| Basic Information | |
|---|---|
| Family ID | F064164 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 47 residues |
| Representative Sequence | AKVINLMDALRRSVETERGGSAKRQAPSVKARGSESERPKKKKSR |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.75 % |
| % of genes near scaffold ends (potentially truncated) | 89.15 % |
| % of genes from short scaffolds (< 2000 bps) | 97.67 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.395 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.829 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.558 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.81% β-sheet: 0.00% Coil/Unstructured: 82.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF02735 | Ku | 1.55 |
| PF05717 | TnpB_IS66 | 1.55 |
| PF00126 | HTH_1 | 1.55 |
| PF03401 | TctC | 0.78 |
| PF08241 | Methyltransf_11 | 0.78 |
| PF00805 | Pentapeptide | 0.78 |
| PF13340 | DUF4096 | 0.78 |
| PF04392 | ABC_sub_bind | 0.78 |
| PF01068 | DNA_ligase_A_M | 0.78 |
| PF08388 | GIIM | 0.78 |
| PF13518 | HTH_28 | 0.78 |
| PF00753 | Lactamase_B | 0.78 |
| PF02668 | TauD | 0.78 |
| PF01625 | PMSR | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 1.55 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.55 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.78 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.78 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.78 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.78 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.40 % |
| Unclassified | root | N/A | 18.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig818891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 730 | Open in IMG/M |
| 3300000550|F24TB_10331108 | Not Available | 769 | Open in IMG/M |
| 3300000550|F24TB_10909995 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1040362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1037593 | Not Available | 752 | Open in IMG/M |
| 3300000956|JGI10216J12902_116858742 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300005178|Ga0066688_10237061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM4349 | 1166 | Open in IMG/M |
| 3300005181|Ga0066678_10125924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1579 | Open in IMG/M |
| 3300005332|Ga0066388_100277961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2317 | Open in IMG/M |
| 3300005332|Ga0066388_100990379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1406 | Open in IMG/M |
| 3300005332|Ga0066388_101338157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1238 | Open in IMG/M |
| 3300005332|Ga0066388_103661230 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005363|Ga0008090_15851680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300005363|Ga0008090_15854972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 755 | Open in IMG/M |
| 3300005434|Ga0070709_10005410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 6915 | Open in IMG/M |
| 3300005434|Ga0070709_11630903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300005437|Ga0070710_10956236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300005440|Ga0070705_101803941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300005454|Ga0066687_10360953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300005540|Ga0066697_10642769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM4349 | 585 | Open in IMG/M |
| 3300005568|Ga0066703_10650076 | Not Available | 610 | Open in IMG/M |
| 3300005575|Ga0066702_10517918 | Not Available | 724 | Open in IMG/M |
| 3300005598|Ga0066706_10688766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
| 3300005598|Ga0066706_10858997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 711 | Open in IMG/M |
| 3300005713|Ga0066905_100815220 | Not Available | 810 | Open in IMG/M |
| 3300005713|Ga0066905_101794565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium liaoningense | 566 | Open in IMG/M |
| 3300005764|Ga0066903_101824285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1162 | Open in IMG/M |
| 3300005764|Ga0066903_101855070 | Not Available | 1153 | Open in IMG/M |
| 3300005764|Ga0066903_102671021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 968 | Open in IMG/M |
| 3300005764|Ga0066903_102835884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300005764|Ga0066903_103046787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 907 | Open in IMG/M |
| 3300005764|Ga0066903_104694786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300005764|Ga0066903_105371737 | Not Available | 677 | Open in IMG/M |
| 3300005764|Ga0066903_105691048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300005764|Ga0066903_105816738 | Not Available | 647 | Open in IMG/M |
| 3300005764|Ga0066903_108803859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300006038|Ga0075365_10694568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. L2-4 | 719 | Open in IMG/M |
| 3300006163|Ga0070715_10187511 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300006791|Ga0066653_10741579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300006796|Ga0066665_11233072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM4349 | 572 | Open in IMG/M |
| 3300006854|Ga0075425_102005772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300006854|Ga0075425_103123148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300006871|Ga0075434_102322431 | Not Available | 539 | Open in IMG/M |
| 3300006871|Ga0075434_102585341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300007788|Ga0099795_10311285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300009137|Ga0066709_103632602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300009137|Ga0066709_103853765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300009162|Ga0075423_11399755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300009792|Ga0126374_11731066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300010043|Ga0126380_11864422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300010048|Ga0126373_11666242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300010048|Ga0126373_12452284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300010048|Ga0126373_12831590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300010358|Ga0126370_10701000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 889 | Open in IMG/M |
| 3300010359|Ga0126376_10425145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1205 | Open in IMG/M |
| 3300010360|Ga0126372_10987332 | Not Available | 852 | Open in IMG/M |
| 3300010361|Ga0126378_11581725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300010366|Ga0126379_10620349 | Not Available | 1169 | Open in IMG/M |
| 3300010366|Ga0126379_12350105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300010376|Ga0126381_101510337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 971 | Open in IMG/M |
| 3300010376|Ga0126381_101748781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300010376|Ga0126381_103114192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300010376|Ga0126381_104127563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300010376|Ga0126381_104810840 | Not Available | 519 | Open in IMG/M |
| 3300010398|Ga0126383_11092845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300012198|Ga0137364_10157593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1645 | Open in IMG/M |
| 3300012201|Ga0137365_10232283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1374 | Open in IMG/M |
| 3300012201|Ga0137365_10734560 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300012204|Ga0137374_11215534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300012205|Ga0137362_10183737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1797 | Open in IMG/M |
| 3300012209|Ga0137379_11368978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300012948|Ga0126375_11084696 | Not Available | 658 | Open in IMG/M |
| 3300012951|Ga0164300_10108192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1234 | Open in IMG/M |
| 3300012957|Ga0164303_11072560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300012960|Ga0164301_11492510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300012971|Ga0126369_12647809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300012971|Ga0126369_13367064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300012975|Ga0134110_10086066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1261 | Open in IMG/M |
| 3300012988|Ga0164306_11308937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300015357|Ga0134072_10195680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300015374|Ga0132255_106075236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300016341|Ga0182035_10318219 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300016357|Ga0182032_11723519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300016387|Ga0182040_10967375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300016387|Ga0182040_11035801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 685 | Open in IMG/M |
| 3300016422|Ga0182039_12110264 | Not Available | 519 | Open in IMG/M |
| 3300016445|Ga0182038_10220327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1507 | Open in IMG/M |
| 3300016445|Ga0182038_10709586 | Not Available | 876 | Open in IMG/M |
| 3300016445|Ga0182038_10775129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300017792|Ga0163161_11569059 | Not Available | 580 | Open in IMG/M |
| 3300018431|Ga0066655_11439955 | Not Available | 502 | Open in IMG/M |
| 3300018433|Ga0066667_11705034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300018433|Ga0066667_12068205 | Not Available | 526 | Open in IMG/M |
| 3300021170|Ga0210400_10335521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1244 | Open in IMG/M |
| 3300021478|Ga0210402_11126071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300021560|Ga0126371_12168603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300022531|Ga0242660_1206468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300025906|Ga0207699_10095093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1878 | Open in IMG/M |
| 3300025906|Ga0207699_11156793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300027907|Ga0207428_11235392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300028885|Ga0307304_10286555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300031546|Ga0318538_10533576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300031572|Ga0318515_10498570 | Not Available | 650 | Open in IMG/M |
| 3300031680|Ga0318574_10931489 | Not Available | 509 | Open in IMG/M |
| 3300031744|Ga0306918_11085505 | Not Available | 620 | Open in IMG/M |
| 3300031748|Ga0318492_10376829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300031764|Ga0318535_10437962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300031769|Ga0318526_10053208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1549 | Open in IMG/M |
| 3300031770|Ga0318521_10474298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300031780|Ga0318508_1125156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300031797|Ga0318550_10202521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 960 | Open in IMG/M |
| 3300031805|Ga0318497_10839619 | Not Available | 515 | Open in IMG/M |
| 3300031879|Ga0306919_10235746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1372 | Open in IMG/M |
| 3300031910|Ga0306923_10487660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1395 | Open in IMG/M |
| 3300031945|Ga0310913_10540040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 827 | Open in IMG/M |
| 3300031945|Ga0310913_11069957 | Not Available | 564 | Open in IMG/M |
| 3300031947|Ga0310909_10122382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2114 | Open in IMG/M |
| 3300031947|Ga0310909_10632688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300031954|Ga0306926_11424747 | Not Available | 803 | Open in IMG/M |
| 3300031981|Ga0318531_10226925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300032001|Ga0306922_10835883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 960 | Open in IMG/M |
| 3300032044|Ga0318558_10194533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 988 | Open in IMG/M |
| 3300032052|Ga0318506_10052785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1645 | Open in IMG/M |
| 3300032055|Ga0318575_10355334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300032076|Ga0306924_10983788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300032090|Ga0318518_10153466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1170 | Open in IMG/M |
| 3300032261|Ga0306920_101894319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 838 | Open in IMG/M |
| 3300032261|Ga0306920_104016321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 534 | Open in IMG/M |
| 3300033290|Ga0318519_10505261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.55% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_14600310 | 2124908045 | Soil | LMDALRRSVEAERGGSAKRQAPSAKARGSESERPKKKKSR |
| F24TB_103311081 | 3300000550 | Soil | IEAPKERAPAKVINLMDALRRSVEAERGGSAKRQAQPAKARGSESERKKKSR* |
| F24TB_109099951 | 3300000550 | Soil | PAKVINLMDALRRSVEAERGGSAKRQASSAKARGSESERPKKKKSR* |
| AP72_2010_repI_A01DRAFT_10403622 | 3300000579 | Forest Soil | KVINLMDALRKSVETERVGPAKRQAPSVKARGSESERPKKKKSR* |
| AF_2010_repII_A01DRAFT_10375933 | 3300000580 | Forest Soil | PAKVINLMDALRRSVETERGAKRQAPSAKARSSESERPKKKKSR* |
| JGI10216J12902_1168587423 | 3300000956 | Soil | APAKVINLMDALRRSVDAERGGSAKRQSPSAKARASESERTKKKKSR* |
| Ga0066688_102370613 | 3300005178 | Soil | MIILPAKVINLMDALRRSVETERGGSAKRQAASAKARGSDSERPKKKKSR* |
| Ga0066678_101259243 | 3300005181 | Soil | MIILPAKVINLMDALRRSVEAERGGSAKRQAPPVKARGSESERPKKKKSR* |
| Ga0066388_1002779611 | 3300005332 | Tropical Forest Soil | MDALRRSVETERVGPAKRQAPSVKARGSESERPKKKKSR* |
| Ga0066388_1009903791 | 3300005332 | Tropical Forest Soil | INLMDALRRSVEASRESGKRQTASVKPRGGQSERPKKKKSC* |
| Ga0066388_1013381571 | 3300005332 | Tropical Forest Soil | INLMDALRRSVEASRESGKRQTASVKPRGGQSERPKKKKSR* |
| Ga0066388_1036612302 | 3300005332 | Tropical Forest Soil | PKERAPAKVINLMDALRRSVDAERGGSAKRQAPSAKARGSESERPKKKKSR* |
| Ga0008090_158516801 | 3300005363 | Tropical Rainforest Soil | IEAPKERAPAKVINLMDALRRSVETERGGAKRQAPSAKARDSQPERPKKKKSR* |
| Ga0008090_158549721 | 3300005363 | Tropical Rainforest Soil | ERAPAKVINLMDALRRSVEAERGGSAKRQAPSAKARGSEFERPKKKKSR* |
| Ga0070709_100054108 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MDALRRSVETERGGSAKRQAPSVKARGSESERPKKKKSR* |
| Ga0070709_116309032 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | APKERAPAKVINLMDALRRSVETERGGSAKRQAPSAKARGNESERPKKKKSR* |
| Ga0070710_109562362 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MDALRRSVETERGGSAKRQATSAKARGSESERPKKKKAR* |
| Ga0070705_1018039411 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IERPERREPAKVINLMDALRRSVEASRESAKRAPAAKARGSQSERPKKKKSR* |
| Ga0066687_103609531 | 3300005454 | Soil | PAKVINLMDALRRSVETERGGSAKRQAPSAKARGNESERPKKKKSR* |
| Ga0066697_106427691 | 3300005540 | Soil | MIILPAKVINLMDALRRSVETERGGSAKRQAASAKARGSDSERPK |
| Ga0066703_106500762 | 3300005568 | Soil | RRSVETERGGSAKRQARSVKARGSESERPKKKKSR* |
| Ga0066702_105179181 | 3300005575 | Soil | LRRSVETERGGSAKRQARSVKARGSESERPKKKKSR* |
| Ga0066706_106887661 | 3300005598 | Soil | EPAKVINLMDALRRSVEASRESAKRAPAAKASGSQSERPKKKKSR* |
| Ga0066706_108589971 | 3300005598 | Soil | MIILPAKVINLMDALRRSVETERGGSAKRQAASAKA |
| Ga0066905_1008152203 | 3300005713 | Tropical Forest Soil | ERREPSKVINLMDALRRSVDASRESAKRAPSIKPRGSQSERPKKKKSR* |
| Ga0066905_1017945651 | 3300005713 | Tropical Forest Soil | KVINLMDALRRSVDAERGGSAKRQAPLAKARGGDSERPKKKKSR* |
| Ga0066903_1018242851 | 3300005764 | Tropical Forest Soil | RSVEEERGGQPKRQAASVKARGGQSERPKKKKSR* |
| Ga0066903_1018550703 | 3300005764 | Tropical Forest Soil | EAPKERAPAKVINLMDALRRSVEAERGSAKRQTASAKERGSQSERPKKKKSR* |
| Ga0066903_1026710211 | 3300005764 | Tropical Forest Soil | DALRRSVEAERGGSAKRQAASAKARGSESERPKKKKSR* |
| Ga0066903_1028358841 | 3300005764 | Tropical Forest Soil | EKIEAPKERAPAKVINLMDALRRSVDAERGGKREATSAKARGSESERPKKKKSR* |
| Ga0066903_1030467871 | 3300005764 | Tropical Forest Soil | QAGEKIEAPKERAPAKVINLMDALRRSVETERSGPAKRQSSSVKASGSESERPKKKKSR* |
| Ga0066903_1046947861 | 3300005764 | Tropical Forest Soil | KVINLMDALRRSVEAGRGGSAKRQALFAKARDSQPERPKKKKSR* |
| Ga0066903_1053717372 | 3300005764 | Tropical Forest Soil | PAKVINLMDALRRSVEAERGGSAKRQAPSAKARGSEFERPKKKKSR* |
| Ga0066903_1056910482 | 3300005764 | Tropical Forest Soil | EAPKERAPAKVINLMDALRRSVETERVGPAKRQAPSVKARGSESERPKKKKSR* |
| Ga0066903_1058167382 | 3300005764 | Tropical Forest Soil | MDALRRSVEAERGGSAKRQEAAPAAERPKKKKSR* |
| Ga0066903_1088038591 | 3300005764 | Tropical Forest Soil | MEYHDPLNAIEAPKERAPAKVINLMDALRRSVETERGGSAKRQAPPAKARGSQSERPKKKKSR* |
| Ga0075365_106945681 | 3300006038 | Populus Endosphere | AKVINLMDALRRSVETERGGKREAAAKARSGESVRPKKKKSR* |
| Ga0070715_101875111 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NLMDALRRSVETERGGSAKRQAPSVKARGSESERPKKKKSR* |
| Ga0066653_107415792 | 3300006791 | Soil | KIEAPKERAPAKVINLMDALRRSVEAERGGSAKRQAQPAKARGSESERKKKSR* |
| Ga0066665_112330721 | 3300006796 | Soil | MIILPAKVINLMDALRRSVETERGGSAKRQAASAKARGSNSERPKKKNRARR* |
| Ga0075425_1020057722 | 3300006854 | Populus Rhizosphere | APKERAPAKVINLMDALRRSVEAERGGSAKRQAPSAKARGSDSERPKKKKSR* |
| Ga0075425_1031231481 | 3300006854 | Populus Rhizosphere | KVINLMDALRRSVETERSGSAKRSAPAAKARGESERPKKKKSR* |
| Ga0075434_1023224311 | 3300006871 | Populus Rhizosphere | NLMDALRRSVETERGGKRVAAAKARGGESERPKKKKSR* |
| Ga0075434_1025853412 | 3300006871 | Populus Rhizosphere | INLMDALRRSVAAERGGSPKRQAPPARARGSASERPKKKKSR* |
| Ga0099795_103112852 | 3300007788 | Vadose Zone Soil | PEKVINLMDALRRSVETERGGSAKRQATSEKARGSESERPKKKKAR* |
| Ga0066709_1036326021 | 3300009137 | Grasslands Soil | PMERAERDEPAEITNLMDALRRSVEAGRESAKRQAPSVKSRGSQSERPKKKKSR* |
| Ga0066709_1038537651 | 3300009137 | Grasslands Soil | RPERREPAKVINLMDALRRSVEASRESAKRQAPTAKARGTQSERPKKKKSR* |
| Ga0075423_113997552 | 3300009162 | Populus Rhizosphere | PAKVINLMDALRRSVETERGGSAKRQATSEKARGSESERPKKKKAR* |
| Ga0126374_117310661 | 3300009792 | Tropical Forest Soil | APKERAPAKVINLMDALRRSVEAERGSGKRQTASAKERGSQSERPKKKKSR* |
| Ga0126380_118644222 | 3300010043 | Tropical Forest Soil | RAPAKVINLMDALRRSVETERGGSAKRQAPSSAKARDSQPERPKKKKSR* |
| Ga0126373_116662421 | 3300010048 | Tropical Forest Soil | AKVINLMDALRRSVETERGGSAKRQAPSVKARGGESERPKKKKSR* |
| Ga0126373_124522842 | 3300010048 | Tropical Forest Soil | PIERPERREPSKVINLMDALRRSVEASRESGKRQTASVKPRGGQSERPKKKKSR* |
| Ga0126373_128315901 | 3300010048 | Tropical Forest Soil | KVINLMDALRRSVETERGGSAKRQAPPAKARGSQSERPKKKKSR* |
| Ga0126370_107010002 | 3300010358 | Tropical Forest Soil | VVLLSQILSVCPLAGEKIEAPKERAPAKVINLMDALRRSVEAERGGPAKRQAPVVKARGGESERPKKKKSR* |
| Ga0126376_104251454 | 3300010359 | Tropical Forest Soil | PKERTPAKVINLKDALRRSVETERGRSPKRQAPSVKAPGSESERPKKKKSR* |
| Ga0126372_109873323 | 3300010360 | Tropical Forest Soil | KIEAPKERAPAKVVNLMDALRRSVEAERGGSAKRQAPSAKARGSESERPKKKKSR* |
| Ga0126378_115817251 | 3300010361 | Tropical Forest Soil | VCPLAGEKIEAPKERAPAKVINLMDALRRSVETERVGPAKRQAPSVKARGSESERPKKKKSR* |
| Ga0126379_106203491 | 3300010366 | Tropical Forest Soil | APAKVVNLMDALRRSVEAERGGSAKRQAPSAKARGSESERPKKKKSR* |
| Ga0126379_123501053 | 3300010366 | Tropical Forest Soil | EAPRERAPAKVINLMDALRRSVEEERGGPTKRQAASVKARGGESERPKKKNSR* |
| Ga0126381_1015103371 | 3300010376 | Tropical Forest Soil | EAPKERAPAKVINLMDALRRSVETERGGSAKRQAPPTKARGSQSERPKKKKSR* |
| Ga0126381_1017487812 | 3300010376 | Tropical Forest Soil | GEKIEAPKERAPAKVINLMDALRRSVETERVGPAKRQAPSVKARGSESERPKKKKSR* |
| Ga0126381_1031141921 | 3300010376 | Tropical Forest Soil | IEAPKERAPAKVINLMDALRRSVETERGGSAKRQAPSAKARGNESERPKKKKSR* |
| Ga0126381_1041275631 | 3300010376 | Tropical Forest Soil | KVINLMDALRRSVETERGGAKRQAPSAKARDSQSERPKKKKSR* |
| Ga0126381_1048108402 | 3300010376 | Tropical Forest Soil | PERREPSKVINLMDALRRSVDTSRESAKRAQSIKPRGSQSERPKKKKSR* |
| Ga0126383_110928453 | 3300010398 | Tropical Forest Soil | KERAPAKVINLMDALRRSVETERGRSPKRQAPSVKAPGSESERPKKKKSR* |
| Ga0137364_101575931 | 3300012198 | Vadose Zone Soil | MIILPAKVINLMDALRRSVETERAGSAKRQAASAKARGSDSERPKKKKSR* |
| Ga0137365_102322831 | 3300012201 | Vadose Zone Soil | VINLMDALRRSVEAERGGSAKRQAQPAKARGSESERKKKSR* |
| Ga0137365_107345601 | 3300012201 | Vadose Zone Soil | MDALRRSVEAERGGSAKRQAQPAKARGSESERKKKSR |
| Ga0137374_112155341 | 3300012204 | Vadose Zone Soil | ERAPAKVINLMDALRRSVEAERGASAKRQAPSAKARGSESERPKKKKSR* |
| Ga0137362_101837371 | 3300012205 | Vadose Zone Soil | ERPQRREPAKVINLMDALRRSVEANRGPGKRQAPSAKSRSSQAERPKKKKSR* |
| Ga0137379_113689781 | 3300012209 | Vadose Zone Soil | AKVINLMDALRRSVEASRESAKRQAPSVKARGSQSNHPTKEKSR* |
| Ga0126375_110846962 | 3300012948 | Tropical Forest Soil | PAKVINLMDALRRSVETERGGAKRQSPSAKARGSESERPKKKKSR* |
| Ga0164300_101081922 | 3300012951 | Soil | MDALRRSVEAERGGSAKRQAPSAKARAGESERPKKKKSR* |
| Ga0164303_110725602 | 3300012957 | Soil | VINLMDALRRSVEAERGGSAKRQAPSAKARAGESERPKKKKSR* |
| Ga0164301_114925102 | 3300012960 | Soil | NLMDAWRRSVETERGGAAKRQAPSVKARGSESERPKKKKSR* |
| Ga0126369_126478091 | 3300012971 | Tropical Forest Soil | KVINLMDTLRRSVEEERGGPTKREAPSVKARGGASERPKKKKSR* |
| Ga0126369_133670642 | 3300012971 | Tropical Forest Soil | INLMDALRRSVETERGGSAKRQAPAAKALGSQSERPKKKKSR* |
| Ga0134110_100860664 | 3300012975 | Grasslands Soil | ERAPAKVINLMDALRRSVETERGGAAKRQAPSAKVRGSDSERPKKKKSR* |
| Ga0164306_113089371 | 3300012988 | Soil | ESHQSMDALRRSVETERSGSAKRPAPAAKARVGESERPKKKKSR* |
| Ga0134072_101956801 | 3300015357 | Grasslands Soil | AKVINLMDALRRSVETERGGSAKRQALSAKARDSASERPKKKKSAS* |
| Ga0132255_1060752362 | 3300015374 | Arabidopsis Rhizosphere | AGEKIEAPKERAPAKVINLMDALRRSVETERGGSAKRQAPSPKARGSESERPKKKKSR* |
| Ga0182035_103182191 | 3300016341 | Soil | EAPKERAPAKVINLMDALRRSVETERGGSAKRQAPSAKARGSESERPKKKKSR |
| Ga0182032_117235192 | 3300016357 | Soil | PERREPSKVINLMDALRRSVDASRESAKRAPSIKARGSQSERPKKKKSR |
| Ga0182040_109673751 | 3300016387 | Soil | PAKVINLMDALRRSVEAERGGSAKRQAFSANARDSQPERPKKKKSR |
| Ga0182040_110358011 | 3300016387 | Soil | VINLMDALRRSVDASRESAKRAPSIKPRGSQSERPKKKKSR |
| Ga0182039_121102641 | 3300016422 | Soil | EAPRERAPAKVINLMDALRRSVQDSREAKRQAPSVKARGSQSDRPTKKKSR |
| Ga0182038_102203271 | 3300016445 | Soil | PKERAPAKVINLMDALRRSVETERGGSAKRQTPSAKARGSESERPKKKKSR |
| Ga0182038_107095861 | 3300016445 | Soil | ERAPAKVINLMDALRRSVEAERGGSAKRQEAAPAAERPKKKKSR |
| Ga0182038_107751291 | 3300016445 | Soil | INLMDALRRSVETERGGSAKRQAAPAKARGSQSERPKKKKSR |
| Ga0163161_115690592 | 3300017792 | Switchgrass Rhizosphere | MDALRRSVETERGGSAKRQAPSVKARGSESERPKKKKSR |
| Ga0066655_114399551 | 3300018431 | Grasslands Soil | MIILPAKVINLMDALRRSVETERGGSAKRQAASAKARGSDSERPKKKKSR |
| Ga0066667_117050342 | 3300018433 | Grasslands Soil | EAPKERTPAKVINLMDALRRSVETERGGSAKRQAQSAKARGSESERPRKKNRAR |
| Ga0066667_120682051 | 3300018433 | Grasslands Soil | MDALRQSVDAERGGPAKRQAASAKARGSQSERPKKKKSG |
| Ga0210400_103355214 | 3300021170 | Soil | LMDALRRSVETERGGSAKRQAPSVKARGSESERPKKKKSR |
| Ga0210402_111260711 | 3300021478 | Soil | IEAPKERAPAKVINLMDALRRSVEAERGGPAKRQAPSVKARGGESERPKKKKSR |
| Ga0126371_121686031 | 3300021560 | Tropical Forest Soil | KVINLMDALRRSVETERGWSPKRQAPSVKAPGSESERPKKKKSR |
| Ga0242660_12064681 | 3300022531 | Soil | GKKIEAPKERAPAKVINLMDALRRSVETERGGSAKRQAPSVKARGRESERPKKKKSR |
| Ga0207699_100950934 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AKVINLMDALRRSVETERGGSAKRQAPSVKARGSESERPKKKKSR |
| Ga0207699_111567931 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | INLMDALRRSVETERGGSAKRQAPSAKARGNESERPKKKKSR |
| Ga0207428_112353922 | 3300027907 | Populus Rhizosphere | RAPAKVINLMDALRRSVEEERGGPKKRQAASVKARGGESERPKKKKSR |
| Ga0307304_102865552 | 3300028885 | Soil | RAPAKVINLMDALRRSVETERGGSAKRQAPSAKARGNESERPKKKKSR |
| Ga0318538_105335762 | 3300031546 | Soil | QSGQPIERPERREPSKVINLMDALRRSVDASRESAKRAPSIKPRGSQSERPKKKKSR |
| Ga0318515_104985701 | 3300031572 | Soil | NLMDALRRSVDASRESAKRAPSIKPRGSQSERPKKKKSR |
| Ga0318574_109314891 | 3300031680 | Soil | PERREPSKVINLMDALRRSVDASRESAKRAPSIKPRGSQSERPKKKKSR |
| Ga0306918_110855052 | 3300031744 | Soil | SGQPIERPERREPSKVINLMDALRRSVDASRESAKRAPSIKPRGSQSERPKKKKSR |
| Ga0318492_103768293 | 3300031748 | Soil | QSGQPIERPERREPSKVINLMDALRRSVDASRESAKRAPSIKARGSQSERPKKKKSR |
| Ga0318535_104379622 | 3300031764 | Soil | LMDALRRSVDASRESAKRAPSIKARGSQSERPKKKKSR |
| Ga0318526_100532081 | 3300031769 | Soil | LMDALRRSVESSRELVKRQAQSVKPRGSQSERPKKKKSR |
| Ga0318521_104742981 | 3300031770 | Soil | APKERAPAKVINLMDALRRSVETERGGSAKRQTPSAKARGSESERPKKKKSR |
| Ga0318508_11251563 | 3300031780 | Soil | LMDALRRSVETERGGSAKRQAPPAKARGSQSERPKKKKSR |
| Ga0318550_102025211 | 3300031797 | Soil | MDALRRSVETERGGSAKRQAPPAKARGSQSERPKKKKSR |
| Ga0318497_108396191 | 3300031805 | Soil | MDALRRSVDASRESAKRAPSIKPRGSQSERPKKKKSR |
| Ga0306919_102357461 | 3300031879 | Soil | APAKVINLMDALRRSVETERGGSAKRQAPPAKARGSQSERPKKKKSR |
| Ga0306923_104876601 | 3300031910 | Soil | IEAPKERAPAKVINLMDALRRSVETERGGSAKRQAPLAKARGSQSERPKKKKSR |
| Ga0310913_105400401 | 3300031945 | Soil | PAKVINLMDALRQSVEAERGGSAKRQAPSAERPKKKKSR |
| Ga0310913_110699572 | 3300031945 | Soil | KIEAPKERAPAKVINLMDALRRSVETERGGSAKRQARSESERPKKKKSR |
| Ga0310909_101223825 | 3300031947 | Soil | GQPIERPERHEPSKVINLMDALRRSVDASRESAKRAPSIKPRGSQSERPKKKKSR |
| Ga0310909_106326882 | 3300031947 | Soil | RAPAKVINLMDALRRSVETERGGSAKRQTPSAKARGSESERPKKKKSR |
| Ga0306926_114247472 | 3300031954 | Soil | RARERAPAKVINLMDALRRSVETERGGSAKRPAPSAKARGSESERPKKKKSR |
| Ga0318531_102269251 | 3300031981 | Soil | IEAPKERVPAKVINLMDALRRSVETERGGSAKRQAPPAKARGSQSERPKKKKSR |
| Ga0306922_108358831 | 3300032001 | Soil | IEAPKERAPAKVINSMDALRRSVEAERGESAKRQAPSAKVRGSDSERPEKKRSR |
| Ga0318558_101945331 | 3300032044 | Soil | FLERPERREPSKVINLMDALRRSVDASRESAKRAPSIKARGSQSERPKKKKSR |
| Ga0318506_100527855 | 3300032052 | Soil | AKVINLMDALRRSVEAERGGSAKRQAPSAKARDSQPERPKKKKSR |
| Ga0318575_103553341 | 3300032055 | Soil | PAKVINLMDALRRSVETERGGSAKRQTPSAKARGSESERPKKKKSR |
| Ga0306924_109837881 | 3300032076 | Soil | PRERAPAKVINLMDALRRSVETERGGSAKRQAPAAKARGSQSERPKKKKSR |
| Ga0318518_101534661 | 3300032090 | Soil | AKVINLMDALRRSVESSRELVKRQAQSVKPRGSQSERPKKKKSR |
| Ga0306920_1018943191 | 3300032261 | Soil | EPSKVINLMDALRRSVDASRESAKRAPSIKPRGSQSERPKKKKSR |
| Ga0306920_1040163212 | 3300032261 | Soil | MDALRRSVETERVGPAKRQGASAKAHGSDSERQKKKKSR |
| Ga0318519_105052612 | 3300033290 | Soil | LMDALRRSVETERGGSAKRQTPSAKARGSESERPKKKKSR |
| ⦗Top⦘ |