| Basic Information | |
|---|---|
| Family ID | F064159 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MHRLSTVLCTSGLAAEARIARAAGFPVVIGAGDRERTAALVE |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.06 % |
| % of genes near scaffold ends (potentially truncated) | 97.67 % |
| % of genes from short scaffolds (< 2000 bps) | 88.37 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.364 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.457 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.008 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.310 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 24.29% β-sheet: 8.57% Coil/Unstructured: 67.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF13243 | SQHop_cyclase_C | 46.51 |
| PF00067 | p450 | 11.63 |
| PF13249 | SQHop_cyclase_N | 8.53 |
| PF01593 | Amino_oxidase | 3.88 |
| PF06574 | FAD_syn | 3.88 |
| PF00494 | SQS_PSY | 1.55 |
| PF01048 | PNP_UDP_1 | 0.78 |
| PF03918 | CcmH | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 11.63 |
| COG0196 | FAD synthase | Coenzyme transport and metabolism [H] | 3.88 |
| COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 1.55 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.78 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.78 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.78 |
| COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.36 % |
| Unclassified | root | N/A | 42.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_11028252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 555 | Open in IMG/M |
| 3300004152|Ga0062386_100060245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2870 | Open in IMG/M |
| 3300005166|Ga0066674_10349679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300005171|Ga0066677_10377223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300005290|Ga0065712_10566776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300005332|Ga0066388_107671437 | Not Available | 541 | Open in IMG/M |
| 3300005446|Ga0066686_10544866 | Not Available | 788 | Open in IMG/M |
| 3300005458|Ga0070681_11861772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300005529|Ga0070741_11051340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 695 | Open in IMG/M |
| 3300005535|Ga0070684_100639747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 990 | Open in IMG/M |
| 3300005539|Ga0068853_102301376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300005549|Ga0070704_102057771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300005559|Ga0066700_10095378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1939 | Open in IMG/M |
| 3300005561|Ga0066699_10286817 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300005563|Ga0068855_101535745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300005574|Ga0066694_10484796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300005576|Ga0066708_10742730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 619 | Open in IMG/M |
| 3300005844|Ga0068862_101096382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300006046|Ga0066652_101837458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
