| Basic Information | |
|---|---|
| Family ID | F064202 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 46 residues |
| Representative Sequence | YFTKVNDMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.67 % |
| % of genes from short scaffolds (< 2000 bps) | 89.92 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (37.984 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (22.481 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.620 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.473 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 0.00% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF12705 | PDDEXK_1 | 7.75 |
| PF01381 | HTH_3 | 3.88 |
| PF00170 | bZIP_1 | 1.55 |
| PF07716 | bZIP_2 | 1.55 |
| PF11753 | DUF3310 | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.02 % |
| Unclassified | root | N/A | 37.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10103298 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1176 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10142685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 832 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10150722 | Not Available | 797 | Open in IMG/M |
| 3300001346|JGI20151J14362_10152307 | Not Available | 691 | Open in IMG/M |
| 3300001347|JGI20156J14371_10082872 | Not Available | 1115 | Open in IMG/M |
| 3300001353|JGI20159J14440_10021290 | All Organisms → Viruses → Predicted Viral | 3031 | Open in IMG/M |
| 3300001353|JGI20159J14440_10182975 | Not Available | 586 | Open in IMG/M |
| 3300001355|JGI20158J14315_10058908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1549 | Open in IMG/M |
| 3300001355|JGI20158J14315_10115307 | Not Available | 886 | Open in IMG/M |
| 3300001450|JGI24006J15134_10077110 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300001450|JGI24006J15134_10140038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 807 | Open in IMG/M |
| 3300001748|JGI11772J19994_1017210 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1102 | Open in IMG/M |
| 3300006027|Ga0075462_10141670 | Not Available | 736 | Open in IMG/M |
| 3300006027|Ga0075462_10226074 | Not Available | 558 | Open in IMG/M |
| 3300006737|Ga0098037_1121836 | Not Available | 891 | Open in IMG/M |
| 3300006737|Ga0098037_1131051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 852 | Open in IMG/M |
| 3300006749|Ga0098042_1171872 | Not Available | 525 | Open in IMG/M |
| 3300006793|Ga0098055_1294178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 607 | Open in IMG/M |
| 3300006802|Ga0070749_10223152 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1074 | Open in IMG/M |
| 3300006869|Ga0075477_10083807 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1379 | Open in IMG/M |
| 3300006870|Ga0075479_10038189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2071 | Open in IMG/M |
| 3300006922|Ga0098045_1125654 | Not Available | 597 | Open in IMG/M |
| 3300006924|Ga0098051_1159260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 595 | Open in IMG/M |
| 3300007236|Ga0075463_10119692 | Not Available | 850 | Open in IMG/M |
| 3300007276|Ga0070747_1037851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1886 | Open in IMG/M |
| 3300007346|Ga0070753_1217860 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 701 | Open in IMG/M |
| 3300007540|Ga0099847_1013182 | All Organisms → Viruses | 2725 | Open in IMG/M |
| 3300008220|Ga0114910_1222035 | Not Available | 513 | Open in IMG/M |
| 3300009027|Ga0102957_1282264 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 605 | Open in IMG/M |
| 3300009027|Ga0102957_1288773 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 599 | Open in IMG/M |
| 3300009071|Ga0115566_10158694 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
| 3300009433|Ga0115545_1208588 | Not Available | 664 | Open in IMG/M |
| 3300009449|Ga0115558_1300905 | Not Available | 638 | Open in IMG/M |
| 3300009476|Ga0115555_1088049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1345 | Open in IMG/M |
| 3300009496|Ga0115570_10342506 | All Organisms → Viruses | 641 | Open in IMG/M |
| 3300009498|Ga0115568_10103759 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1406 | Open in IMG/M |
| 3300009507|Ga0115572_10407144 | All Organisms → Viruses | 761 | Open in IMG/M |
| 3300009790|Ga0115012_11927705 | Not Available | 522 | Open in IMG/M |
| 3300010150|Ga0098056_1197717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 672 | Open in IMG/M |
| 3300010300|Ga0129351_1210600 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 752 | Open in IMG/M |
| 3300010368|Ga0129324_10019850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3333 | Open in IMG/M |
| 3300013195|Ga0116815_1041933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 633 | Open in IMG/M |
| 3300016737|Ga0182047_1200772 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 790 | Open in IMG/M |
| 3300016749|Ga0182053_1048982 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300017697|Ga0180120_10189876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 855 | Open in IMG/M |
| 3300017727|Ga0181401_1035953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1403 | Open in IMG/M |
| 3300017731|Ga0181416_1014244 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300017731|Ga0181416_1095665 | Not Available | 707 | Open in IMG/M |
| 3300017740|Ga0181418_1121953 | Not Available | 630 | Open in IMG/M |
| 3300017741|Ga0181421_1136668 | Not Available | 634 | Open in IMG/M |
| 3300017741|Ga0181421_1164205 | Not Available | 573 | Open in IMG/M |
| 3300017743|Ga0181402_1118415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 679 | Open in IMG/M |
| 3300017745|Ga0181427_1031496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1321 | Open in IMG/M |
| 3300017745|Ga0181427_1114799 | Not Available | 658 | Open in IMG/M |
| 3300017748|Ga0181393_1131798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 630 | Open in IMG/M |
| 3300017750|Ga0181405_1018919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1922 | Open in IMG/M |
| 3300017750|Ga0181405_1053164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1064 | Open in IMG/M |
| 3300017752|Ga0181400_1009285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3457 | Open in IMG/M |
| 3300017753|Ga0181407_1138720 | Not Available | 603 | Open in IMG/M |
| 3300017756|Ga0181382_1090570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 836 | Open in IMG/M |
| 3300017764|Ga0181385_1033026 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300017764|Ga0181385_1268048 | Not Available | 510 | Open in IMG/M |
| 3300017765|Ga0181413_1072170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 1059 | Open in IMG/M |
| 3300017765|Ga0181413_1137200 | Not Available | 739 | Open in IMG/M |
| 3300017765|Ga0181413_1259609 | Not Available | 511 | Open in IMG/M |
| 3300017767|Ga0181406_1063234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1136 | Open in IMG/M |
| 3300017769|Ga0187221_1170951 | Not Available | 637 | Open in IMG/M |
| 3300017771|Ga0181425_1108899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 886 | Open in IMG/M |
| 3300017771|Ga0181425_1123481 | Not Available | 826 | Open in IMG/M |
| 3300017771|Ga0181425_1138609 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 774 | Open in IMG/M |
| 3300017781|Ga0181423_1065402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1442 | Open in IMG/M |
| 3300017782|Ga0181380_1217998 | Not Available | 637 | Open in IMG/M |
| 3300017786|Ga0181424_10066081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1562 | Open in IMG/M |
| 3300017952|Ga0181583_10482718 | Not Available | 760 | Open in IMG/M |
| 3300017956|Ga0181580_10337663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1017 | Open in IMG/M |
