| Basic Information | |
|---|---|
| Family ID | F064020 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MPLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASY |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.04 % |
| % of genes near scaffold ends (potentially truncated) | 98.45 % |
| % of genes from short scaffolds (< 2000 bps) | 86.05 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.147 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (7.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.581 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF13354 | Beta-lactamase2 | 10.85 |
| PF00069 | Pkinase | 4.65 |
| PF00582 | Usp | 2.33 |
| PF01624 | MutS_I | 2.33 |
| PF14310 | Fn3-like | 2.33 |
| PF05649 | Peptidase_M13_N | 1.55 |
| PF07732 | Cu-oxidase_3 | 1.55 |
| PF08240 | ADH_N | 1.55 |
| PF13414 | TPR_11 | 1.55 |
| PF07731 | Cu-oxidase_2 | 1.55 |
| PF10067 | DUF2306 | 1.55 |
| PF03544 | TonB_C | 1.55 |
| PF00496 | SBP_bac_5 | 1.55 |
| PF00072 | Response_reg | 1.55 |
| PF11741 | AMIN | 0.78 |
| PF10094 | DUF2332 | 0.78 |
| PF01578 | Cytochrom_C_asm | 0.78 |
| PF05188 | MutS_II | 0.78 |
| PF02518 | HATPase_c | 0.78 |
| PF00933 | Glyco_hydro_3 | 0.78 |
| PF08241 | Methyltransf_11 | 0.78 |
| PF04253 | TFR_dimer | 0.78 |
| PF01676 | Metalloenzyme | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 18.60 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 3.10 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 3.10 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.55 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.15 % |
| Unclassified | root | N/A | 10.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000651|AP72_2010_repI_A10DRAFT_1029571 | Not Available | 703 | Open in IMG/M |
| 3300000789|JGI1027J11758_12122289 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300000953|JGI11615J12901_10224792 | Not Available | 536 | Open in IMG/M |
| 3300001131|JGI12631J13338_1000620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10507 | Open in IMG/M |
| 3300001593|JGI12635J15846_10765138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300004091|Ga0062387_101373375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 561 | Open in IMG/M |
| 3300004091|Ga0062387_101432383 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300004152|Ga0062386_101403253 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300004635|Ga0062388_102330547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300005356|Ga0070674_100381660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1147 | Open in IMG/M |
| 3300005541|Ga0070733_10194974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1323 | Open in IMG/M |
| 3300005561|Ga0066699_11175626 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005568|Ga0066703_10076310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1931 | Open in IMG/M |
| 3300005576|Ga0066708_10258790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1108 | Open in IMG/M |
| 3300005921|Ga0070766_10131705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1513 | Open in IMG/M |
| 3300005921|Ga0070766_11283901 | Not Available | 507 | Open in IMG/M |
| 3300006032|Ga0066696_10080320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1913 | Open in IMG/M |
| 3300006041|Ga0075023_100424664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300006173|Ga0070716_100243109 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300006794|Ga0066658_10012910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3120 | Open in IMG/M |
| 3300006796|Ga0066665_10329079 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300009038|Ga0099829_11688628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300009137|Ga0066709_101299115 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300009521|Ga0116222_1124405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300009522|Ga0116218_1182732 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300009524|Ga0116225_1454603 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300009634|Ga0116124_1140406 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300009646|Ga0116132_1022996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2187 | Open in IMG/M |
| 3300009683|Ga0116224_10232922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 880 | Open in IMG/M |
| 3300009700|Ga0116217_10906685 | Not Available | 541 | Open in IMG/M |
| 3300009709|Ga0116227_11373565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300009762|Ga0116130_1193583 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300009824|Ga0116219_10622379 | Not Available | 593 | Open in IMG/M |
| 3300009824|Ga0116219_10743490 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010046|Ga0126384_11412406 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010048|Ga0126373_11777116 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300010333|Ga0134080_10108174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1149 | Open in IMG/M |
| 3300010341|Ga0074045_10090046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2135 | Open in IMG/M |
| 3300010341|Ga0074045_10625501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300010343|Ga0074044_10191235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1361 | Open in IMG/M |
| 3300010359|Ga0126376_12121532 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300010361|Ga0126378_11246718 | Not Available | 840 | Open in IMG/M |
| 3300010366|Ga0126379_12491987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300010371|Ga0134125_11516031 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010376|Ga0126381_104265603 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010400|Ga0134122_10007440 | All Organisms → cellular organisms → Bacteria | 8143 | Open in IMG/M |
| 3300011269|Ga0137392_10208548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1600 | Open in IMG/M |
| 3300011269|Ga0137392_11060811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300012357|Ga0137384_10921258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300012683|Ga0137398_11074882 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012929|Ga0137404_10232717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1575 | Open in IMG/M |
| 3300014638|Ga0181536_10519500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300015053|Ga0137405_1391958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5933 | Open in IMG/M |
| 3300015077|Ga0173483_10850047 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300015373|Ga0132257_101129443 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300016341|Ga0182035_10179487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1656 | Open in IMG/M |
| 3300017929|Ga0187849_1096099 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300017934|Ga0187803_10182747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 826 | Open in IMG/M |
| 3300017943|Ga0187819_10156865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1354 | Open in IMG/M |
| 3300017959|Ga0187779_10073146 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300017959|Ga0187779_10277695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1066 | Open in IMG/M |
| 3300017961|Ga0187778_10761619 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300017993|Ga0187823_10007027 | All Organisms → cellular organisms → Bacteria | 2609 | Open in IMG/M |
| 3300018012|Ga0187810_10032903 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300018012|Ga0187810_10504837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300018024|Ga0187881_10071840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1617 | Open in IMG/M |
| 3300018035|Ga0187875_10002683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13007 | Open in IMG/M |
| 3300018038|Ga0187855_10308241 | Not Available | 926 | Open in IMG/M |
| 3300018047|Ga0187859_10484333 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300018060|Ga0187765_10601779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300018062|Ga0187784_11090622 | Not Available | 634 | Open in IMG/M |
| 3300018085|Ga0187772_10075567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2125 | Open in IMG/M |
| 3300018088|Ga0187771_10837774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300018088|Ga0187771_11478629 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300019082|Ga0187852_1052726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1886 | Open in IMG/M |
| 3300019268|Ga0181514_1028361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
| 3300019787|Ga0182031_1558169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1968 | Open in IMG/M |
| 3300020580|Ga0210403_10978118 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300020581|Ga0210399_10212893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1609 | Open in IMG/M |
| 3300020583|Ga0210401_11475591 | Not Available | 537 | Open in IMG/M |
| 3300021171|Ga0210405_10953082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300021405|Ga0210387_10801864 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300021478|Ga0210402_10227475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1719 | Open in IMG/M |
| 3300021560|Ga0126371_10224174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1985 | Open in IMG/M |
| 3300025496|Ga0208191_1009419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2808 | Open in IMG/M |
| 3300025507|Ga0208188_1143523 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300025900|Ga0207710_10042132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2027 | Open in IMG/M |
| 3300025911|Ga0207654_10094496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1830 | Open in IMG/M |
| 3300025944|Ga0207661_10040803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3651 | Open in IMG/M |
| 3300026309|Ga0209055_1022048 | All Organisms → cellular organisms → Bacteria | 3043 | Open in IMG/M |
| 3300026309|Ga0209055_1217979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300026998|Ga0208369_1012518 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300027737|Ga0209038_10203544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300027738|Ga0208989_10095854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300027854|Ga0209517_10048209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3254 | Open in IMG/M |
| 3300027854|Ga0209517_10547616 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300027867|Ga0209167_10129784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
| 3300027869|Ga0209579_10687531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300027882|Ga0209590_10906113 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027889|Ga0209380_10121296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1520 | Open in IMG/M |
| 3300027895|Ga0209624_10226500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300028047|Ga0209526_10348400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
| 3300028572|Ga0302152_10241649 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300028788|Ga0302189_10327892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 611 | Open in IMG/M |