| 3300006163|Ga0070715_10259531 | Not Available | 912 | Open in IMG/M |
| 3300006800|Ga0066660_11659617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium AT-5844 | 508 | Open in IMG/M |
| 3300006806|Ga0079220_11985001 | Not Available | 518 | Open in IMG/M |
| 3300009038|Ga0099829_10697829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300009137|Ga0066709_104669536 | Not Available | 501 | Open in IMG/M |
| 3300009156|Ga0111538_13479473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300009162|Ga0075423_13196453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300009545|Ga0105237_12724427 | Not Available | 505 | Open in IMG/M |
| 3300010361|Ga0126378_10058426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 3635 | Open in IMG/M |
| 3300010366|Ga0126379_10678019 | Not Available | 1123 | Open in IMG/M |
| 3300010375|Ga0105239_12240625 | Not Available | 635 | Open in IMG/M |
| 3300010376|Ga0126381_100574860 | Not Available | 1600 | Open in IMG/M |
| 3300010376|Ga0126381_101984051 | Not Available | 839 | Open in IMG/M |
| 3300010376|Ga0126381_102453538 | Not Available | 748 | Open in IMG/M |
| 3300010398|Ga0126383_13432331 | Not Available | 517 | Open in IMG/M |
| 3300011120|Ga0150983_13567148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 505 | Open in IMG/M |
| 3300011444|Ga0137463_1049611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1562 | Open in IMG/M |
| 3300012205|Ga0137362_11410983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300012209|Ga0137379_10333937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1426 | Open in IMG/M |
| 3300012211|Ga0137377_10871963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300012353|Ga0137367_11058052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300012355|Ga0137369_10782235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300012387|Ga0134030_1285620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300012582|Ga0137358_10407947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300012582|Ga0137358_10925853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300012683|Ga0137398_11153728 | Not Available | 531 | Open in IMG/M |
| 3300012917|Ga0137395_10526816 | Not Available | 852 | Open in IMG/M |
| 3300012925|Ga0137419_10702150 | Not Available | 821 | Open in IMG/M |
| 3300012927|Ga0137416_10852590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 808 | Open in IMG/M |
| 3300012929|Ga0137404_11000682 | Not Available | 765 | Open in IMG/M |
| 3300012971|Ga0126369_10175860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2040 | Open in IMG/M |
| 3300013308|Ga0157375_13112160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300014262|Ga0075301_1100285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300015373|Ga0132257_102181563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300016294|Ga0182041_12173520 | Not Available | 518 | Open in IMG/M |
| 3300016319|Ga0182033_12123787 | Not Available | 512 | Open in IMG/M |
| 3300016357|Ga0182032_11423847 | Not Available | 600 | Open in IMG/M |
| 3300016371|Ga0182034_10195345 | Not Available | 1560 | Open in IMG/M |
| 3300016404|Ga0182037_11632016 | Not Available | 574 | Open in IMG/M |
| 3300016422|Ga0182039_10387924 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300016422|Ga0182039_12166681 | Not Available | 513 | Open in IMG/M |
| 3300018422|Ga0190265_13636082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300018431|Ga0066655_10246544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1137 | Open in IMG/M |
| 3300018433|Ga0066667_11059879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300018433|Ga0066667_12186462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 515 | Open in IMG/M |
| 3300018482|Ga0066669_12166565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300020580|Ga0210403_11526388 | Not Available | 502 | Open in IMG/M |
| 3300020582|Ga0210395_10613200 | Not Available | 816 | Open in IMG/M |
| 3300021168|Ga0210406_10319501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
| 3300021178|Ga0210408_11172905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300021420|Ga0210394_10570906 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300021559|Ga0210409_11081965 | Not Available | 677 | Open in IMG/M |
| 3300021560|Ga0126371_10023043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5763 | Open in IMG/M |
| 3300021560|Ga0126371_13110182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300022711|Ga0242674_1013434 | Not Available | 886 | Open in IMG/M |
| 3300022722|Ga0242657_1072332 | Not Available | 802 | Open in IMG/M |
| 3300025324|Ga0209640_10449751 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300025920|Ga0207649_11230510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300025922|Ga0207646_10653783 | Not Available | 942 | Open in IMG/M |
| 3300025926|Ga0207659_10938981 | Not Available | 744 | Open in IMG/M |
| 3300025930|Ga0207701_10804429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300025938|Ga0207704_11262023 | Not Available | 631 | Open in IMG/M |
| 3300025944|Ga0207661_10991890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300026035|Ga0207703_10723701 | Not Available | 947 | Open in IMG/M |
| 3300026550|Ga0209474_10357682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300026557|Ga0179587_10489729 | Not Available | 806 | Open in IMG/M |
| 3300027737|Ga0209038_10006273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3509 | Open in IMG/M |
| 3300028381|Ga0268264_10306568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1497 | Open in IMG/M |
| 3300030905|Ga0308200_1116976 | Not Available | 585 | Open in IMG/M |
| 3300031122|Ga0170822_12393914 | Not Available | 612 | Open in IMG/M |
| 3300031543|Ga0318516_10060412 | Not Available | 2084 | Open in IMG/M |
| 3300031544|Ga0318534_10644861 | Not Available | 600 | Open in IMG/M |
| 3300031545|Ga0318541_10186716 | Not Available | 1145 | Open in IMG/M |
| 3300031561|Ga0318528_10101994 | Not Available | 1507 | Open in IMG/M |
| 3300031564|Ga0318573_10165545 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300031564|Ga0318573_10361399 | Not Available | 779 | Open in IMG/M |
| 3300031640|Ga0318555_10638392 | Not Available | 576 | Open in IMG/M |
| 3300031679|Ga0318561_10007015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4714 | Open in IMG/M |
| 3300031679|Ga0318561_10206845 | Not Available | 1065 | Open in IMG/M |
| 3300031680|Ga0318574_10397838 | Not Available | 805 | Open in IMG/M |
| 3300031680|Ga0318574_10482732 | Not Available | 726 | Open in IMG/M |
| 3300031681|Ga0318572_10021831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3224 | Open in IMG/M |
| 3300031681|Ga0318572_10642679 | Not Available | 632 | Open in IMG/M |
| 3300031708|Ga0310686_104974276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300031719|Ga0306917_10009220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5591 | Open in IMG/M |
| 3300031719|Ga0306917_10068421 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300031747|Ga0318502_10515410 | Not Available | 717 | Open in IMG/M |
| 3300031763|Ga0318537_10035451 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300031764|Ga0318535_10358049 | Not Available | 652 | Open in IMG/M |
| 3300031769|Ga0318526_10107543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300031770|Ga0318521_10285998 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300031771|Ga0318546_10000622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 13700 | Open in IMG/M |
| 3300031777|Ga0318543_10208407 | Not Available | 868 | Open in IMG/M |
| 3300031795|Ga0318557_10136923 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300031796|Ga0318576_10020980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2595 | Open in IMG/M |
| 3300031797|Ga0318550_10544010 | Not Available | 559 | Open in IMG/M |
| 3300031846|Ga0318512_10164694 | Not Available | 1075 | Open in IMG/M |
| 3300031893|Ga0318536_10300863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300031912|Ga0306921_11162360 | Not Available | 861 | Open in IMG/M |
| 3300031938|Ga0308175_101587388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300031946|Ga0310910_10976167 | Not Available | 663 | Open in IMG/M |
| 3300031947|Ga0310909_10620833 | Not Available | 902 | Open in IMG/M |
| 3300031962|Ga0307479_11789081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300032090|Ga0318518_10012755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3525 | Open in IMG/M |
| 3300032091|Ga0318577_10604439 | Not Available | 521 | Open in IMG/M |
| 3300032180|Ga0307471_103564488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300032515|Ga0348332_13754807 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300033158|Ga0335077_11017959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.78% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_110282521 | 3300004080 | Bog Forest Soil | MRRLSTVLCTSGLAAEAKIARAAGFPVVIGAGDRERTAALVENAVQ |
| Ga0062386_1000602451 | 3300004152 | Bog Forest Soil | MHRLSSVLCTSGLAAEAKIARAAGFPVVIGAGDRERTAALVENAVQQ |
| Ga0066674_103496791 | 3300005166 | Soil | MRILTPVLCTSGLAAEARVARAAGFQVIVGAGDPERTTALVKDAA |
| Ga0066677_103772232 | 3300005171 | Soil | MRTLTPVLCTSGLAAEARVARAAGFQVIVGAGDPERTTAL |
| Ga0065712_105667761 | 3300005290 | Miscanthus Rhizosphere | MRILTPVLCTSGLAAEARVARAAGFQVIVGAGDPERTTALVKD |
| Ga0066388_1076714371 | 3300005332 | Tropical Forest Soil | MHRLSTVLCTSGLAAEARIARASGFPVVIGAGDRDRTAALVANAVKGANCLIS |
| Ga0066686_105448661 | 3300005446 | Soil | MQPLAMVLCTSGLAVEAKIARAAGFSAVIGAGDRDRTAALV |
| Ga0070681_118617722 | 3300005458 | Corn Rhizosphere | MRRTLTPVLCTSGLAAEARVARAAGFQVIVGAGDSRRTTALVAYAAQRAKCLISFG |
| Ga0070741_110513402 | 3300005529 | Surface Soil | MRTLIPVLCTSGLAAEARIARAAGFQVIIGAGDPNRTATLVAAAAQQAKCLVSFGV |
| Ga0070684_1006397471 | 3300005535 | Corn Rhizosphere | MRTLTPVLCTSGLAAEAKVARAAGFQVIVGAGDPRRTAELVELAAKRAKFLISFGVAG |
| Ga0068853_1023013761 | 3300005539 | Corn Rhizosphere | MRTLTPVLCTSGLAAEAKVARAAGFQVIVGAGDPRRTAELVELAAKRAKFL |
| Ga0070704_1020577711 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLTPVLCTSGLAAEARVARAAGFQVIVGAGDPERTTALVKDAARDAKCLVSFGV |
| Ga0066700_100953781 | 3300005559 | Soil | MRILTPVLCTSGLAAEARVARAAGFQVIVGGGDPGRTEALVEDAAQQAKCLVSFGVAG |
| Ga0066699_102868171 | 3300005561 | Soil | MQPPATVLCTSGLAVEAKIARAAGFSVVIGAADRD |
| Ga0068855_1015357452 | 3300005563 | Corn Rhizosphere | MRTLTPVLCTSGLAAEARIARAAGFQVIVGAGDPRRTAALVEAAAPQARCLISFGIA |
| Ga0066694_104847961 | 3300005574 | Soil | MRTLIPVLCTSGLAAEAKVARAAGFQVIVGAGDPERTTALVQAAIRQAKCLI |
| Ga0066708_107427302 | 3300005576 | Soil | MRTLTPVLCTSGLAAEARVARAAGFPVIVGAGDHGRTMVLLKNAAREAKCLVSFGVAG |
| Ga0068862_1010963821 | 3300005844 | Switchgrass Rhizosphere | MRTLTPVLCTSGLAAEAKVARAAGFQVIVGAGDPRRTAELVELAA |
| Ga0066652_1018374581 | 3300006046 | Soil | MRTLIPVLCTSGLAAEAKVARAAGFQVIVGAGDPERTTALVEAAIRRAKCLISFGIAGG |
| Ga0070715_102595312 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRLSTVLCTSGLAAEAKIARAAGFPVIIGAGDRERTAVLVRNAVQRASC |
| Ga0066660_116596171 | 3300006800 | Soil | MRTLAPVLCTSGLAAEARVARAAGFQVIVGGGDPRRTASLVQSAARQAKCLV |
| Ga0079220_119850011 | 3300006806 | Agricultural Soil | MLRSSTVLCTSGLAVEAKIARAAGFPVVIGAGDRARTSALVEEA |
| Ga0099793_104236731 | 3300007258 | Vadose Zone Soil | MQPPAMVLCTSGLAVEAKIARAAGFSVVIRAGDRDRTAALVATAAAQTD |
| Ga0099829_106978291 | 3300009038 | Vadose Zone Soil | MRTLIPVLCTSGLAAEAKVARAAGFQVIVGAGDPERTTALVEAAIRQAKCLISFGIAGGL |
| Ga0066709_1046695361 | 3300009137 | Grasslands Soil | MQPLATVLCTSGLAVEARIARAAGFSVVVGAGDRDRTAALVATAAAQTDC |
| Ga0111538_134794731 | 3300009156 | Populus Rhizosphere | MSQRKGELRMRTLTPVLCTSGLAAEARIARAAGFPVIVGAGDPHRTAALVEAAA |
| Ga0075423_131964532 | 3300009162 | Populus Rhizosphere | MRTLTPVLCTSGLAAEARIARAAGFPVIVGAGDPHRTAALVEAAARQAKCLV |
| Ga0105237_127244272 | 3300009545 | Corn Rhizosphere | MHRLSTVLCTSGLAAEARIARAAGFPVVIGAGDRERTAALVE |
| Ga0126378_100584261 | 3300010361 | Tropical Forest Soil | VGLLTSVLCTSGLAAEARIARAAGFPVVIGAGDRERTAAL |
| Ga0126379_106780192 | 3300010366 | Tropical Forest Soil | MLCTSGLAIEAKIARAAGFSVAVGGGDRDRTRALVEAAA |
| Ga0105239_122406252 | 3300010375 | Corn Rhizosphere | MSTLSTVLCTAGLAAEAKIARAAGFPVIVGGGDPYRTVSLVDTAAA |
| Ga0126381_1005748602 | 3300010376 | Tropical Forest Soil | VLCTSGLAAEARIARAAGFPVVIGAGDRDRTAALVESA |
| Ga0126381_1019840511 | 3300010376 | Tropical Forest Soil | MQPLATVLCTSGLMVEAKIAQAAGFSVVIGAGDRDRT |
| Ga0126381_1024535381 | 3300010376 | Tropical Forest Soil | MSPLRRTLLCTTGLAAEARIARAAGFTTVVGGGDRERTA |
| Ga0126383_134323311 | 3300010398 | Tropical Forest Soil | MHRLATVLCTSGLAAEARIARAAGFPVVIGAGDRDRTAALVESAVQHAKCLM |
| Ga0150983_135671481 | 3300011120 | Forest Soil | MHRLSTVLCTSGLAAEAKVARAAGFSVVIGAGDRDRTAALVENAVRHA |
| Ga0137463_10496111 | 3300011444 | Soil | MRTLTPVLCTSGLAAEARIARAAGFQVIVGAGDHRRTTVLVEAA |
| Ga0137362_114109832 | 3300012205 | Vadose Zone Soil | MRTLIPVLCTSGLAAEAKVARAAGFQVIVGAGDPERTTALVEAAIRQAKC |
| Ga0137379_103339371 | 3300012209 | Vadose Zone Soil | MRTLIPVLCTSGLAAEAKVARAAGFQVIVGSFDEAATT |
| Ga0137377_108719631 | 3300012211 | Vadose Zone Soil | MRTLIPVLCTSGLAAEAKVARAAGFQVIVGAGDPERTTALVQAAIRQAKCL |
| Ga0137367_110580521 | 3300012353 | Vadose Zone Soil | MRTLTPVLCTSGLAAEARVARAAGFPVIVGAGDHG |
| Ga0137369_107822352 | 3300012355 | Vadose Zone Soil | MRTLTPVLCTSGLAAEARVARAAGFPVIVGAGDHGRTTVLLENAAR |
| Ga0134030_12856202 | 3300012387 | Grasslands Soil | MRILTPVLCTSGLAAEARVARAAGFQVIVGAGDPERTTALVKDAARDAKCLVSFGVA |
| Ga0137358_104079471 | 3300012582 | Vadose Zone Soil | MRTLTPVLCTSGLAAEARVARAAGFQVIVGAGDPERTTALVK |
| Ga0137358_109258531 | 3300012582 | Vadose Zone Soil | MRTLTPVLCTSGLAAEAKVARAAGFQVIVGAGDPARTTAL |
| Ga0137398_111537282 | 3300012683 | Vadose Zone Soil | MHRLSTVLCTSGLAAEAKIARAAGFPVVIGAGDRERTAALVESA |
| Ga0137395_105268162 | 3300012917 | Vadose Zone Soil | MHRSSTVLCTSGLAAEARIARAAGFSVVIGAGDRERTAALVKD |
| Ga0137419_107021501 | 3300012925 | Vadose Zone Soil | MQPPAMVLCTSGLAVEAKIARAAGFSVVIRAGDRDRT |
| Ga0137416_108525902 | 3300012927 | Vadose Zone Soil | MQALPIVLCVTGLAAEAKIARAVGFQAVIGAGDPERTMALVAVAA |
| Ga0137404_110006822 | 3300012929 | Vadose Zone Soil | MQPLATVLCTSGLAVEAKIARAAGFSVVIGAGDRDRT |
| Ga0126369_101758601 | 3300012971 | Tropical Forest Soil | MVGAHSQPLVTVLCTSGLAVEAKIARAAGFSVVVGAGDRERTKAL |
| Ga0157375_131121601 | 3300013308 | Miscanthus Rhizosphere | MRTLTPVLCTSGLAAEARIARAAGFQVIVGAGDPHRTAAMVEAAAQDAKC |
| Ga0075301_11002851 | 3300014262 | Natural And Restored Wetlands | MHGLTPVLCACGLAAEARIARHAGFQVIVGAGDPHRTAALVASASRQAKCLISFGI |
| Ga0132257_1021815631 | 3300015373 | Arabidopsis Rhizosphere | MRTLTPVLCTSGLAAEAKVARAAGFQVIVGAGDPRRTAELVELTARRAKFLVSFGFAGGLAPHLRS |
| Ga0182041_121735201 | 3300016294 | Soil | KKFQGACMPSPVAVLCTSGLAVEAKIARAAGFSVVI |
| Ga0182033_121237871 | 3300016319 | Soil | VRMHRLSTVLCTSGLAAEAKIARAAGFPVVIGAGDRERTAA |
| Ga0182032_114238471 | 3300016357 | Soil | MQPLATVLCTSGLKVEAKIAQAAGFSVVIGAGDRDRTAAL |
| Ga0182034_101953452 | 3300016371 | Soil | MHRLATVLCASGLAAEARIARAAGFPVVIGAGDRDRTA |
| Ga0182037_116320161 | 3300016404 | Soil | MQPLATVLCTSGLRVEAKIAQAAGFAVVIGAGDRD |
| Ga0182039_103879242 | 3300016422 | Soil | MHRLSTVLCTSGLAAEARIATAAGFPVIIGGGNRERTTALVEEAVRRASCL |
| Ga0182039_121666812 | 3300016422 | Soil | MHRLSTVLCTSGLAAEAKIARAAGFPVVIGAGDRERTAALVQNAAQH |
| Ga0190265_136360821 | 3300018422 | Soil | MRTLTPVLCTSGLAAEARVARAAGFQVIVGAGDPRRTAALVEVAARQAKCLVSFGVAG |
| Ga0066655_102465442 | 3300018431 | Grasslands Soil | MRTLTPVLCTSGLAAEARVARAAGFQVIVGAGDPERTTALVKDAARDAGSGGTL |
| Ga0066667_110598791 | 3300018433 | Grasslands Soil | MRTLTPVLCTSGLAAEARVARAAGFQVIVGAGDPERTTALVKDAARDAK |
| Ga0066667_121864621 | 3300018433 | Grasslands Soil | MHRLATVLCTSGLAAEAKIARAAGFPVVIGAGDRERTAAL |
| Ga0066669_121665651 | 3300018482 | Grasslands Soil | MRTLIPVLCTSGLAAEAKVARAAGFQVIVGAGDPERTTALVKAAIRQAKCLISFGIAGGL |
| Ga0210403_115263881 | 3300020580 | Soil | MQPLSTVLCTSGLKVEAKIAQAAGFSVVIGAGDRTRTATLVGNAA |
| Ga0210395_106132001 | 3300020582 | Soil | MPTFPTTVLCTSGLAAEARIARAAGFSTVVGGGDRNRTAA |
| Ga0210406_103195011 | 3300021168 | Soil | MQPVTTVLCMSGLKVEAKIAQAAGFSVVVGAGDRDRTAAL |
| Ga0210408_111729051 | 3300021178 | Soil | MRTLTPVLCTSGLAAEARVARAAGFQVIVGAGDPERTTALVKDAAREGK |
| Ga0210394_105709062 | 3300021420 | Soil | MHRLSTVLCTSGLAAEAKIARAAGFPVVIGAGDRERT |
| Ga0210409_110819651 | 3300021559 | Soil | MHRLSTVLCTSGLAAEAKIARAAGFPVVIGAGDRERTAALVESAVQGANCLM |
| Ga0126371_100230431 | 3300021560 | Tropical Forest Soil | MQSPVTVLCTSGLAVEAKIARAAGFSVVIGAGDRYRTMT |
| Ga0126371_131101822 | 3300021560 | Tropical Forest Soil | MQPLATVLCTSGLAIEAKIARAAGFSVVIGAGDRDRTAALVATAAART |
| Ga0242674_10134341 | 3300022711 | Soil | MPTFPTTVLCTSGLAAEARIARAAGFSTVVGGGDRNRTAALVESAVGETKC |
| Ga0242657_10723321 | 3300022722 | Soil | MHRLSTVLCTSGLAAEAKVARAAGFPVVIGAGDRERTAALVENAVRHA |
| Ga0209640_104497512 | 3300025324 | Soil | MRALTPVLCTSGLAAEARIARAAGFQVIVGAGDHRRTAALVE |
| Ga0207649_112305102 | 3300025920 | Corn Rhizosphere | MRTLTPVLCTSGLAAEARIARAAGFPVIVGAGDPHRTAALVEAAARQAKCLVSF |
| Ga0207646_106537832 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRLSTVLCTSGLAAEARIARAAGFPVLIGAGDRE |
| Ga0207659_109389812 | 3300025926 | Miscanthus Rhizosphere | MRTLTPVLCTSGLAAEARIARAAGFPVIVGAGDPHRTAALV |
| Ga0207701_108044292 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLTPVLCTSGLAAEAKVARAAGFQVIVGAGDPRRTAELVELAARR |
| Ga0207704_112620232 | 3300025938 | Miscanthus Rhizosphere | MRTLTPVLCTSGLAAEARIARAAGFPVIVGAGDPHRTAALVAA |
| Ga0207661_109918902 | 3300025944 | Corn Rhizosphere | MRTLTPVLCTSGLAAEAKVARAAGFQVIVGAGDLRRTAELVELAAKRAKFLISFGV |
| Ga0207703_107237012 | 3300026035 | Switchgrass Rhizosphere | MRTLTPVLCTSGLAAEARIARAAGFPVIVGAGDPHRTAALVEAAAQEA |
| Ga0209474_103576822 | 3300026550 | Soil | MRTLIPVLCTSGLAAEARVARAAGFQVIVGGGDPS |
| Ga0179587_104897292 | 3300026557 | Vadose Zone Soil | MHRLSTVLCTSGLAAEAKIARAAGFPVVIGAGDRERTAALVESAVQGANCLI |
| Ga0209038_100062731 | 3300027737 | Bog Forest Soil | MRRLLTVLCASGLAAEAKIARAAGFPVVIGAGDRERTAALVENAVQRANCLM |
| Ga0268264_103065681 | 3300028381 | Switchgrass Rhizosphere | MRTLTPVLCTSGLAAEAKVARAAGCQVIVGAGDPRRTAELVEL |
| Ga0308200_11169761 | 3300030905 | Soil | MHRLSTVLCTSGLAVEAKIARAAGFPVVIGAGNRARTAA |
| Ga0170822_123939142 | 3300031122 | Forest Soil | MARAVCISGLAVEAKIARTAGFAVVTGAGDRDRTATLVATAAAQ |
| Ga0318516_100604121 | 3300031543 | Soil | VHRLSTVLCTSGLAAEARIARAAGFPVVIGAGDRERTAALVERAVKG |
| Ga0318534_106448612 | 3300031544 | Soil | MHRLSTVLFISGLAAEARIARAVGFPVVIGGGDRGRTAA |
| Ga0318541_101867161 | 3300031545 | Soil | MHRLATVLCASGLAAEARIARAAGFPVVIGAGDRDRTAALVESA |
| Ga0318528_101019941 | 3300031561 | Soil | MQPLATVLCTSGLKVEAKIAQAAGFSVVIGAGDRDRTAALVATAA |
| Ga0318528_101023981 | 3300031561 | Soil | VHRLSTVLCTSGLAAEARIARAAGFPVVIGAGDRERTAALVERAVKGANCLVS |
| Ga0318573_101655451 | 3300031564 | Soil | MHRLSTVLFISGLAAEARIARAVGFPVVIGGGDRRRTAALVERAVPG |
| Ga0318573_103613992 | 3300031564 | Soil | MHRLATVLCASGLAAEARIARAAGFPVVIGAGDRDRTAALVESAVQH |
| Ga0318555_106383922 | 3300031640 | Soil | MHRLSTVLCTSGLAAEAKIARAAGFPVLIGAGDRARTAALIGGAVNGANCL |
| Ga0318561_100070151 | 3300031679 | Soil | VHRLSTVLCTSGLAAEARIARAAGFPVVIGAGDRERTAALVERAVTGAD |
| Ga0318561_102068452 | 3300031679 | Soil | MHRLATVLCASGLAAEARIARAAGFPVVIGAGDRD |
| Ga0318574_103978381 | 3300031680 | Soil | MHRLSTVLFISGLAAEARIARAVGFPVVIGGGDRG |
| Ga0318574_104827322 | 3300031680 | Soil | MHRLATVLCASGLAAEARIARAAGFPVVIGAGDRDRTAALVESAVQHAKCL |
| Ga0318572_100218311 | 3300031681 | Soil | MQRLATVLCTSGLAIEAKIARAAGFSAVIRAGDRDRTAALVAAT |
| Ga0318572_106426791 | 3300031681 | Soil | MHRLSTVLFISGLAAEARIARAVGFPVVIGGGDRGRTAALVERAVPGA |
| Ga0310686_1049742762 | 3300031708 | Soil | MRTLIPVLCTSGLAAEARVARAAGSQVIVGGGDLRRTTALVE |
| Ga0306917_100092207 | 3300031719 | Soil | MQRPATVLCTSGLAVEAQIARAAGFSAVIRAGDRDRTAA |
| Ga0306917_100684214 | 3300031719 | Soil | MQRSATVLCTSGLAVEAKIARAAGFSVVIRAGNRDRTAARLG |
| Ga0318502_105154102 | 3300031747 | Soil | MHRLATVLCASGLAAEARIARAAGFPVVIGAGDRDRTAA |
| Ga0318537_100354511 | 3300031763 | Soil | MHRLSTVLFISGLAAEARIARAVGFPVVIGGGDRR |
| Ga0318535_103580491 | 3300031764 | Soil | MHRLATVLCASGLAAEARIARAAGFPVVIGAGDRDRTAALVESAVQHAKCLMS |
| Ga0318526_101075433 | 3300031769 | Soil | MQRPATVLCTSGLAVEAQIARAAGFSAVIRAGDRDRTA |
| Ga0318521_102859982 | 3300031770 | Soil | MHRLSTVLFISGLAAEARIARAVGFPVVIGGGDRRRTAALVEKAV |
| Ga0318546_1000062215 | 3300031771 | Soil | MHRLSTVLCTSGLAAEAKIARAAGFPVLIGAGDRARTAALIGG |
| Ga0318543_102084071 | 3300031777 | Soil | MHRLATVLCTSGLAAEARIARAAGFPVLIGAGDRDRTAALVESAVQHA |
| Ga0318557_101369231 | 3300031795 | Soil | MHRLSTVLCTSGLAAEAKIARAAGFPVLIGAGDRAR |
| Ga0318576_100209803 | 3300031796 | Soil | MHRLATVLCASGLAAEARIARAAGFPVVIGAGDRDRTAALVESAVQHAK |
| Ga0318550_105440102 | 3300031797 | Soil | MHRLATVLCTSGLAAEARIARAAGFPVVIGAGDRDRTAALVE |
| Ga0318512_101646941 | 3300031846 | Soil | MHRLATVLCASGLAAEARIARAAGFPVVIGAGDRDRTAALVE |
| Ga0318536_103008631 | 3300031893 | Soil | MQRSATVLCTSGLAVEAKIARAAGFSVVIRAGNRDRTA |
| Ga0306921_111623602 | 3300031912 | Soil | VHRLSTVLCTSGLAAEARIARAAGFPVVIGAGDRERTAALVERAVKGAN |
| Ga0308175_1015873882 | 3300031938 | Soil | MRTLTPVLCTSGLAAEAKVARAAGFQVIVGAGDPRRTAELVELAAKRAKF |
| Ga0310910_109761672 | 3300031946 | Soil | MHRLSTVLFISGLAAEARIARAAGFPVVIGGGDRGRTAALVERAV |
| Ga0310909_106208331 | 3300031947 | Soil | MHRLSTVLCTSGLAAEARIATAAGFPVIIGGGNRERTT |
| Ga0307479_117890812 | 3300031962 | Hardwood Forest Soil | MRTLIPVLCTSGLAAEARVARAAGFQVIVGGGDLRRTAALVQDAAREAECLVSFG |
| Ga0318518_100127551 | 3300032090 | Soil | VHRLSTVLCTSGLAAEARIARAAGFPVVIGAGDRERTAALVERAVKGANCLV |
| Ga0318577_106044391 | 3300032091 | Soil | MHRLSTVLCTSGLAAEAKIARAVGFPVVIGAGDRERTASLV |
| Ga0307471_1035644881 | 3300032180 | Hardwood Forest Soil | MRPLTPVLCTSGLAAEARIARAAGFQVIVGAGDPRRTAELVEAA |
| Ga0348332_137548071 | 3300032515 | Plant Litter | LLETTGPAAPLCICGLAAEAKIARAAGFSVVLGAGNRSRTTT |
| Ga0335077_110179592 | 3300033158 | Soil | MHTLWPVLCTSGLAAEARVARAAGLQAIVGAGDPQRTTALVNAA |
| ⦗Top⦘ |