| 3300017986|Ga0181569_10479808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 843 | Open in IMG/M |
| 3300018418|Ga0181567_10225950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1276 | Open in IMG/M |
| 3300018420|Ga0181563_10071516 | All Organisms → cellular organisms → Bacteria | 2353 | Open in IMG/M |
| 3300019756|Ga0194023_1045727 | Not Available | 882 | Open in IMG/M |
| 3300019765|Ga0194024_1078721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 744 | Open in IMG/M |
| 3300020174|Ga0181603_10134229 | Not Available | 1094 | Open in IMG/M |
| 3300020472|Ga0211579_10597260 | Not Available | 619 | Open in IMG/M |
| 3300020810|Ga0181598_1040661 | All Organisms → Viruses | 2371 | Open in IMG/M |
| 3300021347|Ga0213862_10083464 | Not Available | 1127 | Open in IMG/M |
| 3300021373|Ga0213865_10281656 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 783 | Open in IMG/M |
| 3300021958|Ga0222718_10098687 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300021959|Ga0222716_10596935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 603 | Open in IMG/M |
| 3300021964|Ga0222719_10757667 | All Organisms → Viruses | 540 | Open in IMG/M |
| 3300022050|Ga0196883_1020018 | Not Available | 804 | Open in IMG/M |
| 3300022053|Ga0212030_1031452 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 738 | Open in IMG/M |
| 3300022053|Ga0212030_1056109 | Not Available | 560 | Open in IMG/M |
| 3300022065|Ga0212024_1082030 | Not Available | 574 | Open in IMG/M |
| 3300022068|Ga0212021_1001736 | All Organisms → Viruses → Predicted Viral | 2681 | Open in IMG/M |
| 3300022068|Ga0212021_1066507 | Not Available | 738 | Open in IMG/M |
| 3300022071|Ga0212028_1104516 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 526 | Open in IMG/M |
| 3300022074|Ga0224906_1051531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1319 | Open in IMG/M |
| 3300022183|Ga0196891_1047892 | Not Available | 780 | Open in IMG/M |
| 3300023180|Ga0255768_10263989 | Not Available | 989 | Open in IMG/M |
| 3300024344|Ga0209992_10348681 | Not Available | 595 | Open in IMG/M |
| 3300025070|Ga0208667_1007871 | Not Available | 2626 | Open in IMG/M |
| 3300025098|Ga0208434_1115017 | All Organisms → Viruses | 512 | Open in IMG/M |
| 3300025099|Ga0208669_1016636 | All Organisms → Viruses → Predicted Viral | 1945 | Open in IMG/M |
| 3300025101|Ga0208159_1072693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 663 | Open in IMG/M |
| 3300025128|Ga0208919_1149908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 723 | Open in IMG/M |
| 3300025168|Ga0209337_1141273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1056 | Open in IMG/M |
| 3300025543|Ga0208303_1008657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3244 | Open in IMG/M |
| 3300025543|Ga0208303_1053961 | Not Available | 965 | Open in IMG/M |
| 3300025632|Ga0209194_1011156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3488 | Open in IMG/M |
| 3300025632|Ga0209194_1092333 | Not Available | 779 | Open in IMG/M |
| 3300025645|Ga0208643_1128886 | Not Available | 662 | Open in IMG/M |
| 3300025646|Ga0208161_1031327 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300025674|Ga0208162_1044075 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1536 | Open in IMG/M |
| 3300025704|Ga0209602_1139925 | All Organisms → Viruses | 792 | Open in IMG/M |
| 3300025759|Ga0208899_1046385 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300025803|Ga0208425_1052310 | Not Available | 1015 | Open in IMG/M |
| 3300025816|Ga0209193_1163907 | Not Available | 507 | Open in IMG/M |
| 3300025853|Ga0208645_1121148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1043 | Open in IMG/M |
| 3300025881|Ga0209309_10158682 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300025886|Ga0209632_10230796 | All Organisms → Viruses | 959 | Open in IMG/M |
| 3300025889|Ga0208644_1045626 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300025889|Ga0208644_1323711 | Not Available | 601 | Open in IMG/M |
| 3300025890|Ga0209631_10234750 | Not Available | 923 | Open in IMG/M |
| 3300026138|Ga0209951_1077604 | Not Available | 694 | Open in IMG/M |
| 3300027859|Ga0209503_10063936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1693 | Open in IMG/M |
| 3300029309|Ga0183683_1009399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2572 | Open in IMG/M |
| 3300031851|Ga0315320_10766231 | Not Available | 610 | Open in IMG/M |
| 3300032088|Ga0315321_10205897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD8-C175 | 1291 | Open in IMG/M |
| 3300034374|Ga0348335_084205 | All Organisms → Viruses | 1060 | Open in IMG/M |
| 3300034375|Ga0348336_119127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 849 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.48% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 22.48% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.95% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.30% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.75% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 6.20% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.33% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.33% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.33% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.33% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.55% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.55% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.55% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.55% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.78% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.78% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300013195 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station7_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016749 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101032981 | 3300000101 | Marine | NKVNEMIEEIKKRQDVDLINYEYSYTGIHEDTDLKYFDIVRH* |
| DelMOSpr2010_101426853 | 3300000116 | Marine | ILMVALLILNFIDTFPSFPKVHDMISQIKKRDDVELINYEYSYTGIHEDTDLKYFEITLN |
| DelMOSpr2010_101507221 | 3300000116 | Marine | IDTFPYFTKVNDMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN* |
| JGI20151J14362_101523071 | 3300001346 | Pelagic Marine | NNPYGSFVSFRFIDTYPYFTKVNEMVEEIKKRSDVDLINYEYTYKQIHKNTDLKHLDFTKN* |
| JGI20156J14371_100828721 | 3300001347 | Pelagic Marine | FIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDLKHLDFTKN* |
| JGI20159J14440_100212909 | 3300001353 | Pelagic Marine | FIDTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDLTRH* |
| JGI20159J14440_101829752 | 3300001353 | Pelagic Marine | DTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDLKHLDFTKN* |
| JGI20158J14315_100589081 | 3300001355 | Pelagic Marine | IAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH* |
| JGI20158J14315_101153074 | 3300001355 | Pelagic Marine | PYGSYVSFRFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN* |
| JGI24006J15134_100771104 | 3300001450 | Marine | MRWSKKLKERSDVDLINYEYTYKKIHKNTDLKYFDLTRN* |
| JGI24006J15134_101400381 | 3300001450 | Marine | PYGSYVSFTFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKKIHKNTDLKYFDFTKN* |
| JGI11772J19994_10172104 | 3300001748 | Saline Water And Sediment | KVNEMVSQIKRRTDVDLIDYEYTYTGIHEDTDLTHLEITRN* |
| Ga0075462_101416701 | 3300006027 | Aqueous | FPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH* |
| Ga0075462_102260741 | 3300006027 | Aqueous | DMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN* |
| Ga0098037_11218362 | 3300006737 | Marine | MVEEVKKRNDVDLINYEYSYTGIHEDTDIKHFDITRN* |
| Ga0098037_11310514 | 3300006737 | Marine | TKVNEMVEEIKRRSDVDLINYEYSYTGIHEDTDIKHFDFTKN* |
| Ga0098042_11718722 | 3300006749 | Marine | IAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH* |
| Ga0098055_12941783 | 3300006793 | Marine | NEMVEEIKRRSDVDLINYEYSYTGIHEDTDIKHFDFTKN* |
| Ga0070749_102231523 | 3300006802 | Aqueous | EIKKRTDVDLVDYEFTYTGIHEDTDLTHLEITRN* |
| Ga0075477_100838074 | 3300006869 | Aqueous | DTFPYFTKVNDMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN* |
| Ga0075479_100381895 | 3300006870 | Aqueous | IDTFPSFPKVHDMISQIKKRDDVELINYQYSYSGIHEDTDLKYFEITLN* |
| Ga0098045_11256542 | 3300006922 | Marine | LETSNNPYGSYVSFRFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKHIHKDTDIKNLDFTKN* |
| Ga0098051_11592603 | 3300006924 | Marine | EEIKRRSDVDLINYEYSYTGIHEDTDIKHFDFTKN* |
| Ga0075463_101196924 | 3300007236 | Aqueous | YPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH* |
| Ga0070747_10378511 | 3300007276 | Aqueous | YFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN* |
| Ga0070753_12178602 | 3300007346 | Aqueous | TFPSFPKLNDMIFEIKKRHDVDLINYEYSYTGIHEDTDLQYFDIVRN* |
| Ga0099847_10131828 | 3300007540 | Aqueous | VSFRFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDLKHFDFTKN* |
| Ga0114910_12220352 | 3300008220 | Deep Ocean | PKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDLTRH* |
| Ga0102957_12822642 | 3300009027 | Pond Water | EAPNNPYGSYVCFRFVDVFPYFTKVNEMVAEIKSRNDVELIDYEYSYTGIHEDTDLSNLEVTRN* |
| Ga0102957_12887732 | 3300009027 | Pond Water | GSYIHFKFIDTFPSFPKLNDMIFEIKKRHDVDLINYEYSYTGIHEDTDLKYFDIVRN* |
| Ga0115566_101586941 | 3300009071 | Pelagic Marine | PNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDLTRH* |
| Ga0115545_12085881 | 3300009433 | Pelagic Marine | ITDLELQLETSNNPYGSYVSFRFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN* |
| Ga0115558_13009052 | 3300009449 | Pelagic Marine | EEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN* |
| Ga0115555_10880491 | 3300009476 | Pelagic Marine | KVNEMVEEIKKRSDVDLINYEYTYKQIHKDTDLQHLDFTKN* |
| Ga0115570_103425061 | 3300009496 | Pelagic Marine | VNNMIEEIKKREDVDLINYEYSYTSIKKDTDLKYFEITRN* |
| Ga0115568_101037594 | 3300009498 | Pelagic Marine | NEMVEEIKRRSDVDLINYEYTYKQIHKDTDIKHLDFTKN* |
| Ga0115572_104071441 | 3300009507 | Pelagic Marine | TFPHFTKVNNMIEEIKKREDVDLINYEYSYTSIKKDTDLKYFEITRN* |
| Ga0115012_119277052 | 3300009790 | Marine | EIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH* |
| Ga0098056_11977171 | 3300010150 | Marine | NNPYGSYVSFRFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYSYTGIHEDTDIKHFDFTKN* |
| Ga0129351_12106003 | 3300010300 | Freshwater To Marine Saline Gradient | LNDMIFEIKKRHDVDLINYEYSYTGIHEDTDLQYFDIVRN* |
| Ga0129324_100198501 | 3300010368 | Freshwater To Marine Saline Gradient | MIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH* |
| Ga0116815_10419332 | 3300013195 | Marine | VHEVKSRTDVELINFEYSYTGIHEDTDLKHFDITRN* |
| Ga0182047_12007723 | 3300016737 | Salt Marsh | FKFIDTFPSFPKLNDMIFEIKKRHDVDLINYEYSYTGIHEDTDLQYFDIVRN |
| Ga0182053_10489825 | 3300016749 | Salt Marsh | IFEIKKRHDVDLINYEYSYTGIHEDTDLQYFDIVRN |
| Ga0180120_101898763 | 3300017697 | Freshwater To Marine Saline Gradient | DTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDLKHFDLTRN |
| Ga0181401_10359535 | 3300017727 | Seawater | YGSYISFRFIDTYPYFTKVNEMVEEIKRRGDVDLINYEYTYKQIHKDTDIKHFDITKN |
| Ga0181416_10142441 | 3300017731 | Seawater | DTFPSFPKLNDMIFEIKKRHDVDLINYEYSYTGIHEDTDLKYFDIVRN |
| Ga0181416_10956651 | 3300017731 | Seawater | DMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDITLN |
| Ga0181418_11219531 | 3300017740 | Seawater | KFIDTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDLTRH |
| Ga0181421_11366682 | 3300017741 | Seawater | FIDTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0181421_11642052 | 3300017741 | Seawater | FTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN |
| Ga0181402_11184151 | 3300017743 | Seawater | TFPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDLKQFDFTKN |
| Ga0181427_10314961 | 3300017745 | Seawater | RCIDNFPYFKKVNEMVEEIKRRNDVDLINYEYSYTGIHEDTDIKHFDITRN |
| Ga0181427_11147991 | 3300017745 | Seawater | DMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0181393_11317982 | 3300017748 | Seawater | NEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN |
| Ga0181405_10189191 | 3300017750 | Seawater | MIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDITLN |
| Ga0181405_10531644 | 3300017750 | Seawater | MVEEIKRRSDVDLINYEYTYKQIHKNTDLKQFDFTKN |
| Ga0181400_100928511 | 3300017752 | Seawater | KVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0181407_11387202 | 3300017753 | Seawater | YPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0181382_10905703 | 3300017756 | Seawater | DSYFAKVNEMVVELKRRSDVDLVHYEYTYKQIHKDTDIKHFDITKN |
| Ga0181385_10330264 | 3300017764 | Seawater | YGSFVNFKFIDTFPSFPKLNDMIFEIKKRHDVDLINYEYSYTGIHEDTDLKYFDIVRN |
| Ga0181385_12680482 | 3300017764 | Seawater | IAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH |
| Ga0181413_10721704 | 3300017765 | Seawater | YFTKVNEMVEEIKRRSDVDLINYEYSYTGIHEDTDIKHFDFTKN |
| Ga0181413_11372001 | 3300017765 | Seawater | PYFTKVNEMIEEIKKRDDVELVKYEYTYTGIHEDTDLKFFDIVKN |
| Ga0181413_12596092 | 3300017765 | Seawater | KVNDMIAEIKKRGDVDLINFEYSYTGIYEDTDLQYFDVTRH |
| Ga0181406_10632341 | 3300017767 | Seawater | NEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKHLDFTKN |
| Ga0187221_11709512 | 3300017769 | Seawater | TSNNPYGSFINFKFIDLYPHFTKVNDMIAEIKKRGDVDLINFEYSYTGIYEDTDLQYFDVTRH |
| Ga0181425_11088993 | 3300017771 | Seawater | TYPYFTKVNEMVEEIKKRSDVDLINYEYTFKQIHKNTDLKHFDFTKN |
| Ga0181425_11234814 | 3300017771 | Seawater | PKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH |
| Ga0181425_11386091 | 3300017771 | Seawater | YFTKVNEMIEEIKKRDDVELVKYEYSYTGIHEDTDLKHFDFTKN |
| Ga0181423_10654021 | 3300017781 | Seawater | SFVNFKFIDTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0181380_12179981 | 3300017782 | Seawater | KVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH |
| Ga0181424_100660811 | 3300017786 | Seawater | PYFTKVNEMVEEIKKRSDVDLINYEYTYKQINKNTDLKHFDFTKN |
| Ga0181583_104827182 | 3300017952 | Salt Marsh | FPYFTKVNDMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN |
| Ga0181580_103376631 | 3300017956 | Salt Marsh | KFIDTFPSFPKVHDMISQIKKRDDVELINYEYSYTGIHEDTDLKYFEITLN |
| Ga0181569_104798083 | 3300017986 | Salt Marsh | NPYGSYVSFRFIDTFPYFTKVNEMVEEVRKRSDVELINYEYSYTGIHEDTDLKFFDVTIN |
| Ga0181567_102259504 | 3300018418 | Salt Marsh | FIDTFPYFTKVNEMVEEVRKRSDVELINYEYSYHGIHEDTDLKFFDVTIN |
| Ga0181563_100715161 | 3300018420 | Salt Marsh | PSFPKLNDMIFEIKKRHDVDLINYEYSYTGIHEDTDLQYFDIVRN |
| Ga0194023_10457273 | 3300019756 | Freshwater | IDTFPYFTKVNDMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN |
| Ga0194024_10787211 | 3300019765 | Freshwater | FKFIDTFPSFPKVHDMISQIKKRDDVELINYEYSYTGIHEDTDLKYFEITLN |
| Ga0181603_101342293 | 3300020174 | Salt Marsh | YVCFRFIDTFPSFPKVNEMVSEIKSRNDVELIDYEYSYTGIHEDTDLSNLEVTRN |
| Ga0211579_105972602 | 3300020472 | Marine | NFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDLTRH |
| Ga0181598_10406611 | 3300020810 | Salt Marsh | TKVNDMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN |
| Ga0213862_100834645 | 3300021347 | Seawater | FIDTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH |
| Ga0213865_102816563 | 3300021373 | Seawater | KLNDMIFEIKKRHDVDLINYEYSYTGIHEDTDLQYFDIVRN |
| Ga0222718_100986874 | 3300021958 | Estuarine Water | KVNEMIAEIKKREDVDLIDYEYSYTGIHEDTDISNLEITRN |
| Ga0222716_105969351 | 3300021959 | Estuarine Water | FTKMNQMISEIKKRDDVELINYEYSYTGIHEDTDLKYFEITLN |
| Ga0222719_107576672 | 3300021964 | Estuarine Water | DTFPHFTKVNNMIEEIKKREDVDLINYEYSYTSIKKDTDLKYFEITRN |
| Ga0196883_10200181 | 3300022050 | Aqueous | FIDTFPYFTKVNDMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN |
| Ga0212030_10314523 | 3300022053 | Aqueous | MVSEIKKRTDVDLVDYEFTYTGIHEDTDLTHLVITRN |
| Ga0212030_10561091 | 3300022053 | Aqueous | VNEMVEEIKKRSDVDLINYEYTYKQIHKNTDLKHFDFTKN |
| Ga0212024_10820301 | 3300022065 | Aqueous | FVNFKFIDTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH |
| Ga0212021_10017368 | 3300022068 | Aqueous | DTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0212021_10665072 | 3300022068 | Aqueous | TFPYFTKVNDMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN |
| Ga0212028_11045162 | 3300022071 | Aqueous | VSQIKRRTDVDLIDYEYTYTGIHEDTDLTHLEITRN |
| Ga0224906_10515315 | 3300022074 | Seawater | FTKVNEMVEEIKRRSDVDLINYEYSYTGIHEDTDIKHFDFTKN |
| Ga0196891_10478921 | 3300022183 | Aqueous | EEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN |
| Ga0255768_102639893 | 3300023180 | Salt Marsh | YFTKVNDMVEEIKKRSDVDLINYEYSYTGIHEDTDLKHFDITRN |
| Ga0209992_103486811 | 3300024344 | Deep Subsurface | VNFKFIDTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0208667_10078711 | 3300025070 | Marine | VNEMVEEIKRRSDVDLINYEYSYTGIHEDTDIKHFDITRN |
| Ga0208434_11150171 | 3300025098 | Marine | VNEMVEEIKRRSDVDLINYEYSYTGIHEDTDIKHFDFTKN |
| Ga0208669_10166365 | 3300025099 | Marine | NNPYGSYVSFRFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYSYTGIHEDTDIKHFDFTK |
| Ga0208159_10726931 | 3300025101 | Marine | PNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH |
| Ga0208919_11499081 | 3300025128 | Marine | FVDTFPYFTKVNEMVHEVKSRSDVELINFEYSYTGIHEDTDIKHFDITRN |
| Ga0209337_11412733 | 3300025168 | Marine | ETSNNPMGSYVSFSFIDTYPYFTKVNEMVEEIKRRTDVDLINYEYTYKQIHKNTDLKYFDVTRN |
| Ga0208303_100865710 | 3300025543 | Aqueous | RFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDLKHFDFTKN |
| Ga0208303_10539614 | 3300025543 | Aqueous | KFIDTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVTRH |
| Ga0209194_10111561 | 3300025632 | Pelagic Marine | IEEIKKREDVDLINYEYSYTSIKKDTDLKYFEITRN |
| Ga0209194_10923333 | 3300025632 | Pelagic Marine | DTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDLKHLDFTKN |
| Ga0208643_11288863 | 3300025645 | Aqueous | DLYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDLTRH |
| Ga0208161_10313271 | 3300025646 | Aqueous | FVSFRFVDTFPSFPKVNEMVSEIKKRTDVDLVDYEFTYTGIHEDTDLTHLEITRN |
| Ga0208162_10440754 | 3300025674 | Aqueous | EMISEINKREDVDLIDYEYSYTGIHEDTDISNLEITRN |
| Ga0209602_11399253 | 3300025704 | Pelagic Marine | NNMIEEIKKREDVDLIDYEYSYTGIHEDTDLKYFEITRH |
| Ga0208899_10463851 | 3300025759 | Aqueous | YFTKVNEMVAEIKSRNDVELIDYEYSYTGIHEDTDLSNLEVTRN |
| Ga0208425_10523101 | 3300025803 | Aqueous | FVNFKFIDTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0209193_11639071 | 3300025816 | Pelagic Marine | PYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN |
| Ga0208645_11211483 | 3300025853 | Aqueous | ELQLETSNNPYGSYVSFRFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN |
| Ga0209309_101586825 | 3300025881 | Pelagic Marine | DTYPNFPKVNDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDLTRH |
| Ga0209632_102307964 | 3300025886 | Pelagic Marine | NNMIEEIKKREDVDLINYEYSYTSIKKDTDLKYFEITRN |
| Ga0208644_10456261 | 3300025889 | Aqueous | YFPKVNQMVSEIKRRTDVDLIDYEYTYTGIHEDTDLTHLEITRN |
| Ga0208644_13237111 | 3300025889 | Aqueous | NDMIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0209631_102347501 | 3300025890 | Pelagic Marine | MIAEIKKRGDVDLINFEYSYTGIHEDTDLKYFDVTRH |
| Ga0209951_10776043 | 3300026138 | Pond Water | EEIKRRTDVDLINYEYSYTGIHEDTDLKHFDITRN |
| Ga0209503_100639361 | 3300027859 | Marine | DMIAEIKKRGDVDLINFEYSYTGIHEDTDLQYFDVIRH |
| Ga0183683_10093991 | 3300029309 | Marine | VNEMVHEVKSRSDVELINFEYSYTGIHEDTDIKHFDITRN |
| Ga0315320_107662312 | 3300031851 | Seawater | FRFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN |
| Ga0315321_102058971 | 3300032088 | Seawater | PYGSYVSFRFIDTYPYFTKVNEMVEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN |
| Ga0348335_084205_40_153 | 3300034374 | Aqueous | MIEEIKKREDVDLIDYEYSYTGIHEDTDLKYFEITRH |
| Ga0348336_119127_3_113 | 3300034375 | Aqueous | VEEIKRRSDVDLINYEYTYKQIHKNTDIKQFDFTKN |
| ⦗Top⦘ |