| 3300028860|Ga0302199_1110451 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300029817|Ga0247275_1131585 | Not Available | 641 | Open in IMG/M |
| 3300030507|Ga0302192_10133461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1121 | Open in IMG/M |
| 3300030509|Ga0302183_10058231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1532 | Open in IMG/M |
| 3300030618|Ga0311354_11798430 | Not Available | 532 | Open in IMG/M |
| 3300031616|Ga0307508_10922540 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031668|Ga0318542_10486757 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031718|Ga0307474_11057359 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031726|Ga0302321_101455992 | Not Available | 789 | Open in IMG/M |
| 3300031781|Ga0318547_10352566 | Not Available | 899 | Open in IMG/M |
| 3300031797|Ga0318550_10284255 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031902|Ga0302322_103592615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300032075|Ga0310890_10392782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300032076|Ga0306924_10180869 | All Organisms → cellular organisms → Bacteria | 2420 | Open in IMG/M |
| 3300032174|Ga0307470_11303748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300032174|Ga0307470_11634713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300032180|Ga0307471_100163955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2163 | Open in IMG/M |
| 3300032205|Ga0307472_100463968 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300032805|Ga0335078_10065398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5333 | Open in IMG/M |
| 3300032828|Ga0335080_11257643 | Not Available | 741 | Open in IMG/M |
| 3300032829|Ga0335070_10695260 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300032829|Ga0335070_11859891 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300033004|Ga0335084_10960742 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300033405|Ga0326727_10464931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300033433|Ga0326726_10892531 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.75% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.20% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.20% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.65% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.10% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.33% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.55% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.55% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10295712 | 3300000651 | Forest Soil | MSIFWLRIALGLYGFGLLYALVALTRTSDLFNKVALHAAYL |
| JGI1027J11758_121222891 | 3300000789 | Soil | MSLFWLRISLGCYGIGLLYALFALTRTSEWFNRVALHAAYLGMVF |
| JGI11615J12901_102247922 | 3300000953 | Soil | MPILWLRFALMCYSVGLLYALLALTQRSNVLHRIALPAM |
| JGI12631J13338_10006208 | 3300001131 | Forest Soil | MPLIWLRVALACYAAGLLYALVALTRTGEILSKIALHASY |
| JGI12635J15846_107651382 | 3300001593 | Forest Soil | MTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYLGMV |
| Ga0062387_1013733752 | 3300004091 | Bog Forest Soil | MSVLWLRVALGCYAIGLLYALVALTRASDLLNRIALHAAYLGMV |
| Ga0062387_1014323831 | 3300004091 | Bog Forest Soil | MPALWLRVALGCYAIGLLYALVALTRTSDLLSRIALHAAYLGM |
| Ga0062386_1014032532 | 3300004152 | Bog Forest Soil | MMTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALHASY |
| Ga0062388_1023305472 | 3300004635 | Bog Forest Soil | MPALWLRVALCCYAVGLLYALVALTRTSDLLNRIALHAAYLGMV |
| Ga0070674_1003816603 | 3300005356 | Miscanthus Rhizosphere | MSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALHASYLG |
| Ga0070733_101949741 | 3300005541 | Surface Soil | MSVLWLRVALGCYAVGLLYALVALTRAGDLLNRIA |
| Ga0066699_111756261 | 3300005561 | Soil | MSIFWLRVALGFYGVGLLYALVALTRTSDLLNRVALHAAYLG |
| Ga0066703_100763103 | 3300005568 | Soil | MSIFWLRVALGFYGVGLLYALVALTRTSDLLNRVALHA |
| Ga0066708_102587903 | 3300005576 | Soil | MPILWLRVALGCYAVGLLYALLALTRRGPLLNRIALPAM |
| Ga0070766_101317051 | 3300005921 | Soil | MMPLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHA |
| Ga0070766_112839012 | 3300005921 | Soil | MPLIWLRVALVCYAAGLLYALVAFTRTSERLTKVVLHSS |
| Ga0066696_100803202 | 3300006032 | Soil | MPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIA |
| Ga0075023_1004246642 | 3300006041 | Watersheds | MPILWLRVALGFYAVGLLYALLALTRTSALLNRVALP |
| Ga0070716_1002431091 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIFWLRVALGFYGVGLLYALVALTRTSDLLNRVALHAS |
| Ga0066658_100129103 | 3300006794 | Soil | MPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIAL |
| Ga0066665_103290791 | 3300006796 | Soil | MPLLWLRVALGFYGVGLLYALVALTRGSDFLSRIA |
| Ga0099829_116886281 | 3300009038 | Vadose Zone Soil | MSLLWLRVALGCYAVGLLYALVTLTRSSDLLSRLA |
| Ga0066709_1012991153 | 3300009137 | Grasslands Soil | MPILWLRVALGCYAVGLFYALLALTRRGHLLNKIALPA |
| Ga0116222_11244053 | 3300009521 | Peatlands Soil | MMTLIWLRVALVCYAAGLLYALVALTRASEVLSKVALHASYLGM |
| Ga0116218_11827323 | 3300009522 | Peatlands Soil | MPIIWLRVALGCYAVGLLYALVALTRTSDLLNKIAL |
| Ga0116225_14546032 | 3300009524 | Peatlands Soil | MPILWLRVALGFYAVGLLYALVALTRASDLLNKIALHA |
| Ga0116124_11404062 | 3300009634 | Peatland | MMTLIWLRVALVCYAAGLLYALVALTRTSEILGKIA |
| Ga0116132_10229961 | 3300009646 | Peatland | MTLIWLRVALVCYAAGLLYALVALTRTSEVLGKVALH |
| Ga0116224_102329222 | 3300009683 | Peatlands Soil | MPILWLRVALGFYAVGLLYALVALTRSSDLLNKIALH |
| Ga0116217_109066852 | 3300009700 | Peatlands Soil | MMTLIWLRVALVCYAAGLLYALVALTRTSEILGKVAL |
| Ