| Basic Information | |
|---|---|
| Family ID | F064153 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VPSAKLYPRTALILLTALNLLNYIDRSVLFAVQPLVQ |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 14.06 % |
| % of genes near scaffold ends (potentially truncated) | 97.67 % |
| % of genes from short scaffolds (< 2000 bps) | 87.60 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.698 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (14.729 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.682 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.039 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF14489 | QueF | 50.39 |
| PF13442 | Cytochrome_CBB3 | 4.65 |
| PF09722 | Xre_MbcA_ParS_C | 3.88 |
| PF05015 | HigB-like_toxin | 3.10 |
| PF01381 | HTH_3 | 3.10 |
| PF13533 | Biotin_lipoyl_2 | 3.10 |
| PF12867 | DinB_2 | 2.33 |
| PF13231 | PMT_2 | 1.55 |
| PF08808 | RES | 1.55 |
| PF03544 | TonB_C | 1.55 |
| PF13432 | TPR_16 | 1.55 |
| PF13419 | HAD_2 | 0.78 |
| PF01513 | NAD_kinase | 0.78 |
| PF12840 | HTH_20 | 0.78 |
| PF05036 | SPOR | 0.78 |
| PF14534 | DUF4440 | 0.78 |
| PF01479 | S4 | 0.78 |
| PF12700 | HlyD_2 | 0.78 |
| PF12852 | Cupin_6 | 0.78 |
| PF02537 | CRCB | 0.78 |
| PF02469 | Fasciclin | 0.78 |
| PF16576 | HlyD_D23 | 0.78 |
| PF01713 | Smr | 0.78 |
| PF03795 | YCII | 0.78 |
| PF03551 | PadR | 0.78 |
| PF05593 | RHS_repeat | 0.78 |
| PF01145 | Band_7 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 3.10 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 1.55 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 0.78 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.78 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.78 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.78 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.78 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.70 % |
| Unclassified | root | N/A | 9.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E02IGLVF | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 520 | Open in IMG/M |
| 3300000567|JGI12270J11330_10034823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2895 | Open in IMG/M |
| 3300001356|JGI12269J14319_10097371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1462 | Open in IMG/M |
| 3300002074|JGI24748J21848_1020913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 789 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10364237 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300004472|Ga0068974_1398700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6263 | Open in IMG/M |
| 3300004499|Ga0068984_1082023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 528 | Open in IMG/M |
| 3300004643|Ga0062591_100729154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 901 | Open in IMG/M |
| 3300005171|Ga0066677_10202169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1112 | Open in IMG/M |
| 3300005535|Ga0070684_102249167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 514 | Open in IMG/M |
| 3300005542|Ga0070732_10002995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 9098 | Open in IMG/M |
| 3300005548|Ga0070665_101392364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 710 | Open in IMG/M |
| 3300005558|Ga0066698_10280643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
| 3300005575|Ga0066702_10017408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3420 | Open in IMG/M |
| 3300005587|Ga0066654_10823485 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005591|Ga0070761_10998867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 531 | Open in IMG/M |
| 3300005602|Ga0070762_10327766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 971 | Open in IMG/M |
| 3300005602|Ga0070762_10783469 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005712|Ga0070764_10944423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 542 | Open in IMG/M |
| 3300006028|Ga0070717_11470331 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006032|Ga0066696_10892232 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006034|Ga0066656_10539257 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300006046|Ga0066652_100622106 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300006163|Ga0070715_10353663 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300006173|Ga0070716_101398632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 569 | Open in IMG/M |
| 3300006174|Ga0075014_100726525 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006176|Ga0070765_100188738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1864 | Open in IMG/M |
| 3300009090|Ga0099827_11231940 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter → unclassified Hymenobacter → Hymenobacter sp. | 651 | Open in IMG/M |
| 3300009143|Ga0099792_10442129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 804 | Open in IMG/M |
| 3300009521|Ga0116222_1166275 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300009522|Ga0116218_1087048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1422 | Open in IMG/M |
| 3300009683|Ga0116224_10406619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300009759|Ga0116101_1081533 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300009824|Ga0116219_10460079 | Not Available | 706 | Open in IMG/M |
| 3300009839|Ga0116223_10175919 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300010360|Ga0126372_10241847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1541 | Open in IMG/M |
| 3300010379|Ga0136449_102751253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300011058|Ga0138541_1008303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 755 | Open in IMG/M |
| 3300011075|Ga0138555_1067698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 788 | Open in IMG/M |
| 3300012204|Ga0137374_11018809 | Not Available | 597 | Open in IMG/M |
| 3300012207|Ga0137381_10272698 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300012361|Ga0137360_10126196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1997 | Open in IMG/M |
| 3300012685|Ga0137397_10209865 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300012685|Ga0137397_11217143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300012917|Ga0137395_10627770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300012971|Ga0126369_12201042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300012988|Ga0164306_10505078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 931 | Open in IMG/M |
| 3300013100|Ga0157373_11359257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300014154|Ga0134075_10198857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300014162|Ga0181538_10402735 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300014199|Ga0181535_10380387 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300016702|Ga0181511_1447855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2184 | Open in IMG/M |
| 3300017823|Ga0187818_10264108 | Not Available | 753 | Open in IMG/M |
| 3300017934|Ga0187803_10191868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300017955|Ga0187817_10174715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1368 | Open in IMG/M |
| 3300017955|Ga0187817_10791202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300017955|Ga0187817_10924338 | Not Available | 558 | Open in IMG/M |
| 3300017955|Ga0187817_11019436 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300017961|Ga0187778_10712624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300017961|Ga0187778_11243614 | Not Available | 523 | Open in IMG/M |
| 3300017970|Ga0187783_10149157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1723 | Open in IMG/M |
| 3300017970|Ga0187783_10857231 | Not Available | 655 | Open in IMG/M |
| 3300017973|Ga0187780_11074325 | Not Available | 588 | Open in IMG/M |
| 3300017995|Ga0187816_10239304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 791 | Open in IMG/M |
| 3300018006|Ga0187804_10034190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1927 | Open in IMG/M |
| 3300018025|Ga0187885_10136770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
| 3300018025|Ga0187885_10415656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 602 | Open in IMG/M |
| 3300018040|Ga0187862_10414384 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300018085|Ga0187772_11166049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300018086|Ga0187769_10677842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300018088|Ga0187771_10813161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300018482|Ga0066669_10072881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2278 | Open in IMG/M |
| 3300019284|Ga0187797_1424783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300019890|Ga0193728_1170279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 940 | Open in IMG/M |
| 3300020199|Ga0179592_10239584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300020580|Ga0210403_11054914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300020580|Ga0210403_11262829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300020582|Ga0210395_10290050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1230 | Open in IMG/M |
| 3300021406|Ga0210386_10611551 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300021407|Ga0210383_10892578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300021433|Ga0210391_10275453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1320 | Open in IMG/M |
| 3300021433|Ga0210391_11221547 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300025906|Ga0207699_10449601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300027497|Ga0208199_1089734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300027521|Ga0209524_1084117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300027562|Ga0209735_1027820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1177 | Open in IMG/M |
| 3300027641|Ga0208827_1132758 | Not Available | 706 | Open in IMG/M |
| 3300027648|Ga0209420_1101785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300027667|Ga0209009_1093527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300027696|Ga0208696_1010588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3773 | Open in IMG/M |
| 3300027725|Ga0209178_1397654 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027727|Ga0209328_10222110 | Not Available | 568 | Open in IMG/M |
| 3300027825|Ga0209039_10392789 | Not Available | 531 | Open in IMG/M |
| 3300027854|Ga0209517_10112019 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300027875|Ga0209283_10892652 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300027879|Ga0209169_10409097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300027911|Ga0209698_10088522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2612 | Open in IMG/M |
| 3300028773|Ga0302234_10009911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4920 | Open in IMG/M |
| 3300028807|Ga0307305_10504738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300028873|Ga0302197_10428591 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300029952|Ga0311346_10243030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 1935 | Open in IMG/M |
| 3300029999|Ga0311339_10031005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7631 | Open in IMG/M |
| 3300030000|Ga0311337_10016069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5800 | Open in IMG/M |
| 3300030049|Ga0302191_10231469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300030114|Ga0311333_10758490 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300030494|Ga0310037_10303263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300030518|Ga0302275_10067485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2561 | Open in IMG/M |
| 3300030618|Ga0311354_10602756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
| 3300030659|Ga0316363_10280240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300030707|Ga0310038_10349439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300030737|Ga0302310_10731248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300031231|Ga0170824_118661239 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300031231|Ga0170824_128860533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300031236|Ga0302324_100066394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6343 | Open in IMG/M |
| 3300031715|Ga0307476_11024140 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031718|Ga0307474_11043781 | Not Available | 647 | Open in IMG/M |
| 3300031754|Ga0307475_10083746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2464 | Open in IMG/M |
| 3300031754|Ga0307475_10806013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300031941|Ga0310912_10282365 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300032059|Ga0318533_10949771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300032090|Ga0318518_10524466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 606 | Open in IMG/M |
| 3300032174|Ga0307470_10014078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3417 | Open in IMG/M |
| 3300032205|Ga0307472_101430348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300032898|Ga0335072_10987462 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300033158|Ga0335077_10679750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1063 | Open in IMG/M |
| 3300033826|Ga0334847_018525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300034163|Ga0370515_0092464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1308 | Open in IMG/M |
| 3300034163|Ga0370515_0260774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 14.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.20% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.10% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.10% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.55% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.55% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.78% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004472 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004499 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 82 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011058 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_03270700 | 2189573000 | Grass Soil | VSQTDLQPRTALIVLTALNLLNYVDRNVLFAVQPLV |
| JGI12270J11330_100348236 | 3300000567 | Peatlands Soil | MARTTYPLATLALLTAINFVNYIDRSVLFAVQPLVQ |
| JGI12269J14319_100973714 | 3300001356 | Peatlands Soil | MVYSRHRMARKTYPLATLALLTAINFVNYIDRSVLFAVQ |
| JGI24748J21848_10209131 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | VVDSHNLVTDKQLYPRTALIVLTLLNLVNYVDRSVLNAVQPLVQ |
| JGIcombinedJ51221_103642371 | 3300003505 | Forest Soil | MLFARPVVQTKLYPRTALVLLTALNLLNYIDRSVLNAVQPLIQ |
| Ga0068974_13987001 | 3300004472 | Peatlands Soil | LIASRPKLYPRTALALLTALNLFNYIDRSVLFAVQDLVKA |
| Ga0068984_10820231 | 3300004499 | Peatlands Soil | LIASRPKLYPRTALALLTALNLFNYIDRSVLFAVQDLVKAEFH |
| Ga0062591_1007291541 | 3300004643 | Soil | MINSHNPVTDKRLYPRTALIVLTLLNLVNYVDRSVLNAVQPLVQ |
| Ga0066677_102021693 | 3300005171 | Soil | VSSTRLYPRMALVVLTALNLLNYIDRSVLNAVQPLIQNEFH |
| Ga0065705_107022892 | 3300005294 | Switchgrass Rhizosphere | MINSHNPVTDKRLYPRTALIVLTLLNLVNYVDRSVLNAVQPLVQSEFQL |
| Ga0070684_1022491671 | 3300005535 | Corn Rhizosphere | VTERKLYPWTALVLLTTLNFLNYIDRSVLFAVQPLVQTEFR |
| Ga0070732_100029951 | 3300005542 | Surface Soil | VSQSELQPRTALILLTALNLLNYVDRNVLFAVQPL |
| Ga0070665_1013923641 | 3300005548 | Switchgrass Rhizosphere | MINSHNPVTDKRLYPRTALIVLTLLNLVNYVDRSVLNAVQPLVQSE |
| Ga0066698_102806431 | 3300005558 | Soil | VPSAKLYPRTALILLTALNLLNYIDRSVLFAVQPLVQ |
| Ga0066702_100174081 | 3300005575 | Soil | VSQKNLQPRTALIVLTALNLLNYADRNVLFAVQPLV |
| Ga0066654_108234851 | 3300005587 | Soil | VASAHLYPRTALVLLTALNLLNYIDRSVLFAVQPLV |
| Ga0070761_109988672 | 3300005591 | Soil | VAQNDLQPRTALIVLTALNLLNYVDRNVLFAVQPLVQDEFHL |
| Ga0070762_103277663 | 3300005602 | Soil | VAADNLHPRTALLLLTSLNLLNYADRNVLFAVQPLVQDEF |
| Ga0070762_107834691 | 3300005602 | Soil | VPPIKLYPRTALALLTTLNLLNYIDRSVLFAVQPLV |
| Ga0070764_109444231 | 3300005712 | Soil | VAQTDLQPRTALIVLTALNLLNYVDRNVLFAVQPLVQDE |
| Ga0070717_114703311 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPRKLYPWTALFILTTLNFLNYIDRSVLFAVQPLVQSEFRLTN |
| Ga0066696_108922321 | 3300006032 | Soil | MPPRSYARLALVLLTGLNFLNYIDRSVLFAVQPLV |
| Ga0066656_105392572 | 3300006034 | Soil | VASKDLHPRTALIVLTALNLLNYADRNVLYAVQPLVQDEFHLTKT |
| Ga0066652_1006221063 | 3300006046 | Soil | MLRFRSTVSSRKLYPRTALVVLTALNLVNYIDRSVLFAVQPLV |
| Ga0070715_103536631 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VTQTKLYPWTALTVLTALNLLNYIDRSVLFAVQPLVQA |
| Ga0070716_1013986322 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VVYSCQVTPRKLYPWTALVILTALNFLNYIDRSVLFAVQPL |
| Ga0075014_1007265252 | 3300006174 | Watersheds | VAQSDLQPRTALIVLTALNLLNYADRNVLFAVQPL |
| Ga0070765_1001887385 | 3300006176 | Soil | VLYSLDPVKSAKLYPRTALILLTALNLLNYVDRSV |
| Ga0099827_112319401 | 3300009090 | Vadose Zone Soil | VTGTKLYPRTALALLTALNLLNYVDRSVLFAVQPL |
| Ga0099792_104421291 | 3300009143 | Vadose Zone Soil | VTSENLQPRTALIVLTALNLLNYADRNVLFAVQPLV |
| Ga0116222_11662751 | 3300009521 | Peatlands Soil | MARKTYPMAALALLTAINFVNYIDRSVLFAVQPLVQAEFKF |
| Ga0116218_10870483 | 3300009522 | Peatlands Soil | VTRTDLQPRTALIVLTALNLLNYADRNVLFAVQPLVQDEFHLTKE |
| Ga0116224_104066193 | 3300009683 | Peatlands Soil | VTPQNLHARSALLVLTALNLLNYVDRNVLFAVQPLVQ |
| Ga0116101_10815333 | 3300009759 | Peatland | VSEAKLYPRTALALLTTLNLLNYVDRSVLFAVQPLVQ |
| Ga0116219_104600791 | 3300009824 | Peatlands Soil | MARKTYPLATLVLLTAINFVNYIDRSVLFAVQPLVQAE |
| Ga0116223_101759191 | 3300009839 | Peatlands Soil | MARKTYPLATLALLTAINFVNYIDRSVLFAVQPLVQAE |
| Ga0126372_102418473 | 3300010360 | Tropical Forest Soil | VPQNKLYPPTALILLTALNLLNYVDRNVLFAVQPLVQDEF |
| Ga0136449_1027512532 | 3300010379 | Peatlands Soil | VAQNDLQPKTALIVLTALNLLNYADRNVLFAVQPLVQDEF |
| Ga0138541_10083033 | 3300011058 | Peatlands Soil | LIASRPKLYPRTALALLTALNLFNYIDRSVLFAVQ |
| Ga0138555_10676983 | 3300011075 | Peatlands Soil | LIASRPKLYPRTALALLTALNLFNYIDRSVLFAVQDL |
| Ga0137374_110188092 | 3300012204 | Vadose Zone Soil | VSETNFNPKTALTILTALNLLNYVDRNVLYAVQPLVQDEFHINK |
| Ga0137381_102726981 | 3300012207 | Vadose Zone Soil | VPPKNLHPRTALIVLTALNLLNYADRNVLYAVQPLVQDEFHLTH |
| Ga0137360_101261961 | 3300012361 | Vadose Zone Soil | VADKKLYPKLALALLTALNLLNYIDRSVLFAVQEGRHPHL* |
| Ga0137397_102098651 | 3300012685 | Vadose Zone Soil | VAPKKLHPRTALIVLTALNLLNYADRNVLYAVQPLVQDE |
| Ga0137397_112171432 | 3300012685 | Vadose Zone Soil | VANVRLYPRTALVLLTALNLLNYIDRSVLFAVQPLVQAE |
| Ga0137395_106277702 | 3300012917 | Vadose Zone Soil | VTQRKLYPWTALVLLTTLNFLNYIDRSVLFAVQPLVQTEFKLTNA |
| Ga0126369_122010421 | 3300012971 | Tropical Forest Soil | VSQKHLQPKTALIILTALNLLNYADRNVLFAVQPLVQDE |
| Ga0164306_105050783 | 3300012988 | Soil | VTPRKLYPWTALIILTALNFLNYIDRSVLFAVQPLV |
| Ga0157373_113592571 | 3300013100 | Corn Rhizosphere | MLYSASVPPEKLYPRTALALLTALNLLNYIDRSVLFAVQPL |
| Ga0134075_101988571 | 3300014154 | Grasslands Soil | VPSSKLYPRTALILLTALNLLNYIDRSVLFAVQPLVQ |
| Ga0181538_104027351 | 3300014162 | Bog | VKPQKLQARTALLVLSVLNLLNYVDRNVLFAVQPLVQ |
| Ga0181535_103803873 | 3300014199 | Bog | VTQTKLYPWTALTLLTALNLLNYIDRSVLNAVQPLIQNEFHV |
| Ga0181511_14478551 | 3300016702 | Peatland | VTDRRLYPRTALLVLTALNLVNYVDRSVLNAVQPLVQVEFRLTKTQL |
| Ga0187818_102641082 | 3300017823 | Freshwater Sediment | MARKTYPLAALALLTAINFVNYIDRSVLFAVQPLVQAEF |
| Ga0187803_101918681 | 3300017934 | Freshwater Sediment | VADRKLYPRTALLVLTALNLLNYADRNVLFAVHPLV |
| Ga0187817_101747151 | 3300017955 | Freshwater Sediment | VTPTKLYPWTALTLLTALNLLNYIDRSVLFAVQPLVQSE |
| Ga0187817_107912022 | 3300017955 | Freshwater Sediment | MARKTYPLAALALLTAINFVNYIDRSVLFAVQPLVQAEFKF |
| Ga0187817_109243382 | 3300017955 | Freshwater Sediment | MLYSRDRMARKTYPLATLALLTAINFVNYIDRSVLFAVQPLVQA |
| Ga0187817_110194361 | 3300017955 | Freshwater Sediment | VASTKLYPRTTLIVLTALNLVNYIDRSVLFAVQPMIQ |
| Ga0187778_107126242 | 3300017961 | Tropical Peatland | VAQKDLQPRTALIVLTALNLLNYADRNVLFAVQPLVQDEFHLTKE |
| Ga0187778_112436142 | 3300017961 | Tropical Peatland | MARRTYPLAALVLLTAINFVNYIDRSVLFAVQPLVQ |
| Ga0187783_101491573 | 3300017970 | Tropical Peatland | VPQKDLHPRTALIVLTALNLLNYVDRNVLFAVQPLVQ |
| Ga0187783_108572312 | 3300017970 | Tropical Peatland | MARKTYPLATLALLTAINFINYIDRSVLFAVQPLV |
| Ga0187780_110743252 | 3300017973 | Tropical Peatland | MARKTYPLAALVLLTAINFVNYIDRSVLFAVQPLVQAEF |
| Ga0187816_102393041 | 3300017995 | Freshwater Sediment | VTSAKLQPRTALIVLTALNLLNYVDRNVLFAVQPLVQDEFHL |
| Ga0187804_100341903 | 3300018006 | Freshwater Sediment | VAKSDLQPWTALTVLTALNLLNYVDRTVLFAVQPLV |
| Ga0187885_101367701 | 3300018025 | Peatland | VTPAKLYPRTALALLTALNLLNYIDRSVLFAVQDL |
| Ga0187885_104156561 | 3300018025 | Peatland | VAATKLYPRTALALLTALNLLNYVDRSVLFAVQPL |
| Ga0187862_104143843 | 3300018040 | Peatland | VTQTKLYPWTALTLLTALNLLNYIDRSVLFAVQPL |
| Ga0187772_111660492 | 3300018085 | Tropical Peatland | LPHAIVAGPVAQKDLQPRTALILLTALNLLNYVDRNVLFAVQPLV |
| Ga0187769_106778422 | 3300018086 | Tropical Peatland | VTQTKLYPRTALIVLTSLNLLNYVDRNVLFAVQPLVQD |
| Ga0187771_108131611 | 3300018088 | Tropical Peatland | MARKTYPLAALALLTAINFVNYIDRSVLFAVQPLVQAEFKFS |
| Ga0066669_100728811 | 3300018482 | Grasslands Soil | VPAKKLYPKTALALLTALNLLNYIDRNVLYAVQDMVKAE |
| Ga0187797_14247832 | 3300019284 | Peatland | VAQKDLQPRTALIVLTTLNLLNYADRNVLFAVQPLVQDEFHLTKE |
| Ga0193728_11702793 | 3300019890 | Soil | VASSRLYPRTALVLLTALNLLNYVDRSVLFAVQPLVQADF |
| Ga0179592_102395841 | 3300020199 | Vadose Zone Soil | VPPTKLYPRTALLVLTALNLVNYVDRSVLNAVQPLVQVEFQLTKTQL |
| Ga0210403_110549142 | 3300020580 | Soil | MAKNDLHPWTALMVLTALNLLNYADRNVLFAVQPLVQA |
| Ga0210403_112628292 | 3300020580 | Soil | VPDKKLYPKTALALLTALNLLNYIDRNVLFAVQELIKVEFA |
| Ga0210395_102900503 | 3300020582 | Soil | VAQTDLQPRTALIVLTALNLLNYVDRNVLFAVQPLVQDEF |
| Ga0210386_106115513 | 3300021406 | Soil | VPDRKLYPKTALALLTALNLLNYIDRNVLFAVQDLIK |
| Ga0210383_108925782 | 3300021407 | Soil | VTSTKLYPWTALGLLTTLNLLNYVDRSVLFAVQPLVQTE |
| Ga0210391_102754534 | 3300021433 | Soil | VTQTKLYPWTALTLLTTLNLLNYIDRSVLFAVQESER |
| Ga0210391_112215473 | 3300021433 | Soil | VTSTKLYPRTALILLTALNLLNYVDRSVLFAVQPL |
| Ga0207699_104496011 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRKLYPKTALALLTALNLLNYIDRSVLYGVQDLIK |
| Ga0208199_10897341 | 3300027497 | Peatlands Soil | VTSAKLHPRTALILLTALNLLNYVDRSVLFAVQPLVQ |
| Ga0209524_10841172 | 3300027521 | Forest Soil | VTQRKLYPWTALVLLTTLNFLNYIDRSVLFAVQPLVQTEFR |
| Ga0209735_10278201 | 3300027562 | Forest Soil | VPPTKLYPRTALLVLTALNLVNYIDRSVLNAVQPLVQVE |
| Ga0208827_11327582 | 3300027641 | Peatlands Soil | MARKTYPLATLALLTAINFVNYIDRSVLFAVQPLVQ |
| Ga0209420_11017851 | 3300027648 | Forest Soil | VTQTKFQARSALLVLTALNLLNYADRNVLFAVQPLVQD |
| Ga0209009_10935272 | 3300027667 | Forest Soil | VPPTKLYPRTALALLTTLNLLNYIDRSVLFAVQPLVQ |
| Ga0208696_10105886 | 3300027696 | Peatlands Soil | MARTTYPLATLALLTAINFVNYIDRSVLFAVQPLVQAE |
| Ga0209178_13976542 | 3300027725 | Agricultural Soil | MSPKLYPRAALALLTGLNLMNYLDRSVLFAVQPLIQKELG |
| Ga0209328_102221102 | 3300027727 | Forest Soil | VAETKLYPRTALVVLTALNLLNYADRNVLFAVQPL |
| Ga0209039_103927891 | 3300027825 | Bog Forest Soil | VPSQKLHARTALLVLTALNLLNYADRNVLFAVQPL |
| Ga0209517_101120191 | 3300027854 | Peatlands Soil | MLYSPSVTPPKLYPRTALLILTALNLLNYIDRSVLFAVQPLV |
| Ga0209283_108926521 | 3300027875 | Vadose Zone Soil | VTPRKLYPWTALIILTALNFLNYIDRSVLFAVQPL |
| Ga0209169_104090971 | 3300027879 | Soil | VAQTDLQPRTALIVLTALNLLNYVDRNVLFAVQPLV |
| Ga0209698_100885224 | 3300027911 | Watersheds | MNNNKLHPWTALILLTALNLLNYVDRSILFAVQPLIQAELHRSKSD |
| Ga0302234_100099118 | 3300028773 | Palsa | VATAKLHPRTALILLTALNLLNYVDRSVLFAVQPPVQSEF |
| Ga0307305_105047382 | 3300028807 | Soil | VANVRLYPRTALILLTALNLLNYIDRSVLFAVQPLVQAE |
| Ga0302197_104285911 | 3300028873 | Bog | VTSPKLYPRTALALLTALNLLNYVDRSVLFAVQPLVQSEF |
| Ga0311346_102430301 | 3300029952 | Bog | VTSAKLQPRTALIVLTALNLLNYADRNVLFAVQPLV |
| Ga0311339_100310051 | 3300029999 | Palsa | VTSEKLQPRTALIVLTALNLLNYVDRNVLYAVQPLIQE |
| Ga0311337_100160691 | 3300030000 | Fen | VTQQKLYPRTALLVLTALNLLNYADRNVLFAVQPLVQ |
| Ga0302191_102314691 | 3300030049 | Bog | VASTKLYPRTALALLTALNLLNYIDRSVLFAVQDLVKA |
| Ga0311333_107584903 | 3300030114 | Fen | VAPTKLYPRTALLVLTALNLLNYADRNVLFAVQPLVQAE |
| Ga0310037_103032632 | 3300030494 | Peatlands Soil | VTSTKLYPRAVLVLLTALNLLNYIDRSVLNAVQPLIQNEFHVT |
| Ga0302275_100674854 | 3300030518 | Bog | VASTKLYPRTALALLTTLNLLNYIDRSVLFAVQDLV |
| Ga0311354_106027561 | 3300030618 | Palsa | VTSAKLYPRTALALLTALNLLNYNDRSVLLAVQDLVKA |
| Ga0316363_102802401 | 3300030659 | Peatlands Soil | VDDSKLYPRTALVVLTALNLLNYVDRNVLFAVQPLVQDEFHL |
| Ga0310038_103494392 | 3300030707 | Peatlands Soil | VTQQKLHARTALLVLTALNLLNYADRNVLFAVQPLV |
| Ga0302310_107312482 | 3300030737 | Palsa | VPQTKLYPRTALALLTALNLLNYVDRSVLFAVQDLV |
| Ga0170824_1186612391 | 3300031231 | Forest Soil | VTQRDLQPRTALIVLTALNLLNYVDRNVLFAVQPLVQDE |
| Ga0170824_1288605332 | 3300031231 | Forest Soil | VAQTDLQPRTALIVLAALNLLNYVDRSVLFAVQPLVQDE |
| Ga0302324_1000663941 | 3300031236 | Palsa | VATTKLYPRTALALLTTLNLLNYIDRSVLYAVQDLV |
| Ga0307476_110241402 | 3300031715 | Hardwood Forest Soil | VANTKLYPKTALALLTALNLFNYIDRSVLFAVQDL |
| Ga0307474_110437813 | 3300031718 | Hardwood Forest Soil | VPATKLYPRTALILLTALNLLNYADRNVLFAVQPLVQNEFHLTK |
| Ga0307475_100837464 | 3300031754 | Hardwood Forest Soil | VTRTKLYPRTALILLTALNLLNYIDRSVLFAVQPLVQHE |
| Ga0307475_108060132 | 3300031754 | Hardwood Forest Soil | VPPNKLYPWTALTLLTALNLLNYADRNVLFAVQPLVQEEFHIN |
| Ga0310912_102823653 | 3300031941 | Soil | VREGIKSPWVALGLLTTLNILNYVDRSVLFAVQPLIQ |
| Ga0318533_109497712 | 3300032059 | Soil | VAATKLYPRTALVLLTSLNLLNYIDRSVLFAVQPLV |
| Ga0318518_105244661 | 3300032090 | Soil | VPDKKLYPKTALAVLTALNLLNYIDRNVLFAVQDLIK |
| Ga0307470_100140785 | 3300032174 | Hardwood Forest Soil | VTSPKTYPKLALALLTALNLLNYIDRSVLFAVQDLL |
| Ga0307472_1014303481 | 3300032205 | Hardwood Forest Soil | VTETKLYPRTALALLTALNLFNYIDRSVLFGVQDL |
| Ga0335072_109874621 | 3300032898 | Soil | VTDAKLYPRTALALLTTLNLLNYVDRSVLFAVQPLVQ |
| Ga0335077_106797503 | 3300033158 | Soil | VTSRKLYPWTALIVLTALNLLNYIDRTVLFAVQTLVQDEF |
| Ga0334847_018525_1_120 | 3300033826 | Soil | VNTTNLHPRTALILLTALNLLNYADRNVLFAVQPLVQAEF |
| Ga0370515_0092464_2_112 | 3300034163 | Untreated Peat Soil | VLYSLDPVTSPKLYPRTALALLTALNLLNYIDRSVLF |
| Ga0370515_0260774_610_735 | 3300034163 | Untreated Peat Soil | VTQTKLYPRTALALLTALNLLNYVDRSVLFAVQDLVKAEFHQ |
| ⦗Top⦘ |