQMGCSQPDMAEFYANVALCGDVLTSTVNGVLIKVNAQTLGVILGVPATGFDLYVREDKSLLSKARLLELAQRLSQQPGLRSPQVVKKGDMQFVQ
Ga0268247_1054790013300030498AgaveLEKFLKRGVVRGKIVKVGYFQEQGLEVFLDKMKAQGWFKLFTNTQLRCCQPDVAEFYANVSVSEGVLTSTVNRVLIEVDVRTLRVILGIPATGFDLYVREDKSLLGKARLLKLAQRLSQQLGLKNP
Ga0268247_1055525623300030498AgaveVRGKVVKASYFQDQGLEVFLDKLQAQGWFELFANTELGCSQPDVVEFYANVALHGEVLSSTVNGVLIEVDDQALGVILGVPATGFDLYVREDKSLLGRDRLLELSRHLSQQPGLRSP
Ga0268247_1056106323300030498AgaveKRGVVRGKLVEVSYFKEQGLDVFLDKLKAQGWFELFTNTQMGCSQPDVAEFYANVSLSEGVLSSIVNGVLIDIDARALGVNLGVPATGFDLYVREDKSLLGKERLLELAQRLSQQPGLRSPQSVKKGDMQPLHQLIF
Ga0268254_1018463623300030515AgaveVAPSPKLEKFQKRGVVRGKIVRVSYFQDQGLEVFLKKLRAQGWYELFTNTQLGCSQPDVAEFYANVALHGDVLSSTVNGVLIEVNAQALGVILGVPATGFDLYVREDKSLLSRDRLLELSQHLGR
Ga0268254_1022683123300030515AgaveVRGKLVKMSYFQEQGLEVFLDKLKAQGWFELFTNTQLGCSQPDMAEFYANVSLSGNMLSSIVNGVLIEVDVRALGVILGVPAIGLDLYVREDKSLLSKARLLELAQHLSQQPGLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.