| Basic Information | |
|---|---|
| Family ID | F064334 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSYGSDE |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.47 % |
| % of genes near scaffold ends (potentially truncated) | 54.69 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.281 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (64.062 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.062 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (85.938 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 0.78 |
| PF00665 | rve | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.78 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.78 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.78 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.28 % |
| All Organisms | root | All Organisms | 36.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005445|Ga0070708_101815410 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 566 | Open in IMG/M |
| 3300005841|Ga0068863_101305336 | Not Available | 732 | Open in IMG/M |
| 3300005842|Ga0068858_100940982 | Not Available | 845 | Open in IMG/M |
| 3300009177|Ga0105248_12535981 | Not Available | 584 | Open in IMG/M |
| 3300009177|Ga0105248_13329738 | Not Available | 511 | Open in IMG/M |
| 3300009553|Ga0105249_11883959 | Not Available | 671 | Open in IMG/M |
| 3300009553|Ga0105249_13447201 | Not Available | 509 | Open in IMG/M |
| 3300009981|Ga0105133_132096 | Not Available | 503 | Open in IMG/M |
| 3300009990|Ga0105132_119595 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 657 | Open in IMG/M |
| 3300009990|Ga0105132_128465 | Not Available | 589 | Open in IMG/M |
| 3300009990|Ga0105132_134441 | Not Available | 554 | Open in IMG/M |
| 3300009990|Ga0105132_136724 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 542 | Open in IMG/M |
| 3300009992|Ga0105120_1015523 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 795 | Open in IMG/M |
| 3300009994|Ga0105126_1029224 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 641 | Open in IMG/M |
| 3300010401|Ga0134121_11934310 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 620 | Open in IMG/M |
| 3300010401|Ga0134121_12095723 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 600 | Open in IMG/M |
| 3300014325|Ga0163163_12118486 | Not Available | 622 | Open in IMG/M |
| 3300014968|Ga0157379_11552757 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 645 | Open in IMG/M |
| 3300015270|Ga0182183_1051746 | Not Available | 612 | Open in IMG/M |
| 3300015270|Ga0182183_1060066 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 584 | Open in IMG/M |
| 3300015270|Ga0182183_1071926 | Not Available | 552 | Open in IMG/M |
| 3300015270|Ga0182183_1081453 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 529 | Open in IMG/M |
| 3300015278|Ga0182099_1035937 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 617 | Open in IMG/M |
| 3300015280|Ga0182100_1041878 | Not Available | 677 | Open in IMG/M |
| 3300015284|Ga0182101_1055930 | Not Available | 616 | Open in IMG/M |
| 3300015301|Ga0182184_1036554 | Not Available | 709 | Open in IMG/M |
| 3300015301|Ga0182184_1053530 | Not Available | 626 | Open in IMG/M |
| 3300015309|Ga0182098_1066144 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 636 | Open in IMG/M |
| 3300015309|Ga0182098_1082390 | Not Available | 590 | Open in IMG/M |
| 3300015309|Ga0182098_1088072 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 576 | Open in IMG/M |
| 3300015311|Ga0182182_1044268 | Not Available | 719 | Open in IMG/M |
| 3300015313|Ga0182164_1092752 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 586 | Open in IMG/M |
| 3300015313|Ga0182164_1109442 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 550 | Open in IMG/M |
| 3300015315|Ga0182120_1067693 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 664 | Open in IMG/M |
| 3300015316|Ga0182121_1105238 | Not Available | 576 | Open in IMG/M |
| 3300015316|Ga0182121_1105277 | Not Available | 576 | Open in IMG/M |
| 3300015316|Ga0182121_1134765 | Not Available | 520 | Open in IMG/M |
| 3300015316|Ga0182121_1137014 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 516 | Open in IMG/M |
| 3300015317|Ga0182136_1104848 | Not Available | 566 | Open in IMG/M |
| 3300015319|Ga0182130_1036261 | Not Available | 801 | Open in IMG/M |
| 3300015320|Ga0182165_1040454 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 814 | Open in IMG/M |
| 3300015324|Ga0182134_1118936 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 549 | Open in IMG/M |
| 3300015324|Ga0182134_1125692 | Not Available | 537 | Open in IMG/M |
| 3300015326|Ga0182166_1087390 | Not Available | 611 | Open in IMG/M |
| 3300015326|Ga0182166_1126357 | Not Available | 531 | Open in IMG/M |
| 3300015327|Ga0182114_1148631 | Not Available | 521 | Open in IMG/M |
| 3300015328|Ga0182153_1031402 | Not Available | 887 | Open in IMG/M |
| 3300015328|Ga0182153_1071448 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 673 | Open in IMG/M |
| 3300015328|Ga0182153_1146850 | Not Available | 511 | Open in IMG/M |
| 3300015329|Ga0182135_1089076 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 626 | Open in IMG/M |
| 3300015329|Ga0182135_1112180 | Not Available | 573 | Open in IMG/M |
| 3300015331|Ga0182131_1002525 | Not Available | 1831 | Open in IMG/M |
| 3300015331|Ga0182131_1022555 | Not Available | 1002 | Open in IMG/M |
| 3300015331|Ga0182131_1073065 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 678 | Open in IMG/M |
| 3300015331|Ga0182131_1137363 | Not Available | 530 | Open in IMG/M |
| 3300015332|Ga0182117_1007328 | Not Available | 1500 | Open in IMG/M |
| 3300015332|Ga0182117_1138677 | Not Available | 549 | Open in IMG/M |
| 3300015335|Ga0182116_1103615 | Not Available | 639 | Open in IMG/M |
| 3300015335|Ga0182116_1117319 | Not Available | 606 | Open in IMG/M |
| 3300015335|Ga0182116_1123219 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 594 | Open in IMG/M |
| 3300015336|Ga0182150_1070498 | Not Available | 704 | Open in IMG/M |
| 3300015337|Ga0182151_1151576 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 523 | Open in IMG/M |
| 3300015338|Ga0182137_1123468 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 592 | Open in IMG/M |
| 3300015338|Ga0182137_1175006 | Not Available | 507 | Open in IMG/M |
| 3300015339|Ga0182149_1079907 | Not Available | 691 | Open in IMG/M |
| 3300015339|Ga0182149_1159357 | Not Available | 522 | Open in IMG/M |
| 3300015339|Ga0182149_1167594 | Not Available | 511 | Open in IMG/M |
| 3300015340|Ga0182133_1190981 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 503 | Open in IMG/M |
| 3300015348|Ga0182115_1220815 | Not Available | 606 | Open in IMG/M |
| 3300015348|Ga0182115_1270717 | Not Available | 538 | Open in IMG/M |
| 3300015349|Ga0182185_1135272 | Not Available | 727 | Open in IMG/M |
| 3300015350|Ga0182163_1103775 | Not Available | 864 | Open in IMG/M |
| 3300015352|Ga0182169_1234584 | Not Available | 598 | Open in IMG/M |
| 3300015352|Ga0182169_1251124 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 575 | Open in IMG/M |
| 3300015352|Ga0182169_1252892 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 572 | Open in IMG/M |
| 3300015352|Ga0182169_1267684 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 554 | Open in IMG/M |
| 3300015352|Ga0182169_1274687 | Not Available | 546 | Open in IMG/M |
| 3300015353|Ga0182179_1299255 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 523 | Open in IMG/M |
| 3300015354|Ga0182167_1162586 | Not Available | 823 | Open in IMG/M |
| 3300015354|Ga0182167_1207166 | Not Available | 716 | Open in IMG/M |
| 3300015354|Ga0182167_1350520 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 516 | Open in IMG/M |
| 3300017408|Ga0182197_1090558 | Not Available | 612 | Open in IMG/M |
| 3300017412|Ga0182199_1071754 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 752 | Open in IMG/M |
| 3300017414|Ga0182195_1063218 | Not Available | 816 | Open in IMG/M |
| 3300017421|Ga0182213_1235053 | Not Available | 525 | Open in IMG/M |
| 3300017422|Ga0182201_1066684 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 657 | Open in IMG/M |
| 3300017422|Ga0182201_1137811 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 511 | Open in IMG/M |
| 3300017435|Ga0182194_1058177 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 722 | Open in IMG/M |
| 3300017439|Ga0182200_1110445 | Not Available | 579 | Open in IMG/M |
| 3300017440|Ga0182214_1092462 | Not Available | 639 | Open in IMG/M |
| 3300017440|Ga0182214_1160834 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 502 | Open in IMG/M |
| 3300017445|Ga0182198_1014759 | Not Available | 1254 | Open in IMG/M |
| 3300017447|Ga0182215_1122773 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 588 | Open in IMG/M |
| 3300017691|Ga0182212_1099191 | Not Available | 653 | Open in IMG/M |
| 3300017694|Ga0182211_1159598 | Not Available | 538 | Open in IMG/M |
| 3300020033|Ga0182146_101183 | Not Available | 848 | Open in IMG/M |
| 3300025972|Ga0207668_11989382 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 524 | Open in IMG/M |
| 3300026095|Ga0207676_12004143 | Not Available | 578 | Open in IMG/M |
| 3300026095|Ga0207676_12214775 | Not Available | 548 | Open in IMG/M |
| 3300028049|Ga0268322_1007216 | Not Available | 946 | Open in IMG/M |
| 3300028050|Ga0268328_1023044 | Not Available | 748 | Open in IMG/M |
| 3300028051|Ga0268344_1004170 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 867 | Open in IMG/M |
| 3300028052|Ga0268300_1004760 | Not Available | 788 | Open in IMG/M |
| 3300028053|Ga0268346_1015379 | Not Available | 702 | Open in IMG/M |
| 3300028054|Ga0268306_1011561 | Not Available | 716 | Open in IMG/M |
| 3300028055|Ga0268338_1020004 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 650 | Open in IMG/M |
| 3300028055|Ga0268338_1022699 | Not Available | 625 | Open in IMG/M |
| 3300028056|Ga0268330_1012765 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 862 | Open in IMG/M |
| 3300028056|Ga0268330_1057962 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 517 | Open in IMG/M |
| 3300028056|Ga0268330_1060154 | Not Available | 510 | Open in IMG/M |
| 3300028056|Ga0268330_1060563 | Not Available | 509 | Open in IMG/M |
| 3300028058|Ga0268332_1041786 | Not Available | 637 | Open in IMG/M |
| 3300028058|Ga0268332_1043941 | Not Available | 626 | Open in IMG/M |
| 3300028061|Ga0268314_1003942 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1203 | Open in IMG/M |
| 3300028061|Ga0268314_1049200 | Not Available | 521 | Open in IMG/M |
| 3300028141|Ga0268326_1006037 | Not Available | 648 | Open in IMG/M |
| 3300028143|Ga0268348_1005481 | Not Available | 810 | Open in IMG/M |
| 3300028151|Ga0268308_1001919 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max | 1247 | Open in IMG/M |
| 3300028251|Ga0268324_1024839 | Not Available | 513 | Open in IMG/M |
| 3300028262|Ga0268310_1043056 | Not Available | 538 | Open in IMG/M |
| 3300028472|Ga0268315_1013362 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 632 | Open in IMG/M |
| 3300028473|Ga0268319_1011500 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 634 | Open in IMG/M |
| 3300028474|Ga0268331_1010328 | Not Available | 685 | Open in IMG/M |
| 3300028529|Ga0268311_1008731 | Not Available | 734 | Open in IMG/M |
| 3300032465|Ga0214493_1072815 | Not Available | 818 | Open in IMG/M |
| 3300032465|Ga0214493_1145673 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 550 | Open in IMG/M |
| 3300032467|Ga0214488_1093898 | Not Available | 654 | Open in IMG/M |
| 3300032758|Ga0314746_1074974 | Not Available | 786 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 64.06% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 19.53% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 5.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.12% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020033 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028052 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070708_1018154102 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LVYSDLLLIMFPGMPSDDHNTRMTWPSVLPAGWSMEWEPSTSYDSDE* |
| Ga0068863_1013053362 | 3300005841 | Switchgrass Rhizosphere | MPSDDHNNSMTWPSALPAGWTMEWEPSTSYGSDE* |
| Ga0068858_1009409821 | 3300005842 | Switchgrass Rhizosphere | MFSGMLSSDQDYSSTWPSGLHAGWTMEWEPSTSYGSDE* |
| Ga0105248_125359812 | 3300009177 | Switchgrass Rhizosphere | MFSGMLSNDQDNSSTWPSGLPVGWTMEWEPSTSYGLDE* |
| Ga0105248_133297382 | 3300009177 | Switchgrass Rhizosphere | FSGITLEGPNTSMTWPSALPAGWTMEWEPSTSYGSDE* |
| Ga0105249_118839591 | 3300009553 | Switchgrass Rhizosphere | GMLSNDPDYSSTWPSCLPAGWTMEWEPSTSYGSDE* |
| Ga0105249_134472011 | 3300009553 | Switchgrass Rhizosphere | MFSGMLSNDQDNSSTWPSGLPVGWTMEWEPSTSYGSD |
| Ga0105133_1320961 | 3300009981 | Switchgrass Associated | LDLLLIMFSGMLSDDQNSSSTWPSGLPAGWTMEWEPPTNHGSDE* |
| Ga0105132_1195951 | 3300009990 | Switchgrass Associated | MPSDDHNNSMTWPSALPTGWTMEWEPSSSYGSDE* |
| Ga0105132_1284652 | 3300009990 | Switchgrass Associated | VLVYSDLLLIMFSGMLSNDQDYSSTWSSGLPVGWTMEWEPSTSHGSDE* |
| Ga0105132_1344411 | 3300009990 | Switchgrass Associated | MFSGMPSDEPNISMTWPSGLPAGWSMDWEPSTSYGSDE* |
| Ga0105132_1367242 | 3300009990 | Switchgrass Associated | MFSGMLSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE* |
| Ga0105120_10155231 | 3300009992 | Switchgrass Associated | GMPSDDHNNSMTWPNALPAGWTMEWEPSTSFGSDE* |
| Ga0105126_10292241 | 3300009994 | Switchgrass Associated | MFLGMLSDDQNTSSTWPSALPAGWTMEWEPSTSYGSDE* |
| Ga0134121_119343101 | 3300010401 | Terrestrial Soil | FSGITLDDSNNSMTWPSALPAGWTMEWEPSTSYGSDK* |
| Ga0134121_120957231 | 3300010401 | Terrestrial Soil | MFSGMPSDDHNNSITWPSALPAGWTMEWEPSTSYGSDE* |
| Ga0163163_121184861 | 3300014325 | Switchgrass Rhizosphere | MFSGMLSNDQDYSSTWPSGLPVGWTMEWEPSTSYGSDE* |
| Ga0157379_115527571 | 3300014968 | Switchgrass Rhizosphere | MMFSGMLSDDQNTSATWPSELPAGWMMEWEPSTSYGSNELCHVRACH |
| Ga0182183_10517462 | 3300015270 | Switchgrass Phyllosphere | MFSGILSDDQNTSSTWPSGLPAGWSIEWEPSTSYGLDE* |
| Ga0182183_10600661 | 3300015270 | Switchgrass Phyllosphere | DLLLIMFPEMPSDDQNTSSTWPSGLPTGWSMEWEPSTSYGSDE* |
| Ga0182183_10719261 | 3300015270 | Switchgrass Phyllosphere | MFSGVLSNDQDISFTWPSGLPAGWMMEWEPSTSHGSDE* |
| Ga0182183_10814532 | 3300015270 | Switchgrass Phyllosphere | LLFTLILGMPSDDQNTSMTWPSALPASWSMEWEPSTSYVSDE* |
| Ga0182099_10359371 | 3300015278 | Switchgrass Phyllosphere | YSDLFLIMFSGMLSDNQSTSSTWPSALPAGWMMEWEPSTSHGLDE* |
| Ga0182100_10418782 | 3300015280 | Switchgrass Phyllosphere | FLGMNSEDANTSLTWPSGLPAGWSMEWEPSTSYGSDK* |
| Ga0182101_10559301 | 3300015284 | Switchgrass Phyllosphere | MFPEMPSDDQNTSSTWPSGLPAGWSMEWEPSTSYGSDE* |
| Ga0182184_10365541 | 3300015301 | Switchgrass Phyllosphere | MFSGMPSDDHNNSMNWPSGLPIGWSMEWEPSTSYGSDE* |
| Ga0182184_10535301 | 3300015301 | Switchgrass Phyllosphere | LVTLFSGINSEDPNTSMTWPSALPASSTMKWEPSTSYGSDE* |
| Ga0182098_10661442 | 3300015309 | Switchgrass Phyllosphere | LIMFSGMLSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE* |
| Ga0182098_10823901 | 3300015309 | Switchgrass Phyllosphere | FSGMLSDNQDSNSTWPSGLPVGWTMEWEPSTSHGLDE* |
| Ga0182098_10880721 | 3300015309 | Switchgrass Phyllosphere | MFSGMLSDDQNNSSTWPSGLPVGWSMEWEPSTSYGSDE* |
| Ga0182182_10442681 | 3300015311 | Switchgrass Phyllosphere | VLVYSFLLLIMFSGMLSDDQNSSSTWPSGLPAGWMIEWEPSTSHGTDE* |
| Ga0182164_10927521 | 3300015313 | Switchgrass Phyllosphere | LLMFSGMLSDNQDSSSTWPSGLPVGWTMEWEPSTSHGSDE* |
| Ga0182164_11094421 | 3300015313 | Switchgrass Phyllosphere | LTMFSGMPSNDQNTSLTWPNAIPAGWSMEWEPSTSYGSNE* |
| Ga0182120_10676931 | 3300015315 | Switchgrass Phyllosphere | MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSHGSDE* |
| Ga0182121_11052381 | 3300015316 | Switchgrass Phyllosphere | LLIMFSGMLSDDQNTSSTWPSGLPTGWSIEWEPSTSYGLDE* |
| Ga0182121_11052771 | 3300015316 | Switchgrass Phyllosphere | LLTMFLGMPSDDHNNSMTWPSALPASWTMEWEPSTSYRSNE* |
| Ga0182121_11347651 | 3300015316 | Switchgrass Phyllosphere | FSEMLSDDQNTSSTWPSGLPAGWTMEWKPSTSYVSDE* |
| Ga0182121_11370141 | 3300015316 | Switchgrass Phyllosphere | SDLLLTMFSGMPSNDQNTSSTWPSALPTGWSMEWEPSTSYGSDE* |
| Ga0182136_11048482 | 3300015317 | Switchgrass Phyllosphere | MFSGMLSNDQDYSSTWPSGLPTGWTMEWEPSTSYGSDE* |
| Ga0182130_10362612 | 3300015319 | Switchgrass Phyllosphere | TMFLGMPSDDHNNNMTWPSALPASWTMEWEPSTSYGLDE* |
| Ga0182165_10404542 | 3300015320 | Switchgrass Phyllosphere | MFPEMLADDQNTSSTWPSGLPAGWSMEWEPSTSYGSDE* |
| Ga0182134_11189361 | 3300015324 | Switchgrass Phyllosphere | TMFSGINLEDPNTSLTWPSVIPAGWSIEWEPSTSYGSDE* |
| Ga0182134_11256921 | 3300015324 | Switchgrass Phyllosphere | MFSGLPSDDQNNSMMWPNALPTGWTMEWEQSTSFGSDE* |
| Ga0182166_10873901 | 3300015326 | Switchgrass Phyllosphere | MLSNDQDINSTWPNALPASWTMEWELSTSCGSDE* |
| Ga0182166_11263572 | 3300015326 | Switchgrass Phyllosphere | MFSGMLSDDQNTSSFWPSGLPAGWTMEWEPSTSYGSDE* |
| Ga0182114_11486311 | 3300015327 | Switchgrass Phyllosphere | DMLLLMFSGMLSDNQDSSSTWPSGLPVGWTMEWEPSTSHGSDE* |
| Ga0182153_10314021 | 3300015328 | Switchgrass Phyllosphere | MFSGLPSDDHNNSMTWPNALPGGWTMEWEPSTSFGSDE* |
| Ga0182153_10714481 | 3300015328 | Switchgrass Phyllosphere | SDLFLTIFSGMPSDDHNNSITWPSALPAGWTMEWEPSTSYGSDE* |
| Ga0182153_11468501 | 3300015328 | Switchgrass Phyllosphere | MFSGMLSDDQNTSSFWPSGLPAGWTMEWEPSSSYGSDE* |
| Ga0182135_10890761 | 3300015329 | Switchgrass Phyllosphere | MFPGMPSDDQNTSSTWPSGLPAGWSMEWEPSTSYGS |
| Ga0182135_11121802 | 3300015329 | Switchgrass Phyllosphere | MFSGMPPDDHNNSMNWPSGLPIGWSMEWEPSTSYGSDE* |
| Ga0182131_10025252 | 3300015331 | Switchgrass Phyllosphere | MFSGMLSNDQDYSSTWPSGLHAGWMMKWEPSTSYGSDE* |
| Ga0182131_10225552 | 3300015331 | Switchgrass Phyllosphere | MFSEMLSNDQDISSTWPNALPAGWMMEWEPSTSCGSVE* |
| Ga0182131_10730652 | 3300015331 | Switchgrass Phyllosphere | LLVTLFLGMFSDDENTSSTWPSGLPAGWTMEWEPSTSYGSDE* |
| Ga0182131_11373631 | 3300015331 | Switchgrass Phyllosphere | MFSGLPSDDHNNSMTWPNALPASWTMEWEPSTSFGSDE* |
| Ga0182117_10073281 | 3300015332 | Switchgrass Phyllosphere | MFSGMLSNDQDSSSTWPSGLPVGWMMEWEPSTSYDSDE* |
| Ga0182117_11386771 | 3300015332 | Switchgrass Phyllosphere | MFSGVLFDDQNISSTWPNALPADWTMEWEPSTSHGSDE* |
| Ga0182116_11036152 | 3300015335 | Switchgrass Phyllosphere | MFSGMPSDDHNNSMTWPSALPAGWMMEWEPSTSYGSDE* |
| Ga0182116_11173191 | 3300015335 | Switchgrass Phyllosphere | SDLFLIMFSGMLSNDQDSSSTWPSGLPVGWMMEWEPSTSYDSDE* |
| Ga0182116_11232191 | 3300015335 | Switchgrass Phyllosphere | MFSGMLSDDQNISSTWPSALPAGWTMEWEPSTSYGSDE* |
| Ga0182150_10704981 | 3300015336 | Switchgrass Phyllosphere | FSGMNSEDPNTSITWPSALPAGWTIEWEPPTSYGSDE* |
| Ga0182151_11515761 | 3300015337 | Switchgrass Phyllosphere | MFLEMLSDDQNTSSTWPSGLPAGWTMEWEPSTSHGSDE* |
| Ga0182137_11234681 | 3300015338 | Switchgrass Phyllosphere | MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSHGLDE* |
| Ga0182137_11750061 | 3300015338 | Switchgrass Phyllosphere | MLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE* |
| Ga0182149_10799071 | 3300015339 | Switchgrass Phyllosphere | MLSNDQDYSSTWPSGLPVGCTMEWEPSTSYGSDE* |
| Ga0182149_11593571 | 3300015339 | Switchgrass Phyllosphere | QECFSNDQDYSSTWPSGLPVGWTMEWEPSTSYGSDE* |
| Ga0182149_11675941 | 3300015339 | Switchgrass Phyllosphere | MFSGMLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE* |
| Ga0182133_11909811 | 3300015340 | Switchgrass Phyllosphere | MFSDDENTSSTWPSGLPAGWTMEWEPSTSYGSDE*C |
| Ga0182115_12208151 | 3300015348 | Switchgrass Phyllosphere | FSGITLEDSNNSMTCPSALPAGWTMEWEPSTSYGSNE* |
| Ga0182115_12707171 | 3300015348 | Switchgrass Phyllosphere | MFSGLPSDDHNNSMTWPNALPADWMMEWEPSTSFGSDE* |
| Ga0182185_11352721 | 3300015349 | Switchgrass Phyllosphere | LVLVYSFLLLIMFSGMLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE* |
| Ga0182163_11037752 | 3300015350 | Switchgrass Phyllosphere | LLLTMFSGMPSDDHNNSMTWPSALPAGWTKEWEPSTSYGLDE* |
| Ga0182169_12345841 | 3300015352 | Switchgrass Phyllosphere | MFSGMLSDDQNTSSTWPSGLPAGWSIEWEPSTSYGLDE* |
| Ga0182169_12511241 | 3300015352 | Switchgrass Phyllosphere | MFSGMFSDDQNTSSTWPSGLPAGWTMEWEPSTSYGSDE* |
| Ga0182169_12528921 | 3300015352 | Switchgrass Phyllosphere | TDLPVTLFSGMNSEDPNTSMTWPSALPAGWTMEWEPSTSYGSDE* |
| Ga0182169_12676841 | 3300015352 | Switchgrass Phyllosphere | MLSDDPNTSLTWPSTIPVGWSMEWEPSTTSYGSDERCH |
| Ga0182169_12746872 | 3300015352 | Switchgrass Phyllosphere | SEDLNTSMFGPSALPASWMMEWEPSNSFGSDEYLS* |
| Ga0182179_12992551 | 3300015353 | Switchgrass Phyllosphere | MFSGMLSDDQNTSSTWPSGLPAGWTMEWEPSTSHGSDE* |
| Ga0182167_11625861 | 3300015354 | Switchgrass Phyllosphere | VYSDLLLIMFSGMLSNDHDYSSTWPSCLPAGWTMEWEPSTSYGSDE* |
| Ga0182167_12071661 | 3300015354 | Switchgrass Phyllosphere | MFSGMLSNDQDNSSTWPSGLPVGWMMEWEPSTSYGSDE* |
| Ga0182167_13505202 | 3300015354 | Switchgrass Phyllosphere | MFSGMLSDDQNTSLTWPSDLPAGWTMEWEPSTSYGSDE* |
| Ga0182197_10905582 | 3300017408 | Switchgrass Phyllosphere | MFSGMPSDDHNNSMTWPSALPAGWTMGWEPSTSYGSDE |
| Ga0182199_10717541 | 3300017412 | Switchgrass Phyllosphere | MFSGMPSDDHNNSMTWPSALPAGWTMEWEPSTSYGLDE |
| Ga0182195_10632181 | 3300017414 | Switchgrass Phyllosphere | VYSDLLLIMFSGMLFDNQNTSSTWPSPLPVGWMEWEPSTSHGSDE |
| Ga0182213_12350531 | 3300017421 | Switchgrass Phyllosphere | MFSGMPADDHNNSMNCPSGLPIGWSMEWEPSTSYGSDE |
| Ga0182201_10666841 | 3300017422 | Switchgrass Phyllosphere | MFLGMLSDDQNTSSTWPSALPAGWTMEWEPSTSHGSDE |
| Ga0182201_11378111 | 3300017422 | Switchgrass Phyllosphere | DLLLIMFPGMPSDDHNTSMTWPSVLPAGWSMEWEPSTSYDSDE |
| Ga0182194_10581772 | 3300017435 | Switchgrass Phyllosphere | MFSGMLSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE |
| Ga0182200_11104451 | 3300017439 | Switchgrass Phyllosphere | SDLLLTMFSGMLSDDQNTSSFWPSGLPAGWTMEWEPSTSYGSDE |
| Ga0182214_10924621 | 3300017440 | Switchgrass Phyllosphere | LYPYMGQSCLVLVYSDLLLIMFSGMLPNDQDSSSTWPSGLPVGWTMEWEPSTSHGSDE |
| Ga0182214_11608342 | 3300017440 | Switchgrass Phyllosphere | MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSYGSDE |
| Ga0182198_10147592 | 3300017445 | Switchgrass Phyllosphere | IMFSGMLSDDQNTSSTWPSGLPTGWMMEWESSTSYGSDE |
| Ga0182215_11227731 | 3300017447 | Switchgrass Phyllosphere | MFSGMPSDDHNNSMTWPSALPVGWTMEWEPSTSYGSDE |
| Ga0182212_10991911 | 3300017691 | Switchgrass Phyllosphere | MFSGMLSNDQDNSSTWPSGLPVGWMMEWEPSTSYGSDE |
| Ga0182211_11595982 | 3300017694 | Switchgrass Phyllosphere | MFSGMLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE |
| Ga0182146_1011831 | 3300020033 | Switchgrass Phyllosphere | SDLLLIMFSGVLSNDQDISSTWPSGLPAGWTMEWEPSTSYGSDE |
| Ga0207668_119893821 | 3300025972 | Switchgrass Rhizosphere | MFSGMPADDHNNSMNWPSGLPIGWSMEWEPSTSYGSNE |
| Ga0207676_120041431 | 3300026095 | Switchgrass Rhizosphere | MFSEILSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE |
| Ga0207676_122147751 | 3300026095 | Switchgrass Rhizosphere | MFSGMLSDNQNTSSTWPSALPAGWTMEWEPSTSHGSDE |
| Ga0268322_10072161 | 3300028049 | Phyllosphere | VLVYSDLFLIMCSGMLSNDQDSSSTWPSGLPVGWMMEWEPSTSYDSDE |
| Ga0268328_10230441 | 3300028050 | Phyllosphere | MFSGVLSNDQDISSTWPNALPAGWTMEWELSTSHGSDE |
| Ga0268344_10041702 | 3300028051 | Phyllosphere | VYSDLLLIMFSGMPSDDHNNSMTRPSALSAGWTMEWEPSTSYGSDE |
| Ga0268300_10047601 | 3300028052 | Phyllosphere | MFSGMLSNDQDYSSTWPSGLPTGWTMEWEPSTSYGS |
| Ga0268346_10153792 | 3300028053 | Phyllosphere | VLVYSDLLLTMFSGMLSDDQNTSSFWPSGLPAGWTMEWELSTSYGSDE |
| Ga0268306_10115611 | 3300028054 | Phyllosphere | MFSGMLSDDQNTSSTWPSGLPAGWSIEWEPSTSYGLDE |
| Ga0268338_10200041 | 3300028055 | Phyllosphere | MFSGLPSDDQNNSMTWPNALPTGWTMEWEQSTSFGSDE |
| Ga0268338_10226991 | 3300028055 | Phyllosphere | MFLGMLSNDQDYSSTWPSGLPVGWTMEWEPSTSYGSDE |
| Ga0268330_10127651 | 3300028056 | Phyllosphere | SDLPVILFSGITLEGPNTSMTWPSALPAGWTMEWEPSTSYGSDE |
| Ga0268330_10579621 | 3300028056 | Phyllosphere | YSDLLVTLFLGMFSDDENTSSTWPSGLPAGWTMEWEPSTSYGSDE |
| Ga0268330_10601541 | 3300028056 | Phyllosphere | MFSGMLSDDQNSSSTWPSGLPAGWMIEWEPSTSHGTDE |
| Ga0268330_10605631 | 3300028056 | Phyllosphere | SDLLLIMFSGMLSNDQDNSSTWPSGLPVGWMMEWEPSTSYGSDE |
| Ga0268332_10417862 | 3300028058 | Phyllosphere | LLKMFSGMLFDNQNTSSTWPSPLPVGWMEWEPSTSHGSDE |
| Ga0268332_10439412 | 3300028058 | Phyllosphere | GMPADDHNNSMNWPSGLPIGWSMEWEPSTSYGSNE |
| Ga0268314_10039421 | 3300028061 | Phyllosphere | MFSGMLSDDQNTSSTWPSALPAGWTMEWEPSTSHGLDE |
| Ga0268314_10492002 | 3300028061 | Phyllosphere | MFSEMLSDDQNTSSTWPNALPAGWTMEWEPSTSHGSDE |
| Ga0268326_10060372 | 3300028141 | Phyllosphere | MFSEMLSDDQNTSSTWPNALPVGWTMEWEPSTSHGSDE |
| Ga0268348_10054811 | 3300028143 | Phyllosphere | MFSGMLSNDQDSSSTWPSGLPVGWMMEWEPSTSYDSDE |
| Ga0268308_10019191 | 3300028151 | Phyllosphere | DLPVILFSGITLEGPNTSMTWPSALPAGWTMEWEPSTSYGSDE |
| Ga0268324_10248391 | 3300028251 | Phyllosphere | MFSGMPSDDHNNSMTWPSALPAGWTMEWEPSTSYGSDE |
| Ga0268310_10430562 | 3300028262 | Phyllosphere | MFSGVLSNDQDISFTWPSGLPAGWMMEWEPSTSHGSDE |
| Ga0268315_10133621 | 3300028472 | Phyllosphere | GMNSEDPNTSMTWPSTLPAGWMMEWEPSTSHGSDE |
| Ga0268319_10115002 | 3300028473 | Phyllosphere | MFLGMLSDDQNSSSTWPSGLPAGWTMEWEPSTSHGSDE |
| Ga0268331_10103281 | 3300028474 | Phyllosphere | LLLIMFSGLLSNDQDYSSIWPSGLPVGWTMEWEPSTSHGSDE |
| Ga0268311_10087311 | 3300028529 | Phyllosphere | MFSGLPSDDHNNSMTWPNALPGGWTMEWEPSTSFGSDE |
| Ga0214493_10728151 | 3300032465 | Switchgrass Phyllosphere | MFSGMLSNDQDYSSTWPSGLHAGWTMEWEPSTSYGSDE |
| Ga0214493_11456731 | 3300032465 | Switchgrass Phyllosphere | LFSGITLEDSNNSITWPSALPAGWTMEWEPSTSYGSDE |
| Ga0214488_10938981 | 3300032467 | Switchgrass Phyllosphere | FSGVLSNDQDISSTWPSGLPAGWTMEWEPSTSHGPNE |
| Ga0314746_10749742 | 3300032758 | Switchgrass Phyllosphere | MLLLMFSGMLSDNQDSNSTWPIGLPVGWTMEWEPSTSHGLDE |
| ⦗Top⦘ |