Metagenome / Metatranscriptome Family F064334

Overview

Basic Information

• Family ID: F064334
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 128
• Average Sequence Length: 40 residues
• Representative Sequence: MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSYGSDE
• Number of Associated Samples: 81
• Number of Associated Scaffolds: 128

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 5.47 %
• % of genes near scaffold ends (potentially truncated): 54.69 %
• % of genes from short scaffolds (< 2000 bps): 100.00 %
• Associated GOLD sequencing projects: 81
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (63.281 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (64.062 % of family members)
• Environment Ontology (ENVO): Unclassified (89.062 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (85.938 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 0.00%
  Coil/Unstructured: 100.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 128 Family Scaffolds
PF00078	RVT_1	0.78
PF00665	rve	0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 128 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.78
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.78
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.78
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.78

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
All Organisms	root	All Organisms	36.72 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
cellular organisms	root	All Organisms → cellular organisms	36.72 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	36.72 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	36.72 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	36.72 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	36.72 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	36.72 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	36.72 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	36.72 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	36.72 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	36.72 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	36.72 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	35.94 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.78 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	35.94 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.78 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	35.94 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.78 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	35.94 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.78 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	35.94 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.78 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	35.94 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.78 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	35.94 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.78 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	35.94 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.78 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	35.94 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.78 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	35.16 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	0.78 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	35.16 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	0.78 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	35.16 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	0.78 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	35.16 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	0.78 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	35.16 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	0.78 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	63.28 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	35.16 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	0.78 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005445|Ga0070708_101815410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	566
3300005841|Ga0068863_101305336	Not Available	732
3300005842|Ga0068858_100940982	Not Available	845
3300009177|Ga0105248_12535981	Not Available	584
3300009177|Ga0105248_13329738	Not Available	511
3300009553|Ga0105249_11883959	Not Available	671
3300009553|Ga0105249_13447201	Not Available	509
3300009981|Ga0105133_132096	Not Available	503
3300009990|Ga0105132_119595	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	657
3300009990|Ga0105132_128465	Not Available	589
3300009990|Ga0105132_134441	Not Available	554
3300009990|Ga0105132_136724	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	542
3300009992|Ga0105120_1015523	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	795
3300009994|Ga0105126_1029224	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	641
3300010401|Ga0134121_11934310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	620
3300010401|Ga0134121_12095723	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	600
3300014325|Ga0163163_12118486	Not Available	622
3300014968|Ga0157379_11552757	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	645
3300015270|Ga0182183_1051746	Not Available	612
3300015270|Ga0182183_1060066	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	584
3300015270|Ga0182183_1071926	Not Available	552
3300015270|Ga0182183_1081453	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	529
3300015278|Ga0182099_1035937	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	617
3300015280|Ga0182100_1041878	Not Available	677
3300015284|Ga0182101_1055930	Not Available	616
3300015301|Ga0182184_1036554	Not Available	709
3300015301|Ga0182184_1053530	Not Available	626
3300015309|Ga0182098_1066144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	636
3300015309|Ga0182098_1082390	Not Available	590
3300015309|Ga0182098_1088072	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	576
3300015311|Ga0182182_1044268	Not Available	719
3300015313|Ga0182164_1092752	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	586
3300015313|Ga0182164_1109442	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	550
3300015315|Ga0182120_1067693	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	664
3300015316|Ga0182121_1105238	Not Available	576
3300015316|Ga0182121_1105277	Not Available	576
3300015316|Ga0182121_1134765	Not Available	520
3300015316|Ga0182121_1137014	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	516
3300015317|Ga0182136_1104848	Not Available	566
3300015319|Ga0182130_1036261	Not Available	801
3300015320|Ga0182165_1040454	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	814
3300015324|Ga0182134_1118936	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	549
3300015324|Ga0182134_1125692	Not Available	537
3300015326|Ga0182166_1087390	Not Available	611
3300015326|Ga0182166_1126357	Not Available	531
3300015327|Ga0182114_1148631	Not Available	521
3300015328|Ga0182153_1031402	Not Available	887
3300015328|Ga0182153_1071448	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	673
3300015328|Ga0182153_1146850	Not Available	511
3300015329|Ga0182135_1089076	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	626
3300015329|Ga0182135_1112180	Not Available	573
3300015331|Ga0182131_1002525	Not Available	1831
3300015331|Ga0182131_1022555	Not Available	1002
3300015331|Ga0182131_1073065	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	678
3300015331|Ga0182131_1137363	Not Available	530
3300015332|Ga0182117_1007328	Not Available	1500
3300015332|Ga0182117_1138677	Not Available	549
3300015335|Ga0182116_1103615	Not Available	639
3300015335|Ga0182116_1117319	Not Available	606
3300015335|Ga0182116_1123219	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	594
3300015336|Ga0182150_1070498	Not Available	704
3300015337|Ga0182151_1151576	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	523
3300015338|Ga0182137_1123468	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	592
3300015338|Ga0182137_1175006	Not Available	507
3300015339|Ga0182149_1079907	Not Available	691
3300015339|Ga0182149_1159357	Not Available	522
3300015339|Ga0182149_1167594	Not Available	511
3300015340|Ga0182133_1190981	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	503
3300015348|Ga0182115_1220815	Not Available	606
3300015348|Ga0182115_1270717	Not Available	538
3300015349|Ga0182185_1135272	Not Available	727
3300015350|Ga0182163_1103775	Not Available	864
3300015352|Ga0182169_1234584	Not Available	598
3300015352|Ga0182169_1251124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	575
3300015352|Ga0182169_1252892	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	572
3300015352|Ga0182169_1267684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	554
3300015352|Ga0182169_1274687	Not Available	546
3300015353|Ga0182179_1299255	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	523
3300015354|Ga0182167_1162586	Not Available	823
3300015354|Ga0182167_1207166	Not Available	716
3300015354|Ga0182167_1350520	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	516
3300017408|Ga0182197_1090558	Not Available	612
3300017412|Ga0182199_1071754	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	752
3300017414|Ga0182195_1063218	Not Available	816
3300017421|Ga0182213_1235053	Not Available	525
3300017422|Ga0182201_1066684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	657
3300017422|Ga0182201_1137811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	511
3300017435|Ga0182194_1058177	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	722
3300017439|Ga0182200_1110445	Not Available	579
3300017440|Ga0182214_1092462	Not Available	639
3300017440|Ga0182214_1160834	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	502
3300017445|Ga0182198_1014759	Not Available	1254
3300017447|Ga0182215_1122773	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	588
3300017691|Ga0182212_1099191	Not Available	653
3300017694|Ga0182211_1159598	Not Available	538
3300020033|Ga0182146_101183	Not Available	848
3300025972|Ga0207668_11989382	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	524
3300026095|Ga0207676_12004143	Not Available	578
3300026095|Ga0207676_12214775	Not Available	548
3300028049|Ga0268322_1007216	Not Available	946
3300028050|Ga0268328_1023044	Not Available	748
3300028051|Ga0268344_1004170	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	867
3300028052|Ga0268300_1004760	Not Available	788
3300028053|Ga0268346_1015379	Not Available	702
3300028054|Ga0268306_1011561	Not Available	716
3300028055|Ga0268338_1020004	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	650
3300028055|Ga0268338_1022699	Not Available	625
3300028056|Ga0268330_1012765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	862
3300028056|Ga0268330_1057962	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	517
3300028056|Ga0268330_1060154	Not Available	510
3300028056|Ga0268330_1060563	Not Available	509
3300028058|Ga0268332_1041786	Not Available	637
3300028058|Ga0268332_1043941	Not Available	626
3300028061|Ga0268314_1003942	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1203
3300028061|Ga0268314_1049200	Not Available	521
3300028141|Ga0268326_1006037	Not Available	648
3300028143|Ga0268348_1005481	Not Available	810
3300028151|Ga0268308_1001919	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1247
3300028251|Ga0268324_1024839	Not Available	513
3300028262|Ga0268310_1043056	Not Available	538
3300028472|Ga0268315_1013362	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	632
3300028473|Ga0268319_1011500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	634
3300028474|Ga0268331_1010328	Not Available	685
3300028529|Ga0268311_1008731	Not Available	734
3300032465|Ga0214493_1072815	Not Available	818
3300032465|Ga0214493_1145673	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	550
3300032467|Ga0214488_1093898	Not Available	654
3300032758|Ga0314746_1074974	Not Available	786

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	97.66%
Environmental	Environmental	2.34%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	97.66%
Terrestrial	Environmental → Terrestrial	2.34%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	83.59%
Unclassified	Host-Associated → Plants → Unclassified	5.47%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.69%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.12%
Soil	Environmental → Terrestrial → Soil	2.34%
Roots	Host-Associated → Plants → Roots	0.78%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	83.59%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	5.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.91%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.12%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.56%
Loam	Environmental → Terrestrial → Soil → Loam	0.78%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.78%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.78%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	83.59%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	5.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.91%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.12%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.78%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.78%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	64.06%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	19.53%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	5.47%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.12%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.12%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.78%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300020033	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated
3300028052	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1	Host-Associated
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028251	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1	Host-Associated
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070708_1018154102	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	LVYSDLLLIMFPGMPSDDHNTRMTWPSVLPAGWSMEWEPSTSYDSDE*
Ga0068863_1013053362	3300005841	Switchgrass Rhizosphere	MPSDDHNNSMTWPSALPAGWTMEWEPSTSYGSDE*
Ga0068858_1009409821	3300005842	Switchgrass Rhizosphere	MFSGMLSSDQDYSSTWPSGLHAGWTMEWEPSTSYGSDE*
Ga0105248_125359812	3300009177	Switchgrass Rhizosphere	MFSGMLSNDQDNSSTWPSGLPVGWTMEWEPSTSYGLDE*
Ga0105248_133297382	3300009177	Switchgrass Rhizosphere	FSGITLEGPNTSMTWPSALPAGWTMEWEPSTSYGSDE*
Ga0105249_118839591	3300009553	Switchgrass Rhizosphere	GMLSNDPDYSSTWPSCLPAGWTMEWEPSTSYGSDE*
Ga0105249_134472011	3300009553	Switchgrass Rhizosphere	MFSGMLSNDQDNSSTWPSGLPVGWTMEWEPSTSYGSD
Ga0105133_1320961	3300009981	Switchgrass Associated	LDLLLIMFSGMLSDDQNSSSTWPSGLPAGWTMEWEPPTNHGSDE*
Ga0105132_1195951	3300009990	Switchgrass Associated	MPSDDHNNSMTWPSALPTGWTMEWEPSSSYGSDE*
Ga0105132_1284652	3300009990	Switchgrass Associated	VLVYSDLLLIMFSGMLSNDQDYSSTWSSGLPVGWTMEWEPSTSHGSDE*
Ga0105132_1344411	3300009990	Switchgrass Associated	MFSGMPSDEPNISMTWPSGLPAGWSMDWEPSTSYGSDE*
Ga0105132_1367242	3300009990	Switchgrass Associated	MFSGMLSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE*
Ga0105120_10155231	3300009992	Switchgrass Associated	GMPSDDHNNSMTWPNALPAGWTMEWEPSTSFGSDE*
Ga0105126_10292241	3300009994	Switchgrass Associated	MFLGMLSDDQNTSSTWPSALPAGWTMEWEPSTSYGSDE*
Ga0134121_119343101	3300010401	Terrestrial Soil	FSGITLDDSNNSMTWPSALPAGWTMEWEPSTSYGSDK*
Ga0134121_120957231	3300010401	Terrestrial Soil	MFSGMPSDDHNNSITWPSALPAGWTMEWEPSTSYGSDE*
Ga0163163_121184861	3300014325	Switchgrass Rhizosphere	MFSGMLSNDQDYSSTWPSGLPVGWTMEWEPSTSYGSDE*
Ga0157379_115527571	3300014968	Switchgrass Rhizosphere	MMFSGMLSDDQNTSATWPSELPAGWMMEWEPSTSYGSNELCHVRACH
Ga0182183_10517462	3300015270	Switchgrass Phyllosphere	MFSGILSDDQNTSSTWPSGLPAGWSIEWEPSTSYGLDE*
Ga0182183_10600661	3300015270	Switchgrass Phyllosphere	DLLLIMFPEMPSDDQNTSSTWPSGLPTGWSMEWEPSTSYGSDE*
Ga0182183_10719261	3300015270	Switchgrass Phyllosphere	MFSGVLSNDQDISFTWPSGLPAGWMMEWEPSTSHGSDE*
Ga0182183_10814532	3300015270	Switchgrass Phyllosphere	LLFTLILGMPSDDQNTSMTWPSALPASWSMEWEPSTSYVSDE*
Ga0182099_10359371	3300015278	Switchgrass Phyllosphere	YSDLFLIMFSGMLSDNQSTSSTWPSALPAGWMMEWEPSTSHGLDE*
Ga0182100_10418782	3300015280	Switchgrass Phyllosphere	FLGMNSEDANTSLTWPSGLPAGWSMEWEPSTSYGSDK*
Ga0182101_10559301	3300015284	Switchgrass Phyllosphere	MFPEMPSDDQNTSSTWPSGLPAGWSMEWEPSTSYGSDE*
Ga0182184_10365541	3300015301	Switchgrass Phyllosphere	MFSGMPSDDHNNSMNWPSGLPIGWSMEWEPSTSYGSDE*
Ga0182184_10535301	3300015301	Switchgrass Phyllosphere	LVTLFSGINSEDPNTSMTWPSALPASSTMKWEPSTSYGSDE*
Ga0182098_10661442	3300015309	Switchgrass Phyllosphere	LIMFSGMLSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE*
Ga0182098_10823901	3300015309	Switchgrass Phyllosphere	FSGMLSDNQDSNSTWPSGLPVGWTMEWEPSTSHGLDE*
Ga0182098_10880721	3300015309	Switchgrass Phyllosphere	MFSGMLSDDQNNSSTWPSGLPVGWSMEWEPSTSYGSDE*
Ga0182182_10442681	3300015311	Switchgrass Phyllosphere	VLVYSFLLLIMFSGMLSDDQNSSSTWPSGLPAGWMIEWEPSTSHGTDE*
Ga0182164_10927521	3300015313	Switchgrass Phyllosphere	LLMFSGMLSDNQDSSSTWPSGLPVGWTMEWEPSTSHGSDE*
Ga0182164_11094421	3300015313	Switchgrass Phyllosphere	LTMFSGMPSNDQNTSLTWPNAIPAGWSMEWEPSTSYGSNE*
Ga0182120_10676931	3300015315	Switchgrass Phyllosphere	MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSHGSDE*
Ga0182121_11052381	3300015316	Switchgrass Phyllosphere	LLIMFSGMLSDDQNTSSTWPSGLPTGWSIEWEPSTSYGLDE*
Ga0182121_11052771	3300015316	Switchgrass Phyllosphere	LLTMFLGMPSDDHNNSMTWPSALPASWTMEWEPSTSYRSNE*
Ga0182121_11347651	3300015316	Switchgrass Phyllosphere	FSEMLSDDQNTSSTWPSGLPAGWTMEWKPSTSYVSDE*
Ga0182121_11370141	3300015316	Switchgrass Phyllosphere	SDLLLTMFSGMPSNDQNTSSTWPSALPTGWSMEWEPSTSYGSDE*
Ga0182136_11048482	3300015317	Switchgrass Phyllosphere	MFSGMLSNDQDYSSTWPSGLPTGWTMEWEPSTSYGSDE*
Ga0182130_10362612	3300015319	Switchgrass Phyllosphere	TMFLGMPSDDHNNNMTWPSALPASWTMEWEPSTSYGLDE*
Ga0182165_10404542	3300015320	Switchgrass Phyllosphere	MFPEMLADDQNTSSTWPSGLPAGWSMEWEPSTSYGSDE*
Ga0182134_11189361	3300015324	Switchgrass Phyllosphere	TMFSGINLEDPNTSLTWPSVIPAGWSIEWEPSTSYGSDE*
Ga0182134_11256921	3300015324	Switchgrass Phyllosphere	MFSGLPSDDQNNSMMWPNALPTGWTMEWEQSTSFGSDE*
Ga0182166_10873901	3300015326	Switchgrass Phyllosphere	MLSNDQDINSTWPNALPASWTMEWELSTSCGSDE*
Ga0182166_11263572	3300015326	Switchgrass Phyllosphere	MFSGMLSDDQNTSSFWPSGLPAGWTMEWEPSTSYGSDE*
Ga0182114_11486311	3300015327	Switchgrass Phyllosphere	DMLLLMFSGMLSDNQDSSSTWPSGLPVGWTMEWEPSTSHGSDE*
Ga0182153_10314021	3300015328	Switchgrass Phyllosphere	MFSGLPSDDHNNSMTWPNALPGGWTMEWEPSTSFGSDE*
Ga0182153_10714481	3300015328	Switchgrass Phyllosphere	SDLFLTIFSGMPSDDHNNSITWPSALPAGWTMEWEPSTSYGSDE*
Ga0182153_11468501	3300015328	Switchgrass Phyllosphere	MFSGMLSDDQNTSSFWPSGLPAGWTMEWEPSSSYGSDE*
Ga0182135_10890761	3300015329	Switchgrass Phyllosphere	MFPGMPSDDQNTSSTWPSGLPAGWSMEWEPSTSYGS
Ga0182135_11121802	3300015329	Switchgrass Phyllosphere	MFSGMPPDDHNNSMNWPSGLPIGWSMEWEPSTSYGSDE*
Ga0182131_10025252	3300015331	Switchgrass Phyllosphere	MFSGMLSNDQDYSSTWPSGLHAGWMMKWEPSTSYGSDE*
Ga0182131_10225552	3300015331	Switchgrass Phyllosphere	MFSEMLSNDQDISSTWPNALPAGWMMEWEPSTSCGSVE*
Ga0182131_10730652	3300015331	Switchgrass Phyllosphere	LLVTLFLGMFSDDENTSSTWPSGLPAGWTMEWEPSTSYGSDE*
Ga0182131_11373631	3300015331	Switchgrass Phyllosphere	MFSGLPSDDHNNSMTWPNALPASWTMEWEPSTSFGSDE*
Ga0182117_10073281	3300015332	Switchgrass Phyllosphere	MFSGMLSNDQDSSSTWPSGLPVGWMMEWEPSTSYDSDE*
Ga0182117_11386771	3300015332	Switchgrass Phyllosphere	MFSGVLFDDQNISSTWPNALPADWTMEWEPSTSHGSDE*
Ga0182116_11036152	3300015335	Switchgrass Phyllosphere	MFSGMPSDDHNNSMTWPSALPAGWMMEWEPSTSYGSDE*
Ga0182116_11173191	3300015335	Switchgrass Phyllosphere	SDLFLIMFSGMLSNDQDSSSTWPSGLPVGWMMEWEPSTSYDSDE*
Ga0182116_11232191	3300015335	Switchgrass Phyllosphere	MFSGMLSDDQNISSTWPSALPAGWTMEWEPSTSYGSDE*
Ga0182150_10704981	3300015336	Switchgrass Phyllosphere	FSGMNSEDPNTSITWPSALPAGWTIEWEPPTSYGSDE*
Ga0182151_11515761	3300015337	Switchgrass Phyllosphere	MFLEMLSDDQNTSSTWPSGLPAGWTMEWEPSTSHGSDE*
Ga0182137_11234681	3300015338	Switchgrass Phyllosphere	MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSHGLDE*
Ga0182137_11750061	3300015338	Switchgrass Phyllosphere	MLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE*
Ga0182149_10799071	3300015339	Switchgrass Phyllosphere	MLSNDQDYSSTWPSGLPVGCTMEWEPSTSYGSDE*
Ga0182149_11593571	3300015339	Switchgrass Phyllosphere	QECFSNDQDYSSTWPSGLPVGWTMEWEPSTSYGSDE*
Ga0182149_11675941	3300015339	Switchgrass Phyllosphere	MFSGMLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE*
Ga0182133_11909811	3300015340	Switchgrass Phyllosphere	MFSDDENTSSTWPSGLPAGWTMEWEPSTSYGSDE*C
Ga0182115_12208151	3300015348	Switchgrass Phyllosphere	FSGITLEDSNNSMTCPSALPAGWTMEWEPSTSYGSNE*
Ga0182115_12707171	3300015348	Switchgrass Phyllosphere	MFSGLPSDDHNNSMTWPNALPADWMMEWEPSTSFGSDE*
Ga0182185_11352721	3300015349	Switchgrass Phyllosphere	LVLVYSFLLLIMFSGMLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE*
Ga0182163_11037752	3300015350	Switchgrass Phyllosphere	LLLTMFSGMPSDDHNNSMTWPSALPAGWTKEWEPSTSYGLDE*
Ga0182169_12345841	3300015352	Switchgrass Phyllosphere	MFSGMLSDDQNTSSTWPSGLPAGWSIEWEPSTSYGLDE*
Ga0182169_12511241	3300015352	Switchgrass Phyllosphere	MFSGMFSDDQNTSSTWPSGLPAGWTMEWEPSTSYGSDE*
Ga0182169_12528921	3300015352	Switchgrass Phyllosphere	TDLPVTLFSGMNSEDPNTSMTWPSALPAGWTMEWEPSTSYGSDE*
Ga0182169_12676841	3300015352	Switchgrass Phyllosphere	MLSDDPNTSLTWPSTIPVGWSMEWEPSTTSYGSDERCH
Ga0182169_12746872	3300015352	Switchgrass Phyllosphere	SEDLNTSMFGPSALPASWMMEWEPSNSFGSDEYLS*
Ga0182179_12992551	3300015353	Switchgrass Phyllosphere	MFSGMLSDDQNTSSTWPSGLPAGWTMEWEPSTSHGSDE*
Ga0182167_11625861	3300015354	Switchgrass Phyllosphere	VYSDLLLIMFSGMLSNDHDYSSTWPSCLPAGWTMEWEPSTSYGSDE*
Ga0182167_12071661	3300015354	Switchgrass Phyllosphere	MFSGMLSNDQDNSSTWPSGLPVGWMMEWEPSTSYGSDE*
Ga0182167_13505202	3300015354	Switchgrass Phyllosphere	MFSGMLSDDQNTSLTWPSDLPAGWTMEWEPSTSYGSDE*
Ga0182197_10905582	3300017408	Switchgrass Phyllosphere	MFSGMPSDDHNNSMTWPSALPAGWTMGWEPSTSYGSDE
Ga0182199_10717541	3300017412	Switchgrass Phyllosphere	MFSGMPSDDHNNSMTWPSALPAGWTMEWEPSTSYGLDE
Ga0182195_10632181	3300017414	Switchgrass Phyllosphere	VYSDLLLIMFSGMLFDNQNTSSTWPSPLPVGWMEWEPSTSHGSDE
Ga0182213_12350531	3300017421	Switchgrass Phyllosphere	MFSGMPADDHNNSMNCPSGLPIGWSMEWEPSTSYGSDE
Ga0182201_10666841	3300017422	Switchgrass Phyllosphere	MFLGMLSDDQNTSSTWPSALPAGWTMEWEPSTSHGSDE
Ga0182201_11378111	3300017422	Switchgrass Phyllosphere	DLLLIMFPGMPSDDHNTSMTWPSVLPAGWSMEWEPSTSYDSDE
Ga0182194_10581772	3300017435	Switchgrass Phyllosphere	MFSGMLSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE
Ga0182200_11104451	3300017439	Switchgrass Phyllosphere	SDLLLTMFSGMLSDDQNTSSFWPSGLPAGWTMEWEPSTSYGSDE
Ga0182214_10924621	3300017440	Switchgrass Phyllosphere	LYPYMGQSCLVLVYSDLLLIMFSGMLPNDQDSSSTWPSGLPVGWTMEWEPSTSHGSDE
Ga0182214_11608342	3300017440	Switchgrass Phyllosphere	MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSYGSDE
Ga0182198_10147592	3300017445	Switchgrass Phyllosphere	IMFSGMLSDDQNTSSTWPSGLPTGWMMEWESSTSYGSDE
Ga0182215_11227731	3300017447	Switchgrass Phyllosphere	MFSGMPSDDHNNSMTWPSALPVGWTMEWEPSTSYGSDE
Ga0182212_10991911	3300017691	Switchgrass Phyllosphere	MFSGMLSNDQDNSSTWPSGLPVGWMMEWEPSTSYGSDE
Ga0182211_11595982	3300017694	Switchgrass Phyllosphere	MFSGMLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE
Ga0182146_1011831	3300020033	Switchgrass Phyllosphere	SDLLLIMFSGVLSNDQDISSTWPSGLPAGWTMEWEPSTSYGSDE
Ga0207668_119893821	3300025972	Switchgrass Rhizosphere	MFSGMPADDHNNSMNWPSGLPIGWSMEWEPSTSYGSNE
Ga0207676_120041431	3300026095	Switchgrass Rhizosphere	MFSEILSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE
Ga0207676_122147751	3300026095	Switchgrass Rhizosphere	MFSGMLSDNQNTSSTWPSALPAGWTMEWEPSTSHGSDE
Ga0268322_10072161	3300028049	Phyllosphere	VLVYSDLFLIMCSGMLSNDQDSSSTWPSGLPVGWMMEWEPSTSYDSDE
Ga0268328_10230441	3300028050	Phyllosphere	MFSGVLSNDQDISSTWPNALPAGWTMEWELSTSHGSDE
Ga0268344_10041702	3300028051	Phyllosphere	VYSDLLLIMFSGMPSDDHNNSMTRPSALSAGWTMEWEPSTSYGSDE
Ga0268300_10047601	3300028052	Phyllosphere	MFSGMLSNDQDYSSTWPSGLPTGWTMEWEPSTSYGS
Ga0268346_10153792	3300028053	Phyllosphere	VLVYSDLLLTMFSGMLSDDQNTSSFWPSGLPAGWTMEWELSTSYGSDE
Ga0268306_10115611	3300028054	Phyllosphere	MFSGMLSDDQNTSSTWPSGLPAGWSIEWEPSTSYGLDE
Ga0268338_10200041	3300028055	Phyllosphere	MFSGLPSDDQNNSMTWPNALPTGWTMEWEQSTSFGSDE
Ga0268338_10226991	3300028055	Phyllosphere	MFLGMLSNDQDYSSTWPSGLPVGWTMEWEPSTSYGSDE
Ga0268330_10127651	3300028056	Phyllosphere	SDLPVILFSGITLEGPNTSMTWPSALPAGWTMEWEPSTSYGSDE
Ga0268330_10579621	3300028056	Phyllosphere	YSDLLVTLFLGMFSDDENTSSTWPSGLPAGWTMEWEPSTSYGSDE
Ga0268330_10601541	3300028056	Phyllosphere	MFSGMLSDDQNSSSTWPSGLPAGWMIEWEPSTSHGTDE
Ga0268330_10605631	3300028056	Phyllosphere	SDLLLIMFSGMLSNDQDNSSTWPSGLPVGWMMEWEPSTSYGSDE
Ga0268332_10417862	3300028058	Phyllosphere	LLKMFSGMLFDNQNTSSTWPSPLPVGWMEWEPSTSHGSDE
Ga0268332_10439412	3300028058	Phyllosphere	GMPADDHNNSMNWPSGLPIGWSMEWEPSTSYGSNE
Ga0268314_10039421	3300028061	Phyllosphere	MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSHGLDE
Ga0268314_10492002	3300028061	Phyllosphere	MFSEMLSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE
Ga0268326_10060372	3300028141	Phyllosphere	MFSEMLSDDQNTSSTWPNALPVGWTMEWEPSTSHGSDE
Ga0268348_10054811	3300028143	Phyllosphere	MFSGMLSNDQDSSSTWPSGLPVGWMMEWEPSTSYDSDE
Ga0268308_10019191	3300028151	Phyllosphere	DLPVILFSGITLEGPNTSMTWPSALPAGWTMEWEPSTSYGSDE
Ga0268324_10248391	3300028251	Phyllosphere	MFSGMPSDDHNNSMTWPSALPAGWTMEWEPSTSYGSDE
Ga0268310_10430562	3300028262	Phyllosphere	MFSGVLSNDQDISFTWPSGLPAGWMMEWEPSTSHGSDE
Ga0268315_10133621	3300028472	Phyllosphere	GMNSEDPNTSMTWPSTLPAGWMMEWEPSTSHGSDE
Ga0268319_10115002	3300028473	Phyllosphere	MFLGMLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE
Ga0268331_10103281	3300028474	Phyllosphere	LLLIMFSGLLSNDQDYSSIWPSGLPVGWTMEWEPSTSHGSDE
Ga0268311_10087311	3300028529	Phyllosphere	MFSGLPSDDHNNSMTWPNALPGGWTMEWEPSTSFGSDE
Ga0214493_10728151	3300032465	Switchgrass Phyllosphere	MFSGMLSNDQDYSSTWPSGLHAGWTMEWEPSTSYGSDE
Ga0214493_11456731	3300032465	Switchgrass Phyllosphere	LFSGITLEDSNNSITWPSALPAGWTMEWEPSTSYGSDE
Ga0214488_10938981	3300032467	Switchgrass Phyllosphere	FSGVLSNDQDISSTWPSGLPAGWTMEWEPSTSHGPNE
Ga0314746_10749742	3300032758	Switchgrass Phyllosphere	MLLLMFSGMLSDNQDSNSTWPIGLPVGWTMEWEPSTSHGLDE