| Basic Information | |
|---|---|
| Family ID | F064149 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VTLAVVFALAAAFSNAVNLMTQHSASISAPKREKGWRLALYL |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.49 % |
| % of genes near scaffold ends (potentially truncated) | 96.12 % |
| % of genes from short scaffolds (< 2000 bps) | 93.02 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.039 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (45.736 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.488 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.186 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF17032 | zinc_ribbon_15 | 12.40 |
| PF14016 | DUF4232 | 5.43 |
| PF00723 | Glyco_hydro_15 | 4.65 |
| PF13466 | STAS_2 | 3.88 |
| PF06897 | DUF1269 | 2.33 |
| PF08240 | ADH_N | 2.33 |
| PF13424 | TPR_12 | 1.55 |
| PF03625 | DUF302 | 1.55 |
| PF13450 | NAD_binding_8 | 1.55 |
| PF03372 | Exo_endo_phos | 1.55 |
| PF01494 | FAD_binding_3 | 1.55 |
| PF01569 | PAP2 | 1.55 |
| PF00196 | GerE | 1.55 |
| PF13365 | Trypsin_2 | 0.78 |
| PF12867 | DinB_2 | 0.78 |
| PF01370 | Epimerase | 0.78 |
| PF00689 | Cation_ATPase_C | 0.78 |
| PF01872 | RibD_C | 0.78 |
| PF11139 | SfLAP | 0.78 |
| PF02517 | Rce1-like | 0.78 |
| PF09995 | MPAB_Lcp_cat | 0.78 |
| PF01957 | NfeD | 0.78 |
| PF00128 | Alpha-amylase | 0.78 |
| PF00185 | OTCace | 0.78 |
| PF14019 | DUF4235 | 0.78 |
| PF00107 | ADH_zinc_N | 0.78 |
| PF12802 | MarR_2 | 0.78 |
| PF16912 | Glu_dehyd_C | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 4.65 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.10 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 2.33 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.55 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.55 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.55 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 1.55 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.78 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.78 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.78 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.78 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.78 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.78 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.04 % |
| Unclassified | root | N/A | 44.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000837|AP72_2010_repI_A100DRAFT_1024934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 839 | Open in IMG/M |
| 3300004082|Ga0062384_100897567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300004092|Ga0062389_102939940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
| 3300005332|Ga0066388_107639060 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005467|Ga0070706_100182828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1958 | Open in IMG/M |
| 3300005536|Ga0070697_100833146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 817 | Open in IMG/M |
| 3300005764|Ga0066903_102872740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 934 | Open in IMG/M |
| 3300005764|Ga0066903_106229815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 623 | Open in IMG/M |
| 3300006102|Ga0075015_100203555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300006163|Ga0070715_10418237 | Not Available | 749 | Open in IMG/M |
| 3300006354|Ga0075021_10656511 | Not Available | 672 | Open in IMG/M |
| 3300006806|Ga0079220_10827449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300009792|Ga0126374_10391648 | Not Available | 968 | Open in IMG/M |
| 3300010043|Ga0126380_11787199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea tibetensis | 555 | Open in IMG/M |
| 3300010361|Ga0126378_11903294 | Not Available | 677 | Open in IMG/M |
| 3300010366|Ga0126379_11087824 | Not Available | 905 | Open in IMG/M |
| 3300010366|Ga0126379_11118690 | Not Available | 894 | Open in IMG/M |
| 3300010366|Ga0126379_13086456 | Not Available | 557 | Open in IMG/M |
| 3300010376|Ga0126381_103395666 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300010376|Ga0126381_104287207 | Not Available | 552 | Open in IMG/M |
| 3300010398|Ga0126383_11726037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces shenzhenensis | 715 | Open in IMG/M |
| 3300010398|Ga0126383_12572702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes aureus | 593 | Open in IMG/M |
| 3300010398|Ga0126383_13607935 | Not Available | 505 | Open in IMG/M |
| 3300011120|Ga0150983_10449572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1234 | Open in IMG/M |
| 3300012201|Ga0137365_10859353 | Not Available | 662 | Open in IMG/M |
| 3300012362|Ga0137361_10746932 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300012971|Ga0126369_11693065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium → unclassified Cryobacterium → Cryobacterium sp. RHLS22-1 | 722 | Open in IMG/M |
| 3300013306|Ga0163162_11076925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 910 | Open in IMG/M |
| 3300016294|Ga0182041_11117334 | Not Available | 716 | Open in IMG/M |
| 3300016319|Ga0182033_10561781 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300016319|Ga0182033_10978187 | Not Available | 752 | Open in IMG/M |
| 3300016319|Ga0182033_11064299 | Not Available | 721 | Open in IMG/M |
| 3300016341|Ga0182035_10564081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Thermobifida → Thermobifida halotolerans | 980 | Open in IMG/M |
| 3300016357|Ga0182032_11252534 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300016404|Ga0182037_10039122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3084 | Open in IMG/M |
| 3300016422|Ga0182039_10399679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
| 3300016422|Ga0182039_10934429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea tibetensis | 775 | Open in IMG/M |
| 3300017928|Ga0187806_1093807 | Not Available | 953 | Open in IMG/M |
| 3300018007|Ga0187805_10648045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300018034|Ga0187863_10709475 | Not Available | 568 | Open in IMG/M |
| 3300018085|Ga0187772_11313801 | Not Available | 535 | Open in IMG/M |
| 3300020580|Ga0210403_11460515 | Not Available | 516 | Open in IMG/M |
| 3300020583|Ga0210401_11494409 | Not Available | 533 | Open in IMG/M |
| 3300021180|Ga0210396_11738612 | Not Available | 506 | Open in IMG/M |
| 3300021401|Ga0210393_10724341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 811 | Open in IMG/M |
| 3300021402|Ga0210385_10780530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300021420|Ga0210394_10821686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
| 3300021433|Ga0210391_10983191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 657 | Open in IMG/M |
| 3300021477|Ga0210398_10790300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 765 | Open in IMG/M |
| 3300021559|Ga0210409_11518048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300021560|Ga0126371_10131460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2543 | Open in IMG/M |
| 3300025905|Ga0207685_10484426 | Not Available | 648 | Open in IMG/M |
| 3300025914|Ga0207671_11451931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 531 | Open in IMG/M |
| 3300025916|Ga0207663_10048781 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
| 3300027567|Ga0209115_1131155 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300027874|Ga0209465_10054696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1915 | Open in IMG/M |
| 3300027884|Ga0209275_10292576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
| 3300027911|Ga0209698_10778849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum | 724 | Open in IMG/M |
| 3300030007|Ga0311338_11904616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300030056|Ga0302181_10124601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1252 | Open in IMG/M |
| 3300031543|Ga0318516_10047280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2332 | Open in IMG/M |
| 3300031546|Ga0318538_10763621 | Not Available | 524 | Open in IMG/M |
| 3300031549|Ga0318571_10040490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1346 | Open in IMG/M |
| 3300031549|Ga0318571_10189088 | Not Available | 731 | Open in IMG/M |
| 3300031549|Ga0318571_10244403 | Not Available | 657 | Open in IMG/M |
| 3300031572|Ga0318515_10260951 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031640|Ga0318555_10406604 | Not Available | 737 | Open in IMG/M |
| 3300031668|Ga0318542_10326972 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300031679|Ga0318561_10064152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1868 | Open in IMG/M |
| 3300031680|Ga0318574_10052507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2149 | Open in IMG/M |
| 3300031681|Ga0318572_10658164 | Not Available | 624 | Open in IMG/M |
| 3300031681|Ga0318572_10690511 | Not Available | 608 | Open in IMG/M |
| 3300031682|Ga0318560_10659491 | Not Available | 566 | Open in IMG/M |
| 3300031708|Ga0310686_111416457 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300031719|Ga0306917_10137621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum | 1799 | Open in IMG/M |
| 3300031719|Ga0306917_10868715 | Not Available | 706 | Open in IMG/M |
| 3300031723|Ga0318493_10773133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300031724|Ga0318500_10402308 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300031736|Ga0318501_10658019 | Not Available | 576 | Open in IMG/M |
| 3300031736|Ga0318501_10791852 | Not Available | 525 | Open in IMG/M |
| 3300031744|Ga0306918_10652106 | Not Available | 824 | Open in IMG/M |
| 3300031748|Ga0318492_10108320 | Not Available | 1371 | Open in IMG/M |
| 3300031748|Ga0318492_10700991 | Not Available | 542 | Open in IMG/M |
| 3300031751|Ga0318494_10127261 | Not Available | 1423 | Open in IMG/M |
| 3300031763|Ga0318537_10123625 | Not Available | 962 | Open in IMG/M |
| 3300031763|Ga0318537_10150019 | Not Available | 868 | Open in IMG/M |
| 3300031770|Ga0318521_10048316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2184 | Open in IMG/M |
| 3300031771|Ga0318546_10626176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300031781|Ga0318547_10241239 | Not Available | 1088 | Open in IMG/M |
| 3300031781|Ga0318547_10859306 | Not Available | 566 | Open in IMG/M |
| 3300031792|Ga0318529_10086143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1404 | Open in IMG/M |
| 3300031793|Ga0318548_10259358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 854 | Open in IMG/M |
| 3300031796|Ga0318576_10493954 | Not Available | 577 | Open in IMG/M |
| 3300031798|Ga0318523_10216074 | Not Available | 958 | Open in IMG/M |
| 3300031798|Ga0318523_10362429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300031799|Ga0318565_10149280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300031805|Ga0318497_10865558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium → unclassified Sphaerisporangium → Sphaerisporangium sp. H8589 | 507 | Open in IMG/M |
| 3300031819|Ga0318568_10931500 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031833|Ga0310917_10256089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum | 1179 | Open in IMG/M |
| 3300031859|Ga0318527_10285328 | Not Available | 703 | Open in IMG/M |
| 3300031879|Ga0306919_11454511 | Not Available | 516 | Open in IMG/M |
| 3300031890|Ga0306925_11273048 | Not Available | 732 | Open in IMG/M |
| 3300031896|Ga0318551_10897787 | Not Available | 517 | Open in IMG/M |
| 3300031910|Ga0306923_11480874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 711 | Open in IMG/M |
| 3300031912|Ga0306921_12467562 | Not Available | 540 | Open in IMG/M |
| 3300031942|Ga0310916_10311519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
| 3300031946|Ga0310910_10942724 | Not Available | 676 | Open in IMG/M |
| 3300031954|Ga0306926_10455396 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300032001|Ga0306922_11026296 | Not Available | 850 | Open in IMG/M |
| 3300032008|Ga0318562_10540208 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300032025|Ga0318507_10241350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium → unclassified Cryobacterium → Cryobacterium sp. RHLS22-1 | 783 | Open in IMG/M |
| 3300032035|Ga0310911_10725375 | Not Available | 575 | Open in IMG/M |
| 3300032041|Ga0318549_10264542 | Not Available | 774 | Open in IMG/M |
| 3300032051|Ga0318532_10281562 | Not Available | 590 | Open in IMG/M |
| 3300032055|Ga0318575_10345191 | Not Available | 754 | Open in IMG/M |
| 3300032068|Ga0318553_10564513 | Not Available | 596 | Open in IMG/M |
| 3300032091|Ga0318577_10479680 | Not Available | 593 | Open in IMG/M |
| 3300032261|Ga0306920_100589824 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300032261|Ga0306920_102633796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300032895|Ga0335074_10271990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1968 | Open in IMG/M |
| 3300032895|Ga0335074_11182137 | Not Available | 647 | Open in IMG/M |
| 3300032896|Ga0335075_10960879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 773 | Open in IMG/M |
| 3300032896|Ga0335075_11574405 | Not Available | 542 | Open in IMG/M |
| 3300033289|Ga0310914_10839414 | Not Available | 817 | Open in IMG/M |
| 3300033290|Ga0318519_10060915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1924 | Open in IMG/M |
| 3300033808|Ga0314867_001411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5366 | Open in IMG/M |
| 3300033808|Ga0314867_019105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 45.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.55% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A100DRAFT_10249343 | 3300000837 | Forest Soil | MTFAVIFALAAGFSNAVNVLTQHKASIGAPKRVKGWRLALYLPRRPLWLL |
| Ga0062384_1008975672 | 3300004082 | Bog Forest Soil | MDQVMVLIVVFAVAAAFSNAVNVMTQHAASTGAPKQEKGWRL |
| Ga0062389_1029399401 | 3300004092 | Bog Forest Soil | MVLIVVFAVAAAFSNAVNVMTQHAASAGAPKQEKGWRLVGYLFRQP |
| Ga0066388_1076390601 | 3300005332 | Tropical Forest Soil | VGSGAMILTVVYALAASFSNAVNVMTQHKASIGAPEREKGWR |
| Ga0070706_1001828283 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLTVVFALAAALCNAVNLLTQHKASIGAPRRVKGWRLALY |
| Ga0070697_1008331462 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLTVVFAVAAAFSNGVNVLTQHAASIGAPRREKAWHLVGYLF |
| Ga0066903_1028727401 | 3300005764 | Tropical Forest Soil | MLLAVVFALAAAMANAVNLLTQHKASIGAPRQVKGWRLALY |
| Ga0066903_1062298151 | 3300005764 | Tropical Forest Soil | VILAVVFALAAAFSNAVNLLTQHKASISAPKKEGG |
| Ga0075015_1002035551 | 3300006102 | Watersheds | MLLVVVFALAAALANAVNLLTQHKASIGAPRRVKGWRLALYLP |
| Ga0070715_104182372 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MILAVGFALAAAFSSAVNLITQHAASISAPKRAKGWRLALYL |
| Ga0075021_106565113 | 3300006354 | Watersheds | MTASVVFGLAAALSNAVFIMTQHLASVSAPAREKGWRLAVYLL |
| Ga0079220_108274492 | 3300006806 | Agricultural Soil | VTLAVAFALAAAFSNAVNLITQHKASVGAPQREKGWRLALYLPRQPL* |
| Ga0126374_103916482 | 3300009792 | Tropical Forest Soil | MFLAVVFALAAALANAVNLLTQHKASIGAPKRVKGWRL |
| Ga0126380_117871991 | 3300010043 | Tropical Forest Soil | VILAVVFALTAAFSNAVNLMTQHKASISAPAKDRGWRLP |
| Ga0126378_119032942 | 3300010361 | Tropical Forest Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPKRVKGWRLALYLPRQP |
| Ga0126379_110878243 | 3300010366 | Tropical Forest Soil | VTLAVVFAMAAAFCNAVNLMTQHSASVGAPERKRGWRLASYLIRQP |
| Ga0126379_111186901 | 3300010366 | Tropical Forest Soil | MTLAVVFALAAAFSSAANLMTQHAASVGAPKREKGWRLALYL |
| Ga0126379_130864561 | 3300010366 | Tropical Forest Soil | VILALGFALAAAFCSAVNVMTQHAASISAPKRGMSWRLALYL |
| Ga0126381_1033956663 | 3300010376 | Tropical Forest Soil | VILAVVFALAAAFSNAVNLLTQHKASISAPKKEGGWRLPL |
| Ga0126381_1042872071 | 3300010376 | Tropical Forest Soil | MTFAVIFALAAGLSNAVNVLTQHKASISAPTRVKGWRLALYLPL |
| Ga0126383_117260371 | 3300010398 | Tropical Forest Soil | VILALGFALAAAFCSAVNAMTQHAASISAPKRGMGWRLALYLIR |
| Ga0126383_125727021 | 3300010398 | Tropical Forest Soil | MTLAVVFALAAAFSSAANLMTQHAASVGAPKREKG |
| Ga0126383_136079351 | 3300010398 | Tropical Forest Soil | VTFAVVFALVAAFSNAVNLLTQHAASIRAPKGEKGWRLGLYLARQPLW |
| Ga0150983_104495721 | 3300011120 | Forest Soil | VTLAIAFAVAAAFSNAVNLMAQHSASAGAPKREKGWRLAAYLVRQPLW |
| Ga0137365_108593532 | 3300012201 | Vadose Zone Soil | VTLAVVFALAAAFSNAVNLMTQHSASVGAPKREKGWR |
| Ga0137361_107469322 | 3300012362 | Vadose Zone Soil | MTLTVVFALAAAFSNAVNLLSQHSASTGAPKREKGWRLVTYLVRQPL |
| Ga0126369_116930652 | 3300012971 | Tropical Forest Soil | MLLAVVFALAAAMANAVNLLTQHKASIGAPRQVKGWRLAL |
| Ga0163162_110769252 | 3300013306 | Switchgrass Rhizosphere | VILAVVFALAAALANAVNLMTQHKASIGAPGRVKGWRLALYL |
| Ga0182041_111173342 | 3300016294 | Soil | VILAVVFALAAAFCSAANLLTQHAASISAPKREKGWRLPLYLIRQ |
| Ga0182033_105617813 | 3300016319 | Soil | VILAVVFALAAAFSNAVNLLTQHKASISAPKKEGGWRLPLYLIR |
| Ga0182033_109781871 | 3300016319 | Soil | VTFAVVFALVAAFSNAVNLLTQHAASIRAPKREKGWRLGVYL |
| Ga0182033_110642991 | 3300016319 | Soil | VILAVVFALGAAMANAVNLLTQHKASIGAPRRVKG |
| Ga0182035_105640811 | 3300016341 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKREKGW |
| Ga0182032_112525341 | 3300016357 | Soil | MILTVVFALAASFSNAVNVMTQHKASIADPQREKGWRL |
| Ga0182037_100391224 | 3300016404 | Soil | VTLAVAFALVAAFSNAVNLLTQHAASIRAPKQEKGWRLGL |
| Ga0182039_103996793 | 3300016422 | Soil | VTFAVVFALVAAFSNAVNLLTQHAASIRAPKREKGWRL |
| Ga0182039_109344291 | 3300016422 | Soil | VILAVVFALAAAFSNAVNLLTQHKASISAPKKEGGWRLPLYLIRQPL |
| Ga0187806_10938071 | 3300017928 | Freshwater Sediment | VIVAVAFALAAAFSSAVTLITQHATSIRALKRDKGWR |
| Ga0187805_106480451 | 3300018007 | Freshwater Sediment | MVVTVVFAVAAAFSNAVNVLTQHSASIGAPTREKGWHLVVYLFRQPL |
| Ga0187863_107094751 | 3300018034 | Peatland | MTLTVVFALAAAFSNAVNVLTQHSASVGAPKREKGWR |
| Ga0187772_108415821 | 3300018085 | Tropical Peatland | MTLTVSFALAAALSSAINLMTQHSASVGAPKRDKGWRLVSYLFRQPTWL |
| Ga0187772_113138011 | 3300018085 | Tropical Peatland | MTLTVAFALAAAFTTAVNLMTQHSASVSAPKREKGWRLVAYL |
| Ga0210403_114605153 | 3300020580 | Soil | VIFAIVFALAAAFSNAVNLMTQHKASIGAPAKERGWRL |
| Ga0210401_114944092 | 3300020583 | Soil | VILAVAFALAAAFANAVNLMTQHAASIAAPDQENG |
| Ga0210396_117386122 | 3300021180 | Soil | MVFTVVFALAAAFSNGANVITQHAASIGAPKREKGLHLVR |
| Ga0210393_107243411 | 3300021401 | Soil | MTLSVAFALAAALSSAVNLMTQHSASVGAPTREKGWRLVGYLFRQPRWLL |
| Ga0210385_107805301 | 3300021402 | Soil | MTLTVAFALAAALSSAVNLMTQHSASVGAPKREKGWRLVAYLF |
| Ga0210394_108216861 | 3300021420 | Soil | MAEGGTGTGIMTLAVVFALAAALCNAVNLMTQHLASTGAPKRERGWRLPVY |
| Ga0210391_109831913 | 3300021433 | Soil | MVFTVVFALASAFCNGANVITQHSASIGAPKREKGLRLVRYLFRQP |
| Ga0210390_111953831 | 3300021474 | Soil | VILAVAFALAAAFANAVNLMTQHAASIAAPNPEKGWHLALYLVRQPMWLLGGAVAVGSYV |
| Ga0210398_107903001 | 3300021477 | Soil | MTLSVAFALAAALSSAVNLMTQHSASVGAPKREKGWRLIAYLFRQP |
| Ga0210409_115180481 | 3300021559 | Soil | MTLTVAFTLAAALCSAVNLMTQHSASAGAPKREKGWRLVTYLFRQ |
| Ga0126371_101314605 | 3300021560 | Tropical Forest Soil | VTLAVVFALAAAFSSAVNLMTQHAASISAPKREKGWRLALYLVRQPL |
| Ga0207685_104844261 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MILAVGFALAAAFSSAVNLITQHAASISAPKRAKGWRLALYLIRQPL |
| Ga0207671_114519312 | 3300025914 | Corn Rhizosphere | VILAVVFALAAALANAVNLMTQHKASIGAPGRVKG |
| Ga0207663_100487813 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MILAVGFALAAAFSSAVNLITQHAASISAPKRAKGWRL |
| Ga0209115_11311551 | 3300027567 | Forest Soil | MILTVVYAVAAALSNGVNVLTQHWASVTAPKQAKGWHLVGYLFR |
| Ga0209465_100546964 | 3300027874 | Tropical Forest Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKQERGWRLGLYLA |
| Ga0209275_102925763 | 3300027884 | Soil | MVFTVVFALAAAFSNGANVITQHAASIGAPKREKGLHLVRY |
| Ga0209698_107788492 | 3300027911 | Watersheds | VILAVAFALAAAFCSAVNLLTQHVASISAPKREKGWRLPLY |
| Ga0311338_119046162 | 3300030007 | Palsa | MTLTVAFALAAALSSAVNLMTQHSASVGAPKGEKGWRLVAYLFRQ |
| Ga0302181_101246011 | 3300030056 | Palsa | MTISVAFALAAALSSAVNLMTQHSASVGAPEGEKGWRLVAYLFRQPPWLL |
| Ga0318516_100472801 | 3300031543 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRRVKGWRLALYLPPPL |
| Ga0318538_107636211 | 3300031546 | Soil | VTFAVVFALVAAFSNAVNLLTQHAASIRAPKREKGWRLGLYLARQPL |
| Ga0318571_100404901 | 3300031549 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRRVKGWRLALYLPRQP |
| Ga0318571_101890882 | 3300031549 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKREKGWRLGLYLARQP |
| Ga0318571_102444031 | 3300031549 | Soil | VILAVVFALAAALCSAVNLLTQHVASISAPKREKGWRLPLYL |
| Ga0318515_102609511 | 3300031572 | Soil | MILTVVYALAASFSNAVNVMTQHKASIGAPEREKGWRLVSYLF |
| Ga0318555_104066042 | 3300031640 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKQEKGWRLGLYLARQPMWLVGG |
| Ga0318542_103269722 | 3300031668 | Soil | VILAVAFALAAALCSAVNLITQHAASIRAPKREKGWRLALY |
| Ga0318561_100641521 | 3300031679 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRQVKGWRLALY |
| Ga0318574_100525071 | 3300031680 | Soil | VILAVGFALAAALCSAVNLITQHAASIRAPKREKGWRLALYL |
| Ga0318572_106581641 | 3300031681 | Soil | VIWAVVFALAAALANAVNLMTQHKASIGAPRRVKGWR |
| Ga0318572_106905111 | 3300031681 | Soil | MILAVAFALAAAFSSAVNLITQHAASISAPKREKGWRLALYLLR |
| Ga0318560_106594911 | 3300031682 | Soil | VTFAVVFALAAAFSSAVNLMTQHAASISAPKQEKGWRLAV |
| Ga0310686_1114164571 | 3300031708 | Soil | MTLAVAFALAAALSSAVNLMTQHSASVGAPKREKGW |
| Ga0306917_101376211 | 3300031719 | Soil | VILAVVFALAAALCSAVNLLTQHVASISAPKREKGWRL |
| Ga0306917_108687152 | 3300031719 | Soil | MLLAVVFALAAALANAVNLLTQHKASISAPRRVKGWRLALYLPRQPLW |
| Ga0318493_107731331 | 3300031723 | Soil | VILAVVFALAAAMANAVNLMTQHKASIGAPRRVKGWRLALYLPRQP |
| Ga0318500_104023082 | 3300031724 | Soil | MTLTVVYALAASFSNAVNVMTQHKASIGAPEREKG |
| Ga0318501_106580192 | 3300031736 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKQEKGWRLGLYLARQPLW |
| Ga0318501_107918521 | 3300031736 | Soil | MILAVAFALAAAFSSAVNLITQHAASISAPKRQKGWRLALY |
| Ga0306918_106521061 | 3300031744 | Soil | MILTVVFALAAAFANATHLLTQHVASADLPKRAAGRRVVT |
| Ga0318492_101083202 | 3300031748 | Soil | VTLAVVFALAAAFSNAVNLMTQHSASISAPKREKGWRLALYLIRQPLW |
| Ga0318492_107009911 | 3300031748 | Soil | VIWAVVFALAAALANAVNLMTQHKASISAPARVKGWRLA |
| Ga0318494_101272611 | 3300031751 | Soil | VTLAVVFALAAAFSNAVNLMTQHSASISAPKREKGWRLALYL |
| Ga0318537_101236253 | 3300031763 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKREKGWRLG |
| Ga0318537_101500191 | 3300031763 | Soil | MLLAVVFALAAALANAVNLLTQHKASIGAPQRVKGWR |
| Ga0318521_100483162 | 3300031770 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRRVKGWRLALYLPRRAD |
| Ga0318546_106261761 | 3300031771 | Soil | VTLAVVFALAAAFSSAVNLMTQHAASISAPEQERGWR |
| Ga0318547_102412391 | 3300031781 | Soil | VILAVVFALAAAMANAVNLLTQHKASIGAPRRVKGWRLALYLPRRAYA |
| Ga0318547_108593062 | 3300031781 | Soil | VTFAVVFALAAAFSSAVNLMTQHAASISAPKQEKGWRLAVYLVR |
| Ga0318529_100861432 | 3300031792 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRRVKGWRLALYLPRQPPPLH |
| Ga0318548_102593582 | 3300031793 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRRVKGWRLALY |
| Ga0318576_104939542 | 3300031796 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKQEKGWRLGLYLARQPMWLVGGAAAVGSY |
| Ga0318523_102160742 | 3300031798 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRRVKGWRLALYLPPPLH |
| Ga0318523_103624292 | 3300031798 | Soil | VIWAVVFALAAALANAVNLMTQHKASISAPARVKGWRLALY |
| Ga0318565_101492802 | 3300031799 | Soil | VTLAVVFALAAAFSSAVNLMTQHAASISAPKQERGW |
| Ga0318497_108655581 | 3300031805 | Soil | VTLAVVFALAAAFSNAVNLMTQHSASISAPKREKGWRLALY |
| Ga0318568_109315002 | 3300031819 | Soil | MILTVVFALAASFSNAVNVLTQHKASIAAPKREKGW |
| Ga0310917_102560891 | 3300031833 | Soil | VILAVVFALAAAFCSAANLLTQHAASISAPKREKGWRL |
| Ga0318527_102853282 | 3300031859 | Soil | MILAVAFALAAAFSSAVNLITQHAASISAPKREKGWRLAL |
| Ga0306919_114545112 | 3300031879 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKREKGWRL |
| Ga0306925_112730481 | 3300031890 | Soil | VTFAVVFALVAAFSNAVNLLTQHAASIRAPKREKGWR |
| Ga0318551_108977872 | 3300031896 | Soil | VILAVVFALAAAMANAVNLLTQHKASIGAPRRVKGWRLALYL |
| Ga0306923_114808742 | 3300031910 | Soil | VTLAVVFAMAAAFSNAVNLMTQHSASISAPEREKGWRLALYLV |
| Ga0306921_124675621 | 3300031912 | Soil | VILAVVFALAAAMANAVNLLTQHKASIGAPGRVRGWRLALYLPRQP |
| Ga0310916_103115191 | 3300031942 | Soil | VTFAVVFALVAAFSNAVNLLTQHAASIRAPKREKG |
| Ga0310910_109427241 | 3300031946 | Soil | VTFAVVFALVAAFSNAVNLLTQHAASIRAPKREKGW |
| Ga0306926_104553963 | 3300031954 | Soil | VILAVVFALAAAFSNAVNLLTQHKASIGAPKKEGGWRLPLYLIRHPLW |
| Ga0306922_110262963 | 3300032001 | Soil | VIWAVVFALAAALANAVNLMTQHKASISAPRQVKGWR |
| Ga0318562_105402082 | 3300032008 | Soil | MIFTVGFALAASFSNAVNVMTQHRASIGAPEREKGWRLVGDLFRQ |
| Ga0318507_102413501 | 3300032025 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRRVKGWRLALYLPRRADARLVLGQQ |
| Ga0310911_107253752 | 3300032035 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKQEKGWRLGLY |
| Ga0318549_102645422 | 3300032041 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRRVKGWRLALYLP |
| Ga0318532_102815621 | 3300032051 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKREKGWRLGLYLAR |
| Ga0318575_103451912 | 3300032055 | Soil | VILAVVFALAAAMANAVNLLTQHKASIGAPRRVKGWRLA |
| Ga0318553_105645131 | 3300032068 | Soil | VTLAVVFALAAAFSNAVNLITQHKASVGAPQREKGWRLALYLP |
| Ga0318577_104796802 | 3300032091 | Soil | VILAVVFALAAAMANAVNLLTQHKASIGAPRRVKGWRLALYLPRRAYARLV |
| Ga0306920_1005898243 | 3300032261 | Soil | MIFTVGFALAASFSNAVNVMTQHRASIAAPEREKGWRLVGYLFRQ |
| Ga0306920_1026337962 | 3300032261 | Soil | MLPTVVFAVAAAFSNGVNVLTQHTASVGAPGREKGWRLV |
| Ga0335074_102719901 | 3300032895 | Soil | MVFTVVFALASAFCNGANVLTQHSVSISAPKREKGL |
| Ga0335074_111821372 | 3300032895 | Soil | MVFTVVFALAAAFCNGANVITQHSASIGAPKREKGLRLVRYL |
| Ga0335075_109608792 | 3300032896 | Soil | MVFTVVFALASAFCNGANVLTQHSVSISAPKREKGLHLVGYLFR |
| Ga0335075_115744052 | 3300032896 | Soil | MVFTVVFALAAAFCNGANVITQHSASIGAPKREKGLHLVRYLFRQP |
| Ga0310914_108394142 | 3300033289 | Soil | VTLAVVFALVAAFSNAVNLLTQHAASIRAPKQEKGWRLGLYLARQP |
| Ga0318519_100609151 | 3300033290 | Soil | MLLTVVFALAAALANAVNLLTQHKASIGAPRQVKGWRLALYLPRQ |
| Ga0314867_001411_1611_1739 | 3300033808 | Peatland | MTLTVAFALAAAFSNAVSVLTQHAAGIGAPKIPGRRRERGWA |
| Ga0314867_019105_1_126 | 3300033808 | Peatland | MTLTVVFALASAFSNAVNLMTQHLASATAPKREKGWRLVGYL |
| ⦗Top⦘ |