| Basic Information | |
|---|---|
| Family ID | F064139 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 48 residues |
| Representative Sequence | HAFVHGLTFGMRVSAVICLGGALAAAALIRKYRHAEQAQPLAEAA |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 85.27 % |
| % of genes from short scaffolds (< 2000 bps) | 79.84 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.519 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.829 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.682 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.163 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00440 | TetR_N | 31.01 |
| PF13560 | HTH_31 | 28.68 |
| PF13977 | TetR_C_6 | 23.26 |
| PF12844 | HTH_19 | 1.55 |
| PF07883 | Cupin_2 | 0.78 |
| PF01381 | HTH_3 | 0.78 |
| PF03109 | ABC1 | 0.78 |
| PF01676 | Metalloenzyme | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.52 % |
| Unclassified | root | N/A | 22.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0678956 | Not Available | 569 | Open in IMG/M |
| 3300000956|JGI10216J12902_109636736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300000956|JGI10216J12902_117357108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
| 3300004114|Ga0062593_101176661 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300004479|Ga0062595_101727708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300005093|Ga0062594_102854302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300005172|Ga0066683_10444590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300005184|Ga0066671_10057531 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300005186|Ga0066676_10761388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300005186|Ga0066676_11166729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300005187|Ga0066675_10094524 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
| 3300005187|Ga0066675_11305410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300005332|Ga0066388_107333337 | Not Available | 554 | Open in IMG/M |
| 3300005341|Ga0070691_10344637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 826 | Open in IMG/M |
| 3300005435|Ga0070714_100055968 | All Organisms → cellular organisms → Bacteria | 3372 | Open in IMG/M |
| 3300005438|Ga0070701_10160541 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300005446|Ga0066686_10921228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300005451|Ga0066681_10506162 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005451|Ga0066681_10510716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
| 3300005455|Ga0070663_101106210 | Not Available | 693 | Open in IMG/M |
| 3300005540|Ga0066697_10333004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 887 | Open in IMG/M |
| 3300005547|Ga0070693_100725432 | Not Available | 730 | Open in IMG/M |
| 3300005556|Ga0066707_10954078 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005598|Ga0066706_10594448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
| 3300005614|Ga0068856_100838572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 938 | Open in IMG/M |
| 3300005840|Ga0068870_10455257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
| 3300005842|Ga0068858_100799558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 920 | Open in IMG/M |
| 3300005843|Ga0068860_100389095 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300006032|Ga0066696_10883934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300006049|Ga0075417_10262005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
| 3300006163|Ga0070715_10589594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300006237|Ga0097621_100052498 | All Organisms → cellular organisms → Bacteria | 3321 | Open in IMG/M |
| 3300006755|Ga0079222_10687492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300006755|Ga0079222_10722255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 794 | Open in IMG/M |
| 3300006755|Ga0079222_12285332 | Not Available | 539 | Open in IMG/M |
| 3300006806|Ga0079220_10649994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300006845|Ga0075421_100417776 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300006854|Ga0075425_100647614 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300006881|Ga0068865_100632529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
| 3300007076|Ga0075435_100301759 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300009012|Ga0066710_103021660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300009012|Ga0066710_103378718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300009137|Ga0066709_102683790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
| 3300009174|Ga0105241_10109335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2211 | Open in IMG/M |
| 3300009553|Ga0105249_10461407 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300010303|Ga0134082_10066819 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300010303|Ga0134082_10183245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 853 | Open in IMG/M |
| 3300010326|Ga0134065_10392151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300010329|Ga0134111_10057684 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300010335|Ga0134063_10462606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300010375|Ga0105239_10469271 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300010403|Ga0134123_13406291 | Not Available | 514 | Open in IMG/M |
| 3300011119|Ga0105246_11810898 | Not Available | 584 | Open in IMG/M |
| 3300012198|Ga0137364_11196469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300012356|Ga0137371_10016455 | All Organisms → cellular organisms → Bacteria | 5679 | Open in IMG/M |
| 3300012362|Ga0137361_11022394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300012514|Ga0157330_1087248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300012904|Ga0157282_10008841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1757 | Open in IMG/M |
| 3300012938|Ga0162651_100070832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300012984|Ga0164309_10831910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300012984|Ga0164309_10947133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300012988|Ga0164306_10219685 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300013102|Ga0157371_10783822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300014969|Ga0157376_11992895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300015356|Ga0134073_10032446 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300015356|Ga0134073_10266168 | Not Available | 598 | Open in IMG/M |
| 3300015357|Ga0134072_10264735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300015373|Ga0132257_101324179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 915 | Open in IMG/M |
| 3300017654|Ga0134069_1217526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300019789|Ga0137408_1262248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3331 | Open in IMG/M |
| 3300020006|Ga0193735_1018527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2165 | Open in IMG/M |
| 3300020170|Ga0179594_10131316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 918 | Open in IMG/M |
| 3300021080|Ga0210382_10252258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 772 | Open in IMG/M |
| 3300021080|Ga0210382_10541435 | Not Available | 516 | Open in IMG/M |
| 3300021344|Ga0193719_10081087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis | 1410 | Open in IMG/M |
| 3300024055|Ga0247794_10000114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10699 | Open in IMG/M |
| 3300024187|Ga0247672_1071789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300025899|Ga0207642_10152887 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300025906|Ga0207699_10783843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
| 3300025908|Ga0207643_10423199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
| 3300025934|Ga0207686_10090846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2015 | Open in IMG/M |
| 3300026285|Ga0209438_1112487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 792 | Open in IMG/M |
| 3300026300|Ga0209027_1082071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1184 | Open in IMG/M |
| 3300026312|Ga0209153_1095636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1111 | Open in IMG/M |
| 3300026316|Ga0209155_1007749 | All Organisms → cellular organisms → Bacteria | 4754 | Open in IMG/M |
| 3300026805|Ga0207507_103961 | Not Available | 558 | Open in IMG/M |
| 3300027717|Ga0209998_10180946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300027909|Ga0209382_10813345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 993 | Open in IMG/M |
| 3300027909|Ga0209382_11661626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300028380|Ga0268265_12404068 | Not Available | 533 | Open in IMG/M |
| 3300028708|Ga0307295_10013400 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300028711|Ga0307293_10132534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
| 3300028716|Ga0307311_10026483 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300028717|Ga0307298_10111082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
| 3300028755|Ga0307316_10182447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 753 | Open in IMG/M |
| 3300028771|Ga0307320_10237596 | Not Available | 717 | Open in IMG/M |
| 3300028784|Ga0307282_10148241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1110 | Open in IMG/M |
| 3300028807|Ga0307305_10173351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 995 | Open in IMG/M |
| 3300028811|Ga0307292_10240197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300028812|Ga0247825_11064022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300028819|Ga0307296_10035081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2647 | Open in IMG/M |
| 3300028819|Ga0307296_10310130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 861 | Open in IMG/M |
| 3300028875|Ga0307289_10056126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1579 | Open in IMG/M |
| 3300028884|Ga0307308_10308422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300030511|Ga0268241_10028375 | Not Available | 1129 | Open in IMG/M |
| 3300031731|Ga0307405_11782164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300031824|Ga0307413_10412817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1061 | Open in IMG/M |
| 3300031939|Ga0308174_11560373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300031995|Ga0307409_100608722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1081 | Open in IMG/M |
| 3300031995|Ga0307409_102427555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300032205|Ga0307472_102514400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300032421|Ga0310812_10157259 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300034172|Ga0334913_037825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1037 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.10% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.88% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026805 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_06789561 | 3300000033 | Soil | HAFVHGLTFGMRVSAVICLGGALAAAALIRKYRHAEQAQPLAEAA* |
| JGI10216J12902_1096367362 | 3300000956 | Soil | VHGLTFAMKVSALICFGAAIAAAVLVRRYRHAEPTEQTAELAA* |
| JGI10216J12902_1173571081 | 3300000956 | Soil | APPQAFVDGLTFGMRVSAAICFGAAIAAAVLVRRYRHADSSHPVEAAA* |
| Ga0063454_1019366492 | 3300004081 | Soil | QVGVALGIGIMGAIIANRATAARHGGASGPEAFVHGLTFGMRVSAVICFGAAIAAAALVRRYSHVEQAERPLEAAA* |
| Ga0062593_1011766612 | 3300004114 | Soil | GADPPHAFVHGLTFGMRVSAAICLGGAIAAVALIRKVRHAEQVQPLAEAA* |
| Ga0062595_1017277081 | 3300004479 | Soil | VDGLTFAMKVSAGICLAAAIAAAVLVRKYRHAEDQSRPVEAAA* |
| Ga0062594_1028543021 | 3300005093 | Soil | FIPKVGPPPQAFVYGLTFGMKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA* |
| Ga0066683_104445901 | 3300005172 | Soil | AGADPPHAFVHGLTFGMRVSAVICLGGAFAAAALIRQYRHAEQAQPLAEAA* |
| Ga0066671_100575313 | 3300005184 | Soil | TFGMRVSAVICLGGAVAAAALVRNYRHAEEEETRLAEAA* |
| Ga0066676_107613881 | 3300005186 | Soil | PPHAFVHGLTFGMRVSALICLGAAVAAAVLVRKYRHAEQAQPLAEAA* |
| Ga0066676_111667292 | 3300005186 | Soil | AAHGGPPPQAFVYGLTFGMRVSAVICLGAAVTAAALVRRYRHVEESERALEAAA* |
| Ga0066675_100945241 | 3300005187 | Soil | GGASGPQAFVDGLTFAMKVSAGICFAAAIAAAVLVRKYRHAEDQGQPVEVAA* |
| Ga0066675_113054102 | 3300005187 | Soil | GGASPPEAFVHGLTFAMKVSALICFGAAISATVLVRKYRHAEESEQPAELAA* |
| Ga0066388_1073333371 | 3300005332 | Tropical Forest Soil | AARHAGADPAHAFVHGLTFAMRVSALICFGAAIAAALLVRKIRHPAEQTQPLAEAA* |
| Ga0070691_103446373 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | HAFVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA* |
| Ga0070692_104406552 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LGIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAVALIRNYRHAEQAQPLAEAA* |
| Ga0070714_1000559686 | 3300005435 | Agricultural Soil | RAGADPSHAFVHGLTFGMRVSAVICLGGALAAALLIRQYRQADQVQTLAEAA* |
| Ga0070701_101605413 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0066686_109212281 | 3300005446 | Soil | LRAGDDGPHAFVHGLTFGMRVSAVICFGAAIAAAVLVRKYQHAEQAQPLAEAA* |
| Ga0066681_105061621 | 3300005451 | Soil | AFVHGLTFAMRVSAVICLGGAVAAAVLVRKYRHAEQAQPLAEAA* |
| Ga0066681_105107161 | 3300005451 | Soil | DPAHAFVHGLTFAMRVSGLICFGAALAAAVLVRKVRHAEQAQPLAEAA* |
| Ga0070663_1011062101 | 3300005455 | Corn Rhizosphere | GLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA* |
| Ga0070698_1010988441 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0070697_1003522923 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVALGIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0068853_1024122001 | 3300005539 | Corn Rhizosphere | VALGIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0066697_103330041 | 3300005540 | Soil | MRVSALICFGAAVAAALLVRKVRHADEQAQPVAEAA* |
| Ga0070696_1004560883 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RQVGVALGIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0070693_1007254322 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | ITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0066707_109540781 | 3300005556 | Soil | GADPPHAFVHGLTFGMRVSALICLGAAVAAAVLVRKYRHAEQAQPLAEAA* |
| Ga0066706_105944481 | 3300005598 | Soil | AGADPPHAFVHGLTFGMRVSAVICLGGAVAAAALIRKYRYAEQAQPLAEAA* |
| Ga0068856_1008385721 | 3300005614 | Corn Rhizosphere | VYGLTFGMKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA* |
| Ga0068861_1007850072 | 3300005719 | Switchgrass Rhizosphere | GIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0068870_104552572 | 3300005840 | Miscanthus Rhizosphere | MKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA* |
| Ga0068858_1007995583 | 3300005842 | Switchgrass Rhizosphere | FGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0068860_1003890952 | 3300005843 | Switchgrass Rhizosphere | GLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0066696_108839342 | 3300006032 | Soil | GMRVSAAICFGAAIAAAVLVRRYRHAESGQPVEVGA* |
| Ga0075417_102620052 | 3300006049 | Populus Rhizosphere | HGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA* |
| Ga0070715_105895942 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VYGLTFGMKVSAGICFGAAIAAATLVRKYRHAESGQAVEVAA* |
| Ga0097621_1000524981 | 3300006237 | Miscanthus Rhizosphere | LTFGMKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA* |
| Ga0079222_106874921 | 3300006755 | Agricultural Soil | AFVYGLTFGMKVSAAICFAAAVAAATLVRRYRHADASTPVEAAA* |
| Ga0079222_107222552 | 3300006755 | Agricultural Soil | AVVYGLPFGLKVSAGLCFGAAIAAATLVRKYRHAEAGQPVEVGA* |
| Ga0079222_122853321 | 3300006755 | Agricultural Soil | EAYVYGLTVAMKVSAAICFGAAIAAATLVRRYRHAESSAREVEVAA* |
| Ga0079220_106499941 | 3300006806 | Agricultural Soil | PPQAFVHGLTFGMRVSAAICLGAALAAAVLVRQYRHADAEQRRPVAEAA* |
| Ga0075421_1004177763 | 3300006845 | Populus Rhizosphere | LTFAMKVSALICLGGAVAAAVLIRRYRHADSSQPVEVAA* |
| Ga0075425_1006476141 | 3300006854 | Populus Rhizosphere | FVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA* |
| Ga0068865_1006325291 | 3300006881 | Miscanthus Rhizosphere | GMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0075435_1003017591 | 3300007076 | Populus Rhizosphere | FVYGLTYGMKVSAAICFAAAIAAAVLVRKYRHAEDVPALEVAA* |
| Ga0066710_1030216602 | 3300009012 | Grasslands Soil | GLTFGMRVSAVICLGGAVAAAALVRKYRHAEQAQPLAEAA |
| Ga0066710_1033787182 | 3300009012 | Grasslands Soil | MKVSAVICFGAAIAAAALVRKYRHAEEASQPAEIAA |
| Ga0066709_1026837902 | 3300009137 | Grasslands Soil | GLTFGMRVSAVICLGGAVAAAALVRKYRHAEQAQPLAEAA* |
| Ga0105241_101093351 | 3300009174 | Corn Rhizosphere | GMKVSAAICFAAAVAAATLVRRYRHADASTPVEAAA* |
| Ga0105242_101054254 | 3300009176 | Miscanthus Rhizosphere | IAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0105249_104614072 | 3300009553 | Switchgrass Rhizosphere | RAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0134082_100668191 | 3300010303 | Grasslands Soil | VHGLTFGMRVSALICLGAAVAAAVLVRKYRHAEQAQPLAEAA* |
| Ga0134082_101832451 | 3300010303 | Grasslands Soil | DRPHAFVHGLTFAMRVSALICFGAALAAAVLVRKVRHAEQAQPLAEAA* |
| Ga0134065_103921511 | 3300010326 | Grasslands Soil | ARGGASPPEAFVHGLTFAMKVSALICFGAAIAAAVLVRRYRHAEPSEQPVELAA* |
| Ga0134111_100576841 | 3300010329 | Grasslands Soil | REAAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA* |
| Ga0134063_104626062 | 3300010335 | Grasslands Soil | AGDDGPHAFVHGLTFGMRVSAVICFGAAIAAAVLVRKYQHAEQAQPLAEAA* |
| Ga0105239_104692712 | 3300010375 | Corn Rhizosphere | HGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQPQPLAEAA* |
| Ga0134123_134062911 | 3300010403 | Terrestrial Soil | GADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0105246_118108981 | 3300011119 | Miscanthus Rhizosphere | GADPPHAFVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA* |
| Ga0137364_111964692 | 3300012198 | Vadose Zone Soil | VHGLTFAMRVSAAICLGAAIVAATLVRRYRHVEASQPLEAAA* |
| Ga0137387_101013991 | 3300012349 | Vadose Zone Soil | GAFITYREAAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA* |
| Ga0137371_100164552 | 3300012356 | Vadose Zone Soil | MRVSAVICFAAAVAAAALVRKYRHAEQAQPLAEAA* |
| Ga0137361_110223941 | 3300012362 | Vadose Zone Soil | EAAALRAGADPPHAFVHGLTSGMRVSAAICLGGAVVAALLIRQYRQVDQVQPLAEAA* |
| Ga0134047_12572042 | 3300012380 | Grasslands Soil | VVNRAAAAARDGTSPPEAFVHGLTFAMKVSALICFGAAVAAAVLVRKYQHGEASKSKPAELAA* |
| Ga0157330_10872481 | 3300012514 | Soil | AFVHGLTFAMKVSALICLGGAIAAGVLIRRYRHAESSQPVEVAA* |
| Ga0157282_100088413 | 3300012904 | Soil | TFAMKISALICLGGGIAAAALIRRYRHADSSQPVEVAA* |
| Ga0162651_1000708321 | 3300012938 | Soil | PEAFVHGLTFGMKVSAAICLGGAIAAAALVRRYRHAESSQAAEAPA* |
| Ga0164301_118520571 | 3300012960 | Soil | GAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLPEAA* |
| Ga0164309_108319102 | 3300012984 | Soil | LRAGADLPHAFVHGLTVGMRVSAVICLGGAAVAALLIRQYRQADQVQPLAEAA* |
| Ga0164309_109471331 | 3300012984 | Soil | AAGGASPPEAFVPGLTFAMRVSAAICFGAAIIAATLVRRYRHADSSLPLEATA* |
| Ga0164306_102196853 | 3300012988 | Soil | AFVHGLTFGMRVSAVICFGGAIAAATLVRRYRHAEASQPLEAAA* |
| Ga0157371_107838221 | 3300013102 | Corn Rhizosphere | MRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA* |
| Ga0157376_119928951 | 3300014969 | Miscanthus Rhizosphere | ASHGGPAPEAFVYGLTFGMKVSAAICFAAAVAAATLVRRYRHADASTPVEAAA* |
| Ga0134073_100324463 | 3300015356 | Grasslands Soil | AALRAGDDGPHAFVHGLTFGMRVSAVICFGAAIAAAVLVRKYRHAEQAQPLAEAA* |
| Ga0134073_102661681 | 3300015356 | Grasslands Soil | GADQPHAFVHGLTFAMRVSALICFGAALAAAVLVRKVRHAEQAQPLAEAA* |
| Ga0134072_102647352 | 3300015357 | Grasslands Soil | DGLTFAMKVSAGICFAAAIAAAVLVRRYRHAEESGQPVEAAA* |
| Ga0132257_1013241792 | 3300015373 | Arabidopsis Rhizosphere | PPPQAFVYGLTFGLKVSAGICFGAAIAAATLVRKYRHAESGQAVEVAA* |
| Ga0134069_12175261 | 3300017654 | Grasslands Soil | AAAARGGASPPEAFVHGLTFAMKVSALICFGAAIAAAVLVRRYRHAEPSEQPVELAA |
| Ga0137408_12622484 | 3300019789 | Vadose Zone Soil | AARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA |
| Ga0193735_10185271 | 3300020006 | Soil | IAIMGAIIANRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA |
| Ga0179594_101313162 | 3300020170 | Vadose Zone Soil | MRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA |
| Ga0210381_100945922 | 3300021078 | Groundwater Sediment | IMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA |
| Ga0210382_102522581 | 3300021080 | Groundwater Sediment | EAAALRAGDDGPHAFVHGLTFGMRVSAVICLGGALAAAVLVRKYRHAEQAQPLAEAA |
| Ga0210382_105414351 | 3300021080 | Groundwater Sediment | GADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA |
| Ga0193719_100810873 | 3300021344 | Soil | GLTFAMRVSAVICFAGALAAALLVRQYRQADQTQALAEPA |
| Ga0247794_1000011413 | 3300024055 | Soil | LTFAMKISALICLGGAIAAAALIRRYRHADSSQPVEVAA |
| Ga0247672_10717891 | 3300024187 | Soil | LHAGASPQQAFVDGLTFGMRVSAAICLAAAVAAAVLVRRYRHAEEESSRPVEVAA |
| Ga0207642_101528871 | 3300025899 | Miscanthus Rhizosphere | DPPHAFVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA |
| Ga0207699_107838431 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TFGMKVSAGICFGAAIAAATLVRKYRHAESGQAVEVAA |
| Ga0207643_104231991 | 3300025908 | Miscanthus Rhizosphere | MKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA |
| Ga0207646_102119381 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAIITNREAAALRAGADPSHAFVHGLTFGMRVSAVICLGGALAAALLIRQYRQADQVQTLAEAA |
| Ga0207686_100908461 | 3300025934 | Miscanthus Rhizosphere | ADPPHAFVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA |
| Ga0207670_117152041 | 3300025936 | Switchgrass Rhizosphere | GMRVSAVICLGAAVAAATLVRRYRHSEASTPVEAAA |
| Ga0209438_11124871 | 3300026285 | Grasslands Soil | DPPHAFVHGLTFGMRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA |
| Ga0209027_10820711 | 3300026300 | Grasslands Soil | PQAFVYGLTFGMRVSAVICLGAAVAAATLVRRYRHVEESERALEAAA |
| Ga0209153_10956362 | 3300026312 | Soil | TFGMRVSAVICLGGAVAAAALVRNYRHAEEEETRLAEAA |
| Ga0209155_10077498 | 3300026316 | Soil | MRVSALICFGAALAAAVLVRKVRHAEQAQPLAEAA |
| Ga0207507_1039611 | 3300026805 | Soil | LTFGMRVSAVICLGGAVAAAALIRKYRHVEQVQPLAEAA |
| Ga0209998_101809462 | 3300027717 | Arabidopsis Thaliana Rhizosphere | HGLTFAMKISALICLGGAIAAAALIRRYRHADSSQPVEVAA |
| Ga0209382_108133452 | 3300027909 | Populus Rhizosphere | PPEAFVHGLTFAMKVSALICLGGAVAAAVLIRRYRHADSSQPVEVAA |
| Ga0209382_116616261 | 3300027909 | Populus Rhizosphere | EAFVHGLTFAMRVSAAICLGAAIVAATLVRRYRHVEASQPLEAAA |
| Ga0268265_124040681 | 3300028380 | Switchgrass Rhizosphere | PPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA |
| Ga0307295_100134003 | 3300028708 | Soil | ARAGADPPHAFVHGLTFGMRVSAIICLAGALAALALIRKQQPFEQSEALLEAA |
| Ga0307293_101325341 | 3300028711 | Soil | IITNREAAALRGGADPPHAFVHGLTFGMRVSAVICFAGALAAALLVRQYRQADQTQALAEPA |
| Ga0307311_100264832 | 3300028716 | Soil | GMRVSAVICLGGALAAVALIRKYRYAEQAQPLAEAA |
| Ga0307298_101110822 | 3300028717 | Soil | TFGMRVSAAICFGGALAAAILVRRYRHADAGHPVEAAA |
| Ga0307316_101824471 | 3300028755 | Soil | AAAADGASPPQAFVHGLTFGMRVSAVICFGAAIAAATLVRRYRHADASQPLEAAA |
| Ga0307320_102375962 | 3300028771 | Soil | AAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA |
| Ga0307282_101482411 | 3300028784 | Soil | GLTFGMRVSAAICFGGALAAAILVRRYRHADAGHPVEAAA |
| Ga0307305_101733511 | 3300028807 | Soil | PPHAFVHGLTFGMRVSAVICFAGALAAALLVRQYRQADQTQALAEPA |
| Ga0307292_102401971 | 3300028811 | Soil | GLTFGMKVSAAICFGAAIAAAVLVRKYRHAEESSQPVEVAA |
| Ga0247825_110640222 | 3300028812 | Soil | TYAMRVSALICFGAAIVAATLVRRYRHVEASQPVEAAA |
| Ga0307296_100350813 | 3300028819 | Soil | GASPPEAFVHGLTFGMRVSAAICFGGALAAAILVRRYRHADAGHPVEAAA |
| Ga0307296_103101301 | 3300028819 | Soil | GLTYGMRVSAVICLGGALAAALLVRKYRHADQPQPLAEAA |
| Ga0307289_100561263 | 3300028875 | Soil | PPEAFVHGLTFGMRVSAAICFGGALAAAILVRRYRHADAGRPVEAAA |
| Ga0307308_101946822 | 3300028884 | Soil | GVALGIAIMGAIITNREAAAARGGADPPHAFVHGLTFGMRVSAVICLGGALAAAVLVRKYRHAEQAQPLAEAA |
| Ga0307308_103084221 | 3300028884 | Soil | LTFGMRVSAVICFAGALAAALLVRQYRQADQTQALAEPA |
| Ga0268241_100283752 | 3300030511 | Soil | AMRVSALICFGAAIAAAVLVRKVRHAEQQAQPLAEAA |
| Ga0307405_117821642 | 3300031731 | Rhizosphere | SAHEGASPPEAFVHGLTFAMKVSAAICLGAAIAAAVLVRRYRHAESSQPAEAAA |
| Ga0307473_109408322 | 3300031820 | Hardwood Forest Soil | GIAIMGAIITNRVAAALRAGADPSHAFVHGLTFGMRVSAVICLGGALAAALLIRQYRQADQVQTLAEAA |
| Ga0307413_104128171 | 3300031824 | Rhizosphere | SPPEAFVHGLTFAMKVSAVICFGAAIAAAVLVRRYRHAESSQPAEAAA |
| Ga0308174_115603732 | 3300031939 | Soil | LTFGMRVSAVICFGAAVVAATLIRRYRHADASRPVEAEAAA |
| Ga0307409_1006087221 | 3300031995 | Rhizosphere | SQPQAFVDGLTFAMKVSAVICFAAAIAAAVLVRRYRHAEEAQPLEAAA |
| Ga0307409_1024275552 | 3300031995 | Rhizosphere | EGASPPEAFVHGLTFAMKVSAAICLGAAIAAAVLVRRYRHAESSQPAEAAA |
| Ga0307472_1025144001 | 3300032205 | Hardwood Forest Soil | MRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA |
| Ga0310812_101572592 | 3300032421 | Soil | GLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA |
| Ga0334913_037825_9_116 | 3300034172 | Sub-Biocrust Soil | MRVSAAICFCAAIAAAVLVRRYRHVESSHPAEAAA |
| ⦗Top⦘ |