NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064245

Metagenome / Metatranscriptome Family F064245

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064245
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 67 residues
Representative Sequence MKDAMDELVQKYSRQGHPSAEELIAAQGLTFPRDPKDLLGNFWPEEESTDDFLAAMREWRGHAKTDPAA
Number of Associated Samples 108
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 63.57 %
% of genes near scaffold ends (potentially truncated) 20.16 %
% of genes from short scaffolds (< 2000 bps) 68.22 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.349 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(12.403 % of family members)
Environment Ontology (ENVO) Unclassified
(36.434 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.062 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.14%    β-sheet: 0.00%    Coil/Unstructured: 61.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF01850PIN 27.91
PF01909NTP_transf_2 6.20
PF13620CarboxypepD_reg 4.65
PF04255DUF433 3.88
PF13328HD_4 2.33
PF01425Amidase 1.55
PF02245Pur_DNA_glyco 1.55
PF02897Peptidase_S9_N 1.55
PF13517FG-GAP_3 1.55
PF01717Meth_synt_2 1.55
PF16576HlyD_D23 1.55
PF05016ParE_toxin 1.55
PF13005zf-IS66 0.78
PF07394DUF1501 0.78
PF13414TPR_11 0.78
PF01258zf-dskA_traR 0.78
PF05426Alginate_lyase 0.78
PF07732Cu-oxidase_3 0.78
PF02452PemK_toxin 0.78
PF02321OEP 0.78
PF13229Beta_helix 0.78
PF10150RNase_E_G 0.78
PF05649Peptidase_M13_N 0.78
PF07244POTRA 0.78
PF07690MFS_1 0.78
PF03787RAMPs 0.78
PF07927HicA_toxin 0.78
PF02834LigT_PEase 0.78
PF13185GAF_2 0.78
PF03681Obsolete Pfam Family 0.78
PF13672PP2C_2 0.78
PF14520HHH_5 0.78
PF04851ResIII 0.78
PF17209Hfq 0.78
PF03551PadR 0.78
PF13349DUF4097 0.78
PF14403CP_ATPgrasp_2 0.78
PF04343DUF488 0.78
PF00144Beta-lactamase 0.78
PF04879Molybdop_Fe4S4 0.78
PF08545ACP_syn_III 0.78
PF00135COesterase 0.78
PF00665rve 0.78
PF02463SMC_N 0.78
PF06429Flg_bbr_C 0.78
PF03446NAD_binding_2 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 3.88
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 1.55
COG1770Protease IIAmino acid transport and metabolism [E] 1.55
COG20943-methyladenine DNA glycosylase MpgReplication, recombination and repair [L] 1.55
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.55
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 1.55
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.55
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.78
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.78
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.78
COG4584TransposaseMobilome: prophages, transposons [X] 0.78
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.78
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.78
COG4786Flagellar basal body rod protein FlgGCell motility [N] 0.78
COG2367Beta-lactamase class ADefense mechanisms [V] 0.78
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.78
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.78
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.78
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.78
COG4787Flagellar basal body rod protein FlgFCell motility [N] 0.78
COG1749Flagellar hook protein FlgECell motility [N] 0.78
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 0.78
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.78
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.78
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.78
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.78
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.78
COG1604CRISPR/Cas system CMR subunit Cmr6, Cas7 group, RAMP superfamilyDefense mechanisms [V] 0.78
COG1567CRISPR-Cas system type III CSM-effector complex subunit Csm4, RAMP superfamily Cas5 groupDefense mechanisms [V] 0.78
COG1558Flagellar basal body rod protein FlgCCell motility [N] 0.78
COG1514RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase)Translation, ribosomal structure and biogenesis [J] 0.78
COG1367CRISPR-Cas system type III CMR-effector complex subunit Cmr1, RAMP superfamily Cas7 groupDefense mechanisms [V] 0.78
COG1337CRISPR-Cas system type III CSM-effector complex subunit Csm3, RAMP superfamily Cas7 groupDefense mechanisms [V] 0.78
COG1336CRISPR-Cas system type III CMR-effector complex subunit Cmr4, RAMP superfamily Cas7 groupDefense mechanisms [V] 0.78
COG1332CRISPR-Cas system type III CSM-effector complex subunit Csm5, RAMP superfamily Cas7 groupDefense mechanisms [V] 0.78
COG1256Flagellar hook-associated protein FlgKCell motility [N] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.35 %
UnclassifiedrootN/A4.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918008|ConsensusfromContig200381All Organisms → cellular organisms → Bacteria928Open in IMG/M
2140918024|NODE_442540_length_1844_cov_8.752170All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300003319|soilL2_10282824All Organisms → cellular organisms → Bacteria → Proteobacteria1955Open in IMG/M
3300004152|Ga0062386_101582432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae546Open in IMG/M
3300004631|Ga0058899_11228891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales612Open in IMG/M
3300005434|Ga0070709_10565772All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300005529|Ga0070741_10004380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae33036Open in IMG/M
3300005650|Ga0075038_10058890All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005938|Ga0066795_10063103All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300005944|Ga0066788_10030273All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300005947|Ga0066794_10077278All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300005949|Ga0066791_10002422All Organisms → cellular organisms → Bacteria5174Open in IMG/M
3300005952|Ga0080026_10185645All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300006893|Ga0073928_10105659All Organisms → cellular organisms → Bacteria2352Open in IMG/M
3300009029|Ga0066793_10051129All Organisms → cellular organisms → Bacteria2341Open in IMG/M
3300009029|Ga0066793_10854885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium516Open in IMG/M
3300009137|Ga0066709_102324372Not Available733Open in IMG/M
3300009548|Ga0116107_1100532All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300009549|Ga0116137_1049074All Organisms → cellular organisms → Bacteria1379Open in IMG/M
3300009552|Ga0116138_1110846All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300009639|Ga0116122_1131772All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300009645|Ga0116106_1023676All Organisms → cellular organisms → Bacteria2144Open in IMG/M
3300009650|Ga0105857_1000476All Organisms → cellular organisms → Bacteria14950Open in IMG/M
3300009651|Ga0105859_1000662All Organisms → cellular organisms → Bacteria10698Open in IMG/M
3300010371|Ga0134125_10001435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia29290Open in IMG/M
3300010376|Ga0126381_104186742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium560Open in IMG/M
3300010379|Ga0136449_100097647All Organisms → cellular organisms → Bacteria → Proteobacteria6055Open in IMG/M
3300010379|Ga0136449_100261490All Organisms → cellular organisms → Bacteria3202Open in IMG/M
3300010379|Ga0136449_102391989All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300010391|Ga0136847_11683642All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300010396|Ga0134126_10069901All Organisms → cellular organisms → Bacteria4362Open in IMG/M
3300012096|Ga0137389_11532523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium563Open in IMG/M
3300012209|Ga0137379_10207293All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300012925|Ga0137419_10042724All Organisms → cellular organisms → Bacteria2871Open in IMG/M
3300012930|Ga0137407_11559066All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium629Open in IMG/M
3300014151|Ga0181539_1018492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4033Open in IMG/M
3300014151|Ga0181539_1047235All Organisms → cellular organisms → Bacteria2053Open in IMG/M
3300014152|Ga0181533_1020059All Organisms → cellular organisms → Bacteria4326Open in IMG/M
3300014152|Ga0181533_1372629All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300014155|Ga0181524_10095544All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300014158|Ga0181521_10001384All Organisms → cellular organisms → Bacteria30166Open in IMG/M
3300014161|Ga0181529_10067326All Organisms → cellular organisms → Bacteria → Acidobacteria2412Open in IMG/M
3300014167|Ga0181528_10014024All Organisms → cellular organisms → Bacteria → Proteobacteria4744Open in IMG/M
3300014168|Ga0181534_10008928All Organisms → cellular organisms → Bacteria5410Open in IMG/M
3300014199|Ga0181535_10089820All Organisms → cellular organisms → Bacteria1995Open in IMG/M
3300014490|Ga0182010_10154112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1186Open in IMG/M
3300014490|Ga0182010_10792456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium537Open in IMG/M
3300014491|Ga0182014_10011287All Organisms → cellular organisms → Bacteria → Acidobacteria8682Open in IMG/M
3300014491|Ga0182014_10068361All Organisms → cellular organisms → Bacteria2304Open in IMG/M
3300014493|Ga0182016_10279243All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300014494|Ga0182017_10030445All Organisms → cellular organisms → Bacteria → Acidobacteria3670Open in IMG/M
3300014494|Ga0182017_10100218All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300014495|Ga0182015_10701699All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium638Open in IMG/M
3300014496|Ga0182011_10010999All Organisms → cellular organisms → Bacteria6773Open in IMG/M
3300014496|Ga0182011_10070811All Organisms → cellular organisms → Bacteria2450Open in IMG/M
3300014498|Ga0182019_10106762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1721Open in IMG/M
3300014839|Ga0182027_10049236All Organisms → cellular organisms → Bacteria5292Open in IMG/M
3300014839|Ga0182027_11802343All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium592Open in IMG/M
3300017929|Ga0187849_1003792All Organisms → cellular organisms → Bacteria12987Open in IMG/M
3300017931|Ga0187877_1323939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium587Open in IMG/M
3300017934|Ga0187803_10101270All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300017935|Ga0187848_10035221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2495Open in IMG/M
3300017935|Ga0187848_10071960All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300017938|Ga0187854_10079146Not Available1575Open in IMG/M
3300017940|Ga0187853_10333869All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300017948|Ga0187847_10211083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1058Open in IMG/M
3300017948|Ga0187847_10652535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium590Open in IMG/M
3300017970|Ga0187783_11395149All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium505Open in IMG/M
3300017975|Ga0187782_10006924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8430Open in IMG/M
3300017988|Ga0181520_11017202All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium548Open in IMG/M
3300018002|Ga0187868_1073597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1383Open in IMG/M
3300018009|Ga0187884_10111734Not Available1179Open in IMG/M
3300018025|Ga0187885_10126450All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300018030|Ga0187869_10397486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium657Open in IMG/M
3300018034|Ga0187863_10541313All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300018034|Ga0187863_10684460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium579Open in IMG/M
3300018040|Ga0187862_10610346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium645Open in IMG/M
3300018044|Ga0187890_10461400All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300018062|Ga0187784_11346991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium566Open in IMG/M
3300021046|Ga0215015_10563225Not Available1869Open in IMG/M
3300021178|Ga0210408_10376875All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300021377|Ga0213874_10265985All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300021420|Ga0210394_11703303All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium528Open in IMG/M
3300021432|Ga0210384_11469556All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium587Open in IMG/M
3300021439|Ga0213879_10105769All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300021439|Ga0213879_10113124Not Available768Open in IMG/M
3300021441|Ga0213871_10132614All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300021478|Ga0210402_10000380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus49902Open in IMG/M
3300021560|Ga0126371_12800378All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium591Open in IMG/M
3300022524|Ga0224534_1001961All Organisms → cellular organisms → Bacteria10166Open in IMG/M
3300022524|Ga0224534_1006315All Organisms → cellular organisms → Bacteria → Acidobacteria4202Open in IMG/M
3300022557|Ga0212123_10380071All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300023075|Ga0224520_1035740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1174Open in IMG/M
3300025498|Ga0208819_1049333All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300026215|Ga0209849_1001963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3564Open in IMG/M
3300026216|Ga0209903_1035538All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium761Open in IMG/M
3300026220|Ga0209855_1048696All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300026222|Ga0209862_1000085All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus33425Open in IMG/M
3300026271|Ga0209880_1026815All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300026474|Ga0247846_1035931All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300027676|Ga0209333_1000678All Organisms → cellular organisms → Bacteria17939Open in IMG/M
3300027706|Ga0209581_1002880All Organisms → cellular organisms → Bacteria15607Open in IMG/M
3300028069|Ga0255358_1059706All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300028745|Ga0302267_10124655All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300028792|Ga0307504_10426234All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium527Open in IMG/M
3300030054|Ga0302182_10145045All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300030503|Ga0311370_11012931All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300031234|Ga0302325_10639269All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300031234|Ga0302325_11044599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1109Open in IMG/M
3300031236|Ga0302324_100500519All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300031236|Ga0302324_101051065All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300031236|Ga0302324_102944476All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300031249|Ga0265339_10575530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium517Open in IMG/M
3300031525|Ga0302326_10435273All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300031726|Ga0302321_101088512All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300031788|Ga0302319_10940558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium833Open in IMG/M
3300031962|Ga0307479_10627082Not Available1057Open in IMG/M
3300031996|Ga0308176_10285616All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300032160|Ga0311301_10012752All Organisms → cellular organisms → Bacteria → Acidobacteria26013Open in IMG/M
3300032160|Ga0311301_10263870All Organisms → cellular organisms → Bacteria2817Open in IMG/M
3300032160|Ga0311301_12240073All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300032770|Ga0335085_12450454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium519Open in IMG/M
3300032783|Ga0335079_11108144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium801Open in IMG/M
3300032805|Ga0335078_11248448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium853Open in IMG/M
3300033402|Ga0326728_10029144All Organisms → cellular organisms → Bacteria9490Open in IMG/M
3300033402|Ga0326728_10089663All Organisms → cellular organisms → Bacteria3832Open in IMG/M
3300033818|Ga0334804_003450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7857Open in IMG/M
3300033891|Ga0334811_042733All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300034281|Ga0370481_0097144All Organisms → cellular organisms → Bacteria → Acidobacteria985Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland12.40%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog8.53%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen6.98%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.20%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil5.43%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.43%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.65%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.65%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil4.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.10%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.33%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.33%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.55%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.55%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.55%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.55%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.55%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.55%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.78%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.78%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.78%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.78%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.78%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.78%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2140918024Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005650Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300005949Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009650Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061EnvironmentalOpen in IMG/M
3300009651Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026216Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051 (SPAdes)EnvironmentalOpen in IMG/M
3300026220Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes)EnvironmentalOpen in IMG/M
3300026222Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes)EnvironmentalOpen in IMG/M
3300026271Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)EnvironmentalOpen in IMG/M
3300026474Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Bog_all_C_021878702140918008SoilMQDAMDELVQKYSRLGHPSAEELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRAWRGRARTDPAA
B_all_v_010493602140918024SoilMDQLVQKYSRLGHPSAKELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRAWRGRASTDPAA
soilL2_1028282443300003319Sugarcane Root And Bulk SoilMSLAEKYMHKGHPTIDELIAAQGVVFPRDPEDLLGETWPEDQPTDDFLRELREWRGHRNTDPAA*
Ga0062386_10158243213300004152Bog Forest SoilRQGHPSAEELIAAQGLTFPRDPKDLLGNFWPEEESIDDFLAAMREWRGHAKTDPAA*
Ga0058899_1122889113300004631Forest SoilSMDKLAQKYAHQGHPSVEEMIAAQGLTFPRDPRDLLGNFWPEEESLDDFLAAMREWRGHAKTDPAA*
Ga0070709_1056577223300005434Corn, Switchgrass And Miscanthus RhizosphereMSLAEKYAREGHPSVEELLAEQELIFPRDPHELLGQFWPEEESIDDFLTAMRDWRGHAKTDPAA*
Ga0070741_10004380263300005529Surface SoilMSYTSVEMSLVEKYLRDGHPTVEELIAEQGLTFPRGPRELIGNFWPEDESIDEFLKLLRESRGHVKTDPAA*
Ga0075038_1005889023300005650Permafrost SoilQKSMDELVQKYARQGHPSTEELIAAQGLTFPRDPQDLLGNFWPEEESIDDFLMAMREWRGHTKTDPAA*
Ga0066795_1006310313300005938SoilVACGVGALLEYAMKDAMDELVQKYSRQGHPSAEELIAAQGLTFPRDPKDLLGNFWPEEESIDNFLAAMREWRGHAKTDPAA*
Ga0066788_1003027333300005944SoilMQKSMDELVQKYARQGHPSTEELIAAQGLTFPRDPQDLLGNFWPEEESIDDFLMAMREWRGHTKTDPAA*
Ga0066794_1007727813300005947SoilAMGELVQKYSRQGHPSAEELIAAQGLTFPRDPKDLLGNFWPEEESTDDLLAAMREWRGHAKTDPAA*
Ga0066791_1000242233300005949SoilMDELVQKYARQGHPSTEELIAAQGLTFPRDPQDLLGNFWPEEESIDDFLMAMREWRGHTKTDPAA*
Ga0080026_1018564513300005952Permafrost SoilSEGMQKSMDELVQKYARQGHPSTAELIAAQGLTFPRDPQDLLGNFWPEEESIDDFLMAMREWRGHTKTDPAA*
Ga0073928_1010565933300006893Iron-Sulfur Acid SpringMAEKYVRDGHPTVDELIAGQRVAFPRDPNELLGDVWAEEERIDDFLAALREWRGHTKTDPAA*
Ga0066793_1005112943300009029Prmafrost SoilMKDAMDELVQKYSRQGHPSAEELIAAQGLTFPRDPKNLLGNFWPEEESTDDLLAAMREWRGHAKTDPAA*
Ga0066793_1085488523300009029Prmafrost SoilMKDAMGELVQKYSRQGHPSAEELIAAQGLTFPRDPKDLLGNFWPEEESIDNFLAAMREWRGHAKTDPAA*
Ga0066709_10232437223300009137Grasslands SoilMDELIQTYTRRGHPSVDELVAAQGLTFSRDPNDLLGSFWPEEESIDAFLNALSEWRGLQKTDPDA*
Ga0116107_110053233300009548PeatlandMQDGMDELVQKYSRLGHPSAEELVAAQGLTFPRDPTDLLGNFWPEEESIDDFLAEMRAWRGCARTDPAA*
Ga0116137_104907423300009549PeatlandMQDAMDELVQKYSRLGHPSAEELVAAQGLTFPRDPTDLLGNFWPEEESIDDFLAEMRAWRGRAKTDPAA*
Ga0116138_111084633300009552PeatlandAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESLDDFLAAVREWRGHAKTDPAA*
Ga0116122_113177213300009639PeatlandVKDAMAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESLDDFLAAVREWRGHAKT
Ga0116106_102367633300009645PeatlandVKDAMAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESLDDFLAAVREWRGHAKTDPAA*
Ga0105857_100047623300009650Permafrost SoilMQKSMDELVQKYARQGHPSTEELIAAQGLTFPRDPQDLLGSFWPEEESIDDFLMAMREWRGHTKTDPAA*
Ga0105859_100066223300009651Permafrost SoilMQKSMDELVQKYARQGHPSTAELIAAQGLTFPRDPQDLLGNFWPEEESIDDFLMAMREWRGHTKTDPAA*
Ga0134125_1000143523300010371Terrestrial SoilMEDLAQKYSRDGHPTTDELIAAQKLTFPRDPRDLLGNFWPEDENIEDLLAAVRDWRGHTKR*
Ga0126381_10418674223300010376Tropical Forest SoilMKQSMDELVQNYARRGHPTTEELITAQGLTFPRDPRELLGSFWPEEESLDAFLSALREGRGLEKTDPAA*
Ga0136449_10009764773300010379Peatlands SoilMTMQEPMEAITEKYTRRGHPTVDELITAQGLSFPRDPADLLGNFWPEEESIDDFLAALRAWRGREKTDPAA*
Ga0136449_10026149063300010379Peatlands SoilMKDAMDELVRKYSRQGHPSAEELIAAQGLTFPRDPKDLLGNFWPEEESIDDFLAAMHDWRGHAKTDPAA*
Ga0136449_10239198913300010379Peatlands SoilLVQKYVRQGHPTAEALIEAQGLSFPRDPRDLLGNFWPEEESIDDFLAAMREWRGHAKTDPAA*
Ga0136847_1168364223300010391Freshwater SedimentMEELIRKYSRRGHPTVDELIAAQGLSFPRDPNDLLGNFWPEEESRDDFLTALREWRGREKTDPAA*
Ga0134126_1006990113300010396Terrestrial SoilVSMEDLAQKYSRDGHPTTDELIAAQKLTFPRDPRDLLGNFWPEDENIEDLLAAVRDWRGHTKR*
Ga0137389_1153252323300012096Vadose Zone SoilMFEFVCVKLGTSMSTSEKYVREGHPGIEELIAEQRVVFPRDPHDLLGNFWPEEEAIDDFLSAMREWRGHSKTDPAA*
Ga0137379_1020729323300012209Vadose Zone SoilMVTSMAESQKYAHSGHPSIEELMDAQRVTFPRDPRDFLGEFWPEEESIDDFLAALYEWRGRVKTDPAAWRRSS*
Ga0137419_1004272433300012925Vadose Zone SoilMSLAEKYIREGHPTIDELIAEQRAVFPRDPKDLLGTFWPDEESIDDFLAALREWRGHTKTDPAA*
Ga0137407_1155906613300012930Vadose Zone SoilMSAAEKYINAGHPTIEELVEDQGVVFPRDPSDLLGNFWSLEESTEDFLKAMREWRGHAKTDPAA*
Ga0181539_101849263300014151BogMDELLRNYARQGHPTVEELVAAQGLTFPRDPRELVGSFWPEEESIDDFLTALREWRGRKETDPAA*
Ga0181539_104723543300014151BogMQDRMDEIVQKYSRLGHPSAEELVAAQGLTFPRDPTDLLGNFWPEEESIDDFLAEMRAWRGCARTDPAA*
Ga0181533_102005953300014152BogMTEPMEVLTEKHSRRGHPTVDELIAVQNLSFPRDPADLLGTFWPEAESIEDFLAALRASRGRGRTDPGT*
Ga0181533_137262913300014152BogQGHPSAGELIAAQGLTFPRDPKDLLGNFWPEKESIDEFLAAMREWRGHAKTDPAA*
Ga0181524_1009554423300014155BogMNDAMDELVQKYLRQGHPSAGELIAAQGLTFPRDPKDLLGNFWPEKESIDEFLAAMREWRGHAKTDPAA*
Ga0181521_10001384143300014158BogMPDSLDNLVRQYIHQGHPTLEEPVTAQGLIFPRDPRDLVGNFWPEEESIDDFLSALDDWRGRRRTDPAA*
Ga0181529_1006732613300014161BogGQPKGDGPRQGRPSGGKLIAAQGLLFPRDPKDLSGGFRPGERSIDNYLAAMRKWRGHAKTDPA*
Ga0181528_1001402473300014167BogMSLAEKHIREGHPTIEELVVEQKLAFPRDPHDLLGNFWPEEESIDDFLVAMHDWRGHAKTDPAA*
Ga0181534_1000892883300014168BogMEGLREAYSRRGHPRLDELIAAQGLSFPRDPADLIGNFWPEEESMDDILTALHAWRGRELAD*
Ga0181535_1008982043300014199BogMAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESLDDFLAAVREWRGHAKTDPAA*
Ga0182010_1015411233300014490FenMIDAMDELTKRHSRQGHPSVDELIAAQGLTFPRDPEDLLGSFWPEEESIDDFLAAMREWRGHAK
Ga0182010_1079245613300014490FenMQDAMDELVQKYSRLGYPSADELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRVWRGRARTDPAA*
Ga0182014_1001128773300014491BogMPEPIEALTEKYSRRGHPTVDELIAAQNLSFPRDPADLLGNFWPEEESIDDFLAALRAWRGRENTNPAA*
Ga0182014_1006836133300014491BogMKDAMDELVRKYSRQGHPSVEELIAAQGLTFPRDPRDLLGNFWPEEESTDDFLAAMRDWRGHAKTDPAA*
Ga0182016_1027924323300014493BogMPEPIEALTEKYSRRGHPTVDELIAAQNLSFPRDPADLLGNFWPEEESIDDFLTALRTWRGRENTNPAA*
Ga0182017_1003044533300014494FenMIDAMDELTKRHSRQGHPSVDELIAAQGLTFPRDPEDLLGSFWPEEESIDDFLAAMREWRGHAKSDPAA*
Ga0182017_1010021833300014494FenMQDAMDELVQKYSRLGHPSADELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLVEMRAWRGRARTDPAA*
Ga0182015_1070169923300014495PalsaMEALTEKYARRGHPTVDETIAAQGLSFPRDPADLLGNFWPEEESIDDFLTALRAWRGRERTDPAA*
Ga0182011_1001099963300014496FenMDELAQRHSRQGHPSVDESIAAQGLTFPRDPKDLLGNFWPEEESIDDFLTAMREWRRHAKTGPTSLPSEPG*
Ga0182011_1007081133300014496FenMQDAMDELVQKYSRLGHPSAEELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRAWRGRASTDPAA*
Ga0182019_1010676233300014498FenMQDAMDELVQKYSRLGHRSAEELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRAWRGRATTDPAA*
Ga0182027_1004923653300014839FenMPDAMDELVQKYSRLGYPSADELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAERRAWRGRARTDPAA*
Ga0182027_1180234313300014839FenMNDAMDELVQKYSRQGHPSAGELIAAQGLTFPRDPKDLLGNFWPEKESIDEFLAAMREWRGHAKTDPAA*
Ga0187849_1003792103300017929PeatlandMQDAMDELVQKYSRLGHPSAEELVAAQGLTFPRDPTDLLGNFWPEEESIDDFLAEMRAWRGRAKTDPAA
Ga0187877_132393923300017931PeatlandMQDRMDEIVQKYSRLGHPSAEELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRAWRGCARTDPAA
Ga0187803_1010127023300017934Freshwater SedimentMQEPMEMLLEKYSRRGHPTVDELIAAQGLSFPRNPADVLGNFWPEEESIDDFLAALREWRGRERTDPAA
Ga0187848_1003522123300017935PeatlandMDELLRNYARQGHPTVEELVAAQGLTFPRDPRELVGSFWPEEESIDDFLTALREWRGRKETDPAA
Ga0187848_1007196043300017935PeatlandMAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESLDDFLAAVREWRGHAKTDPAA
Ga0187854_1007914633300017938PeatlandMAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESLDDFLAAVREWRGH
Ga0187853_1033386913300017940PeatlandMQDRMDEIVQKYSRLGHPSAEELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMREWRGCARTDP
Ga0187847_1021108333300017948PeatlandMSLAQKYSREGHPTIDELIADQRVAFPRDPCDLLGDFWPEEEPIDDFLAALCEWRGHINTDPAA
Ga0187847_1065253513300017948PeatlandMPGSMDELLRNYARQGHPTTDELVAAQGLTFPRDPRDAVGNFWPEEESIDDFLRVLREWRGRKETDPAA
Ga0187783_1139514923300017970Tropical PeatlandMSIADKCVREGRPTVNELIGEQRVDFPRDLLGDFWPEEESIDDFLAARREWRGHAKTDPA
Ga0187782_1000692423300017975Tropical PeatlandMSLVEKHMREGHPTIEELIAEQGTVFPRDPEDLLGEPWSDDQPTDDFLQQLREWRGHRNTDPAA
Ga0181520_1101720223300017988BogMVELVQKYSRTGHPSAQELAVAQGVTFPRDPKDLLGNFWPEEESIGDFLAAVREWRGHAKTDPAA
Ga0187868_107359713300018002PeatlandMPGSMDELLRNYARQGHPTVEELVAAQGLTFPRDPRELVGSFWPEEESIDDFLTALREWRGRKETDPAA
Ga0187884_1011173433300018009PeatlandMAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESLDDFLAAVREWRGHAK
Ga0187885_1012645033300018025PeatlandMDEIVQKYSRLGHPSAEELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRAWRGCARTDPAA
Ga0187869_1039748623300018030PeatlandMKDAMVELVQKYSRTGHPSAQELAVAQGVTFPRDPKDLLGNFWPEEESIGDFLAAVREWRGHAKTDPAA
Ga0187863_1054131323300018034PeatlandMDELLRNYARQGHPTTDELVAAQGLTFPRDPRDAVGNFWPEEESIDDFLRVLREWRGRKETDPAA
Ga0187863_1068446013300018034PeatlandMSLAEKHIREGHPTIEELVVEQKLAFPRDPHDLLGNFWPEEESIDDFLVAMHDWRGHAKTDPAA
Ga0187862_1061034613300018040PeatlandMVELVQKYSRTGHPSAQELAVAQGVTFPRDPKDLLGNFWPEEESIGDFLAAVREWRGHA
Ga0187890_1046140013300018044PeatlandNRGGAILGPGMPGSMDELLRNYARQGHPTTDELVAAQGLTFPRDPRDAVGNFWPEEESIDDFLRVLREWRGRKETDPAA
Ga0187784_1134699123300018062Tropical PeatlandMSLADNYIREGHPTIDELVVEQKLAFPRDPHDLLGNFWPEEESIDDFLAAMHDWRGHAKNDPAA
Ga0215015_1056322523300021046SoilMSLAEKYIRQGHPTIDEMILEQRVEFPRDPRDLLGNFWPEEESIDDFLAALREWRGHAKTDPAA
Ga0210408_1037687523300021178SoilMDELVQKYAQRGHPTTDELIAAQGLTFPRDPQDLVGNFWPEEESIDDFLIALREWRGHARTDPAA
Ga0213874_1026598513300021377Plant RootsGWMSAAEKYVREGHPTIEELIAEQNLTFPRDPRDLIGDFWPPEESIDDFLKLLRESRGHVKTDPAA
Ga0210394_1170330323300021420SoilMRESMDELVQKYTRRGHPTTEELIASQNVTFPRDPRDLLGSFWPEEESIDAFLSAVREWRGHAKTDPAA
Ga0210384_1146955623300021432SoilMRESMDELAKKYTRRGHPTVEELIAAQGLTFPRDPQDLLGSFWPEEESIDDFLSALREWRGHAKTDPAA
Ga0213879_1010576923300021439Bulk SoilVMSAAEKYVLEGHPTIDELIAEQKLTFPRDPRDLIGDFWPSEESIDDFLKLLRESRGHVKTDPAA
Ga0213879_1011312423300021439Bulk SoilVVFELNFGWMSAAEKYVREGHPTIDELIAEQKLTFPRDPHDLIGDFWPPEESIDDFLKLLRESRGHVKTDPAA
Ga0213871_1013261413300021441RhizosphereMSAAEKYVREGHPTIEELIAEQNLTFPRDPRDLIGDFWPPEESIDDFLKLLRESRGHVKTDPAA
Ga0210402_10000380343300021478SoilMPMPDSTDELAKKYARQGHPSAEELIAAQGLTFPRDPRDLLGNFWPEEESIDDFLAAMREWRGHAKTDPAA
Ga0126371_1280037813300021560Tropical Forest SoilMSLTEKHIYEGHPSIHELVAEQKVVFPRDPNDLLGNFWPEEESINEFLAAMRDWRGHARTDPAV
Ga0224534_100196163300022524SoilMPEPIEALTEKYSRRGHPTVDELIAAQNLSFPRDPADLLGNFWPEEESIDDFLAALRAWRGRENTNPAA
Ga0224534_100631543300022524SoilMNDAMDELVQKYSRQGHPSAGELIAAQGLTFPRDPKDLLGNFWPEKESIDEFLAAMREWRGHAKTDPAA
Ga0212123_1038007143300022557Iron-Sulfur Acid SpringMAEKYVRDGHPTVDELIAGQRVAFPRDPNELLGDVWAEEERIDDFLAALREWRGHTKTDPAA
Ga0224520_103574033300023075SoilMQDAMDELVQKYSRLGHPSADELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLVEMRAWRGRARTDPAA
Ga0208819_104933333300025498PeatlandMAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRAWRGRAKTDPAA
Ga0209849_100196323300026215SoilMDELVQKYARQGHPSTEELIAAQGLTFPRDPQDLLGNFWPEEESIDDFLMAMREWRGHTKTDPAA
Ga0209903_103553823300026216SoilMQKSMDELVQKYARQGHPSTEELIAAQGLTFPRDPQDLLGNFWPEEESIDDFLMAMREWRGHTKTDPAA
Ga0209855_104869613300026220Permafrost SoilHAEIDGMQKSMDELVQKYARQGHPSTEELIAAQGLTFPRDPQDLLGNFWPEEESIDDFLMAMREWRGHTKTDPAA
Ga0209862_100008553300026222Permafrost SoilMDELVQKYARQGHPSTEELIAAQGLTFPRDPQDLLGSFWPEEESIDDFLMAMREWRGHTKTDPAA
Ga0209880_102681533300026271SoilVACGVGALLEYAMKDAMDELVQKYSRQGHPSAEELIAAQGLTFPRDPKDLLGNFWPEEESIDNFLAAMREWRGHAKTDPAA
Ga0247846_103593123300026474SoilMQDAMDELVQKYSRLGHRFAEELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRVWRGRARTDPAA
Ga0209333_1000678123300027676Forest SoilMQESMENLTEKYIRRGHPTVDELIAAQNLSFPRDPVDLLGNFWPENESIEDFLTALRAWRGRKKN
Ga0209581_1002880123300027706Surface SoilMSYTSVEMSLVEKYLRDGHPTVEELIAEQGLTFPRGPRELIGNFWPEDESIDEFLKLLRESRGHVKTDPAA
Ga0255358_105970623300028069SoilMQDTMDELVQKYSRLGHPSAEELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRAWRGRA
Ga0302267_1012465513300028745BogMAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESLDDFLAAVREWRGHA
Ga0307504_1042623423300028792SoilMDELVQKYARRGHPTLEELASAQGLTFPRDPHDLIGNFWPDEECIDDFLRAIREWRGHTKTDPAA
Ga0302182_1014504523300030054PalsaMQDSMDALARQYATRGHPTTDELVSAQGLTFPRDPHDLLGDFWPEEESIDDFLSAMRE
Ga0311370_1101293123300030503PalsaMNDAMDEVVQKYSRRGHPSAEELITAQGITFPRDPNDLLGNFWPEEDSIDDFLAAMREWRGHANTDPAA
Ga0302325_1063926933300031234PalsaMEALTEKYARRGHPTVDETIAAQGLSFPRDPADLLGNFWPEEESIDDFLTALRAWRGRERTDPAA
Ga0302325_1104459923300031234PalsaMEDVNEQYDRAGHPSVDELIRAQGLSFPRDPRELLADIWPEDESIEDFLAVLGEWRGREKTDPAA
Ga0302324_10050051933300031236PalsaMEALTEKYARRGHPTVDETIAAQGLSFPRDPADLLGNFWPEEESIDDFLTALRAWRGRERTDPA
Ga0302324_10105106523300031236PalsaMPESMEALSDKYSRRGHPTVDELIAAQGLSFPRDPADLLGNFWPEEESIDDFLTALHEWRGRKRTDPAA
Ga0302324_10294447613300031236PalsaSRCETGSMEDVNEQYDRAGHPSVDELIRAQGLSFPRDPRELLADIWPEDESIEDFLAVLGEWRGREKTDPAA
Ga0265339_1057553023300031249RhizosphereMSEAMDNLLRQYARQGHPTVEELVEAQGLTFPRDPQDLIGHFWPEEESIDDFLNALDDWRGRKKTDPAA
Ga0302326_1043527343300031525PalsaMDEVVQKYSRRGHPSAEELITAQGITFPRDPNDLLGNFWPEEDSIDDFLAAMREWRGHANTDPAA
Ga0302321_10108851243300031726FenMAQRYTEIAVADRTDELARKYARQGHPTVLELVTAQEQTFPRDPQELLGNFCPEEESTDEFLAAMREWRGHAKTDPAA
Ga0302319_1094055813300031788BogMKDAMDELVRKYSRQGHPSVEELIAAQGLTFPRDPRDLLGNFWPEEESTDDFLAAMRDWRGHAKTDPAA
Ga0307479_1062708223300031962Hardwood Forest SoilVQESIDELTQKYARRGHPTIEELITAQGLTFPRDPRDLLGSFWPEEESIDDFLIALREWRGHAKTDPAA
Ga0308176_1028561623300031996SoilMSLADKYIRDGHPTIDELVVEQKLAFPRDPHDLLGNFWPEEESIDDFLAAMHDWRGHAKTDPAA
Ga0311301_10012752183300032160Peatlands SoilMTMQEPMEAITEKYTRRGHPTVDELITAQGLSFPRDPADLLGNFWPEEESIDDFLAALRAWRGREKTDPAA
Ga0311301_1026387023300032160Peatlands SoilMDELVRKYSRQGHPSAEELIAAQGLTFPRDPKDLLGNFWPEEESIDDFLAAMHDWRGHAKTDPAA
Ga0311301_1224007323300032160Peatlands SoilMKDSMDELVQKYVRQGHPTAEALIEAQGLSFPRDPRDLLGNFWPEEESIDDFLAAMREWRGHAKTDPAA
Ga0335085_1245045413300032770SoilMSLADKYIREGHPTIDELVVEQKLAFPRDPHDLLGSFWPEGESIDDFLAAMHDWRGHAKTDPAG
Ga0335079_1110814423300032783SoilMSLADKYIREGHPTIDELVVEQKLAFPRDPHDLLGSFWPEGESIDDFLAAMHDWRGHAKTDPAA
Ga0335078_1124844813300032805SoilMSLADKYIREGHPTIDELVVEQKLAFPRDPHDLLGNFWPEEESIDDFLAAMHDWRGHAKTDPAA
Ga0326728_1002914453300033402Peat SoilMQDRMDEIVQKYSRLGHPSAEELVAAQGLTFPRDPTDLLGNFWPEEESIDDFLAEMRAWRGCARTDPAA
Ga0326728_1008966333300033402Peat SoilVCGAGAILEYGMKDAMDQLVQKYSRQGHPSAEELIGAQGLSFPRDPKDLLGSFWPEEESIDDFLAAMRDWRGHARTDPAA
Ga0334804_003450_6124_63333300033818SoilVKDAMAELVQKYSRAGHPSAEELIATQGLTFPRDPRDLLGNFWPEEESLDDFLAAVREWRGHAKTDPAA
Ga0334811_042733_1035_12323300033891SoilMDQLVQKYSRLGHRSAKELVAAQGLTFPRDPRDLLGNFWPEEESIDDFLAEMRAWRGRATTDPAA
Ga0370481_0097144_606_8153300034281Untreated Peat SoilMKDAMDELVQKYSRQGHPSAEELIAAQGLTFPRDPKDLLGNFWPEEESTDDFLAAMREWRGHAKTDPAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.