 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F064086 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKQIKLKKIKVEIDKLVTMAEMGLGVVRPLNKEKRGWIAK |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 7.83 % |
| % of genes near scaffold ends (potentially truncated) | 86.82 % |
| % of genes from short scaffolds (< 2000 bps) | 77.52 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (25.581 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.271 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 0.00% Coil/Unstructured: 83.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 42.64 |
| PF07733 | DNA_pol3_alpha | 6.20 |
| PF09834 | DUF2061 | 1.55 |
| PF00731 | AIRC | 0.78 |
| PF02915 | Rubrerythrin | 0.78 |
| PF02195 | ParBc | 0.78 |
| PF05345 | He_PIG | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 42.64 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 6.20 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 6.20 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.67 % |
| All Organisms | root | All Organisms | 33.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.58% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 17.05% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.40% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.08% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.65% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.65% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.10% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.10% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.33% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.55% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.55% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.78% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.78% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.78% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.78% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.78% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.78% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.78% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005597 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF51B | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300013195 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station7_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020278 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556076-ERR599151) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020393 | Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023296 | Saline water microbial communities from Ace Lake, Antarctica - #604 | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025603 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028111 | Seawater microbial communities from Monterey Bay, California, United States - 35D | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031588 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCM | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300031596 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCM | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031625 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surface | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031700 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_surface | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300032151 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_SCM | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_102003021 | 3300000117 | Marine | MKQIEIKKVKIELSKLVTMAEMGLGAERPLNKEKRKWINKLKKDGAW |
| JGI20157J14317_101599431 | 3300001352 | Pelagic Marine | MKQIKLKKIKVDIDKLVTMAEMGLGVVRPLNREKKGWIAKLKKEGE |
| JGI11705J14877_100291395 | 3300001419 | Saline Water And Sediment | MTKIKSIDVEIDRLITLAEIGLGVERPLNKEKRAW |
| JGI24003J15210_100280415 | 3300001460 | Marine | MIVKAIKIKKIKVEISKLVTMAELGLGAVRPLNKEKRTWIAK |
| JGI24003J15210_101500573 | 3300001460 | Marine | MKKIKLKRTLVPIDRLVTMAELGLGAVRPLNKEKRGWINKLK |
| GOS2218_10036473 | 3300001947 | Marine | MPKIKIKKVKVELSKLVTMAEMGLGVERPLNKEKRN |
| GOS2249_10382794 | 3300001951 | Marine | MTKKTKLIRKNIPIDKLVTMAEMGLGVVRPLNKEKRYWINKLAKE |
| Ga0055584_1004865624 | 3300004097 | Pelagic Marine | MKAIKIKKIKVEISKLVTMAEMGLGAVRPLNKEKRTWINK |
| Ga0055584_1024361511 | 3300004097 | Pelagic Marine | MIKIKTINVDLKKLVTMAEMGLGAVRPLNKEKRTWINKLKKQ |
| Ga0066832_100949733 | 3300005597 | Marine | MTKKIKLKRMFVPIDKLVTMAELGLGAKRPLNKEKRGWINKLKKQSEPLD |
| Ga0075443_103867413 | 3300006165 | Marine | MKAIKLKKIKVEISKLVTMAELGLGAVRPLNKEKRTWIAK |
| Ga0068487_10540313 | 3300006315 | Marine | MKRTKKIKLKRMFVPIDKLVTMAELGLGAKRPLNKEKRGWI |
| Ga0099954_12389621 | 3300006350 | Marine | MTKKTKLLRKNVPIDKLVTMAEMGLGVVRPLNKEKRYWINK |
| Ga0098037_10594331 | 3300006737 | Marine | MKAIKIKKIKVEISKLVTMADMGLGVERPLNKEKRSWINKLKKD |
| Ga0070749_101315825 | 3300006802 | Aqueous | MKRIKIKKVQVEIKKLVTMAEMGLGVERPLNKEKRGWI |
| Ga0070746_101557661 | 3300006919 | Aqueous | MKKRIKIKKIKVQINKLVTMADMGLGVERPLNKEKRSWISKLKKQ |
| Ga0098034_10465641 | 3300006927 | Marine | MTKKIKLQRINVPIDKLVTMAELGLGAKRPLNKEKRGWINKLKKQSEP |
| Ga0102960_11064214 | 3300009000 | Pond Water | MKQIKIKKVKVEIDKLVTMAEMGLGVERPLNKEKRGWIAKLKKNG |
| Ga0115552_12992793 | 3300009077 | Pelagic Marine | MKAIKIKKIKVEINKLVTMAEMGLGVERPLNKEKRSWINKLKKEG |
| Ga0114996_113229371 | 3300009173 | Marine | VNKIKIKKIKVEISKLVTMAELGLGVVRPLNKEKRTWIAKLKK |
| Ga0115545_12287811 | 3300009433 | Pelagic Marine | MKKIQIKKVKVLLSKLVTMAEMGLGVERPLNKEKRTWINKLKKDGAW |
| Ga0115554_11137791 | 3300009472 | Pelagic Marine | MKAIKIKKVEVELSKLVTMAEMGLGVERPLNKEKRTWINKLKKD |
| Ga0115571_10094928 | 3300009495 | Pelagic Marine | MKQIKLKKIKVEIDKLVTMAEMGLGVVRPLNKEKRGWIAK* |
| Ga0115002_101485401 | 3300009706 | Marine | MKSIKLKKIKVEIDKLVTMAEMGLGAVRPLNKEKKGWIAKLKKEG |
| Ga0114999_106477583 | 3300009786 | Marine | MKQIKLKKIKVEIDKLVTMAEMGLGAVRPLNKEKKGWIAKLKKEGAW |
| Ga0098056_11785601 | 3300010150 | Marine | MKAIKIKKVTVEIHRLVTMAEMGLGVERPLNKEKRGWINK |
| Ga0163110_104740621 | 3300012928 | Surface Seawater | MTKRIKTKRTFVPIDKLVTMAEMGLGAVRPLNKEKRSW |
| Ga0163110_116291103 | 3300012928 | Surface Seawater | MKKIKLKRTLVPIDKLVTMAELGIGAVRPLNKEKRSWI |
| Ga0163110_117491841 | 3300012928 | Surface Seawater | MKQIKIKKVKVEIDKLVTMAEMGLGVERPLNKEKRGWIAKLKKEGA |
| Ga0116815_10548243 | 3300013195 | Marine | MKQIKKKKVKVEIDKLVTMAEMGLGVERPLNKEKR |
| Ga0182095_10416272 | 3300016791 | Salt Marsh | MKQIKIKKIKVEINKLVTMAEMGLGVERPLNKEKRTWINKLKKDGA |
| Ga0180120_103322101 | 3300017697 | Freshwater To Marine Saline Gradient | MKQIKIKKVKVEIDKLVTMAEMGLGAERPLNKEKRGW |
| Ga0181369_10162011 | 3300017708 | Marine | MPQIKIKKLSVQLSKLVTMAEMGLGVERPLNKEKRTW |
| Ga0181390_10194351 | 3300017719 | Seawater | MKAIKIKKVKVEIHRLVTMAEMGLGVERPLNKEKRGWINKLKKEDA |
| Ga0181383_11766273 | 3300017720 | Seawater | MKAIKIKKIKVEISKLVTMAELGLGAVRPLNKEKRTWIN |
| Ga0181398_10380511 | 3300017725 | Seawater | MKAIKIKKVKVEIDRLVTMAEMGLGVERPLDKEKRGWISK |
| Ga0187218_10578504 | 3300017737 | Seawater | MTKKIALKRIQVPIEKLVTMAELGLGTVRPLNKEKRSWIKKLT |
| Ga0181428_10508053 | 3300017738 | Seawater | MTKKVNLKRISVPIDKLVTMAEMGLGAVRPLNKEK |
| Ga0181397_11696223 | 3300017744 | Seawater | LTKIKLKRIFVPIDKLVTMAELGLGAVRPLNKEKRGWINK |
| Ga0181422_11722353 | 3300017762 | Seawater | MKAIKIKKIKVEISKLVTMAELGLGAVRPLNKEKRTWINKLKKDGVW |
| Ga0181422_12439901 | 3300017762 | Seawater | MTKKVNLKRTSVPIDKLVTMAEMGLGAVRPLNKEK |
| Ga0181406_11339893 | 3300017767 | Seawater | LTKIKLKRIFVPIDKLVTMAELGLGAVRPLNKEKRTWINK |
| Ga0181406_12196271 | 3300017767 | Seawater | MKKIKICKIKVEIGKLVTMADMGLGVERPLNKEKRGWISKLKKDGV |
| Ga0187217_12287643 | 3300017770 | Seawater | LTKIKLKRIFVPIDKLVTMAELGLGAVRPLNKEKRGW |
| Ga0181394_11609992 | 3300017776 | Seawater | VNKIKIKKIKVDIDKLVTMAELGLGAVRPLNKEKRTWINKLKK |
| Ga0181394_12396411 | 3300017776 | Seawater | MKQIKIKKVKVEIDRLVTMAEMGLGVERPLNKEKRTWI |
| Ga0181395_12004662 | 3300017779 | Seawater | MPSKIKIKKVKVQIDKLVTMAEMGLGVERPLNKEKRGWIAKLKKDGA |
| Ga0181395_12323023 | 3300017779 | Seawater | MKAIKIKKIKVEISKLVTMAELGLGAVRPLNKEKRTWINKLKN |
| Ga0181423_10670904 | 3300017781 | Seawater | MKAIKIKKVEVELSKLVTMAEMGLGVERPLNKEKRTWINKLKKDGA |
| Ga0181552_102619003 | 3300017824 | Salt Marsh | MTKKIKLKRIFVPIDRLVTMAELGLGAVRPLNKEKRGWINKLKKQAEPF |
| Ga0181571_104045131 | 3300017957 | Salt Marsh | MSKIVIKKVKVEIRKLVTMAEMGLGVERPLNKEKR |
| Ga0181581_108386321 | 3300017962 | Salt Marsh | MKRIKIKKVKVELSKLVTMAEMGLGVERPLNKEKRT |
| Ga0181590_103151642 | 3300017967 | Salt Marsh | MKPIKIKKVKVELSKLVTMAEMGLGVERPLNKEKRNWINKLKKD |
| Ga0181590_110724173 | 3300017967 | Salt Marsh | MKQIKIKKVKVEIDKLVTMAEMGLGVERPLNKEKRGWI |
| Ga0181600_103158091 | 3300018036 | Salt Marsh | MKRIKIKKVKVELSKLVTMAEMGLGVERPLNKEKRTWINKLKK |
| Ga0181560_102679213 | 3300018413 | Salt Marsh | MKQIKKKKIKVEIDKLVTMAEMGLGVERPLNKEKRGWIA |
| Ga0181567_110112242 | 3300018418 | Salt Marsh | MKQIKIKKVKVEIDRLVTMAEMGLGVERPLNKEKRGWIAKLKKEGAW |
| Ga0181575_103261363 | 3300020055 | Salt Marsh | MKRIKIKKVQVEIKKLVTMAEMGLGVERPLNKEKRGWIAKLKK |
| Ga0206125_101532921 | 3300020165 | Seawater | MKPIKIKKVIVEISKLVTMAEMGLGAVRPLNKEKRTWINK |
| Ga0181597_104461651 | 3300020194 | Salt Marsh | MKQIKIKKVKVEIEKLVTMAEMGLGVERPLNKEKRTWISKLM |
| Ga0211606_10215811 | 3300020278 | Marine | MTKLKIKKLQVPINRLVTMAEMGLGVVRPLNKEKRSW |
| Ga0211504_10937403 | 3300020347 | Marine | MIKIKKIKVEINKLVTMAEMGLGAVRPLNKEKRAWINKLKKE |
| Ga0211652_101058861 | 3300020379 | Marine | MKQIKLKRIQVPIDKLVTMAEMGLGVERPLNKEKRGWINK |
| Ga0211476_102116382 | 3300020381 | Marine | MTKKIKLKRIFIPIDKLVTMAEMGLGASRPLNKEKKGWITK |
| Ga0211677_102369693 | 3300020385 | Marine | MKAIKIKKVKVDIDKLVTMAEMGLGVERPLNKEKRTWI |
| Ga0211618_100895031 | 3300020393 | Marine | MTKKTDIKRTHVPIDKLVTMAELGLGAVRPLNKEKRGWIRK |
| Ga0211532_103753421 | 3300020403 | Marine | MKKIKLKRIWIPIDKLVTMAELGLGAKRPLNKEKSSWIKKLVKQDEPLN |
| Ga0211523_100664102 | 3300020414 | Marine | MKKIKIKKVKVEIDRLVTMAEMGLGVERPLNKEKRGWIAKLKK |
| Ga0211521_100360891 | 3300020428 | Marine | MKKIKVEKCKVEIAKLVTMAEMGLGVERPLNKEKRGWIN |
| Ga0211521_100623781 | 3300020428 | Marine | MKAIKIKKVKVEIKKLVTMAEMGLGVERPLNKEKRGWIN |
| Ga0211521_105046631 | 3300020428 | Marine | MKAIKIKKIKVEISKLVTMAEMGLGVERPLNKEKRTWINKLKKEG |
| Ga0211539_100828741 | 3300020437 | Marine | MPKKIKIKKVKVEIDKLVTMAEMGLGVERPLNKEK |
| Ga0211473_101028733 | 3300020451 | Marine | MAKKIKIKKTQVPIDKLVTMAEMGLGIERPLNKEKRTWINKLKKDGA |
| Ga0211643_104271642 | 3300020457 | Marine | MTKKIRLKRIFVPIDRLVTMAELGLGAVRPLNKEKRGWINKLKKQ |
| Ga0211475_102064541 | 3300020468 | Marine | MKAIKIKKVKVDIDKLVTMAEMGLGVERPLNKEKRTWINKL |
| Ga0211475_104285061 | 3300020468 | Marine | MTKKTKLIRKNVPIDKLVTMAEMGLGVVRPLNKEK |
| Ga0211577_108221923 | 3300020469 | Marine | MKAIKVKKIKVEISKLVTMAELGLGAVRPLNKEKRTW |
| Ga0211547_101791741 | 3300020474 | Marine | MPKKIKLKRTFVPIDKLVTMAEMGLGAVRPLNKEKRGWIS |
| Ga0211547_105024602 | 3300020474 | Marine | MAKKIKIKKTQVPIDKLVTMAEMGLGVERPLNKEKRTW |
| Ga0211541_106561992 | 3300020475 | Marine | MTKKVNLKRTSVRIDKLVTMAEMGLGAVRPLNKEKRAW |
| Ga0213858_105356391 | 3300021356 | Seawater | MKAIKIKKVKVELNKLVTMADMGLGVERPLNKEKKSWINKLKKDGAW |
| Ga0206123_103196241 | 3300021365 | Seawater | MKKTIKITKIKVDIDKLVTMAEMGLGVVRPLNREKKGWIAKLKKEGE |
| Ga0222718_100146431 | 3300021958 | Estuarine Water | MKPIKIKKVKVELSKLVTMAEMGLGVERPLNKEKRTWIN |
| Ga0222718_103700131 | 3300021958 | Estuarine Water | MTKIKIKKVKVDIDRLVTMAEMGLGVERPLNREKRRWINKLKKDG |
| Ga0222716_100485566 | 3300021959 | Estuarine Water | MTKITIKKVKIEIDKLVTMAEMGLGVERPLNKEKRSWINKLKKE |
| Ga0222716_101799931 | 3300021959 | Estuarine Water | MKQIEIKKVKVEINKLVTMAEMGLGVERPLNKEKKTWINKLKKDGA |
| Ga0222715_102445993 | 3300021960 | Estuarine Water | MKAIKIKKVKVELSKLVTMAEMGLGVERPLNKEKRTWI |
| Ga0222719_101204116 | 3300021964 | Estuarine Water | MKQIKLKKIKVEISKLVTMAEMGLGAVRPLNREKKGWIAKLKKEGE |
| Ga0255752_100710135 | 3300022929 | Salt Marsh | MKRIKIKKVQVEIKKLVTMAEMGLGVERPLNKEKRGWIAKLKKEG |
| Ga0255784_101834683 | 3300023108 | Salt Marsh | MKPIKMKKVKVEIDKLVTMAEMGLGVERPLNKEKRGW |
| Ga0222664_10092441 | 3300023296 | Saline Water | MKQIKLKKIKVEISKLVTMAEMGLGVVRPLNREKSG |
| Ga0233396_11344593 | 3300024428 | Seawater | MKAIKIKKIKVEISKLVTMAELGLGAVRPLNKEKRTWINK |
| Ga0209348_10786953 | 3300025127 | Marine | MTKKINIKRISVPIDKLVTMAELGLGAVRPLNKEKRSWINKLKKQD |
| Ga0209232_10432801 | 3300025132 | Marine | MPKKIKLKRTFVPIDKLVTMAEMGLGAVRPLNKEKRGWISTLVKK |
| Ga0209634_10179709 | 3300025138 | Marine | MKQIKLKKIKVEISKLVTMAEMGLGAVRPLNKEKKGWIAK |
| Ga0209645_10927621 | 3300025151 | Marine | MKQTKIERVSVNVDKLVTMAELGLGAERPLNKEKRGWIN |
| Ga0209337_10181489 | 3300025168 | Marine | MKQIKLKKIKVDIDKLVTMAEMGLGVVRPLNKEKKG |
| Ga0208414_11101861 | 3300025603 | Saline Lake | MKQIKLKKIKVEISKLVTMAEMGLGAVRPLNREKKGWIKKLKKE |
| Ga0208134_11703251 | 3300025652 | Aqueous | MKKIQIKKVKVDITKLVTMAEMGLGVERPLNKEKKTWINKLK |
| Ga0209095_12122061 | 3300025685 | Pelagic Marine | MKAIKIKKVKVELSKLVTMAEMGLGVERPLNKEKR |
| Ga0208543_11196632 | 3300025810 | Aqueous | MTKITIKKVKIEIDKLVTMAEMGLGVERPLNKEKRT |
| Ga0208917_12188631 | 3300025840 | Aqueous | MKRIKIKKVQVEIKKLVTMADMGLGVERPLNKEKR |
| Ga0208917_12476193 | 3300025840 | Aqueous | MKAIKIKKVKVEISKLVTMAEMGLGAERPLNKEKRTWINKLKKE |
| Ga0209603_12936883 | 3300025849 | Pelagic Marine | MKAIKIKKVKVELSKLVTMAEMGLGVERPLNKEKRTWINKLK |
| Ga0209309_100044281 | 3300025881 | Pelagic Marine | MKQIKLKKIKVDIDKLVTMAEMGLGVVRPLNKEKRGWI |
| Ga0209631_104874163 | 3300025890 | Pelagic Marine | MKQIKIEKIQVELSKLVTMAEMGLGAERPLNKEKRTWIN |
| Ga0209709_104374963 | 3300027779 | Marine | MKQIKLKKIKVDVNKLVTMAELGLGVVRPLNKEKSGWIK |
| Ga0209091_100223079 | 3300027801 | Marine | MKQIKLKKIKVEIDKLVTMAEMGLGVVRPLNKEKRTWIA |
| Ga0209359_105018361 | 3300027830 | Marine | MTKKIKLKRTQVPIDKLVTMAEMGLGAVRPLNKEKR |
| Ga0209402_100428289 | 3300027847 | Marine | MKQIKLKKIKVEIDKLVTMAEMGLGAVRPLNKEKKG |
| Ga0233397_10667841 | 3300028111 | Seawater | MIMKAIKIKKIKVEISKLVTMAELGLGAVRPLNKEKR |
| Ga0257106_10899933 | 3300028194 | Marine | MKIKIKKIKVEIIKLVTMAEMGLGVERPLNKEKRT |
| Ga0228615_10841751 | 3300028418 | Seawater | LTKIKLKRIFVPIDKLVTMAELGLGAVRPLNKEKRGWI |
| Ga0183755_10023681 | 3300029448 | Marine | MKKIKVKKCKVEIAKLVTMAEMGLGVERPLNKEKRGWINKLKKDGA |
| Ga0307488_102083834 | 3300031519 | Sackhole Brine | MKQIKLKKIKVDIDKLVTMAEMGLGVVRPLNREKKGWIAKLKKE |
| Ga0302137_11505793 | 3300031588 | Marine | MKAIKLKKIKVEISKLVTMAEMGLGAVRPLNREKSGWIAKLK |
| Ga0302137_11736391 | 3300031588 | Marine | MKQIKLKKIKIDISKLVTMAEMGLGVERPLNREKKGWIAKLKKES |
| Ga0302131_10948284 | 3300031594 | Marine | MKQIKLKKIKIDISKLVTMAEMGLGVERPLNREKKGWIAKLKKE |
| Ga0302131_11123921 | 3300031594 | Marine | VNKIKIKKIKVEISKLVTMAELGLGVVRPLNKEKRTWINKLKK |
| Ga0302134_101959461 | 3300031596 | Marine | MKQIKLKKIKVEISKLVTMAEMGLGAVRPLNREKSGWIKKL |
| Ga0302132_101588031 | 3300031605 | Marine | MKQIKLKKIKVEISKLVTMAEMGLGVVRPLNREKS |
| Ga0302114_102610731 | 3300031621 | Marine | VNKIKIKKIKVKVSKLVTMAEMGLGTERPLNKEKRT |
| Ga0302126_101317341 | 3300031622 | Marine | MKQIKLKKIKIDISKLVTMAEMGLGVVRPLNREKKGWIAKL |
| Ga0302135_103000803 | 3300031625 | Marine | MKAIKLKKIKVDIDKLVTMAEMGLGVVRPLNKEKS |
| Ga0302121_102455233 | 3300031626 | Marine | MKVIKLKKIKVDIDKLVTMAEMGLGVVRPLNKEKSGWIKK |
| Ga0302130_12379581 | 3300031700 | Marine | MKQIKIKKIKVEINKLVTMAEMGLGVARPLNKEKKGWIAKLKKE |
| Ga0310343_107896311 | 3300031785 | Seawater | MTKKIKLKRTFVPIEKLITMSEMGLGAMRPLNKEKRGWIRKLVK |
| Ga0302127_101280031 | 3300032151 | Marine | MKQIKLKKIKVEISKLVTMAEMGLGVVRPLNKEKKG |
| Ga0302127_102015151 | 3300032151 | Marine | MKQIKLKKIKVDIDRLVTMAEMGLGAVRPLNKEKRTWINKL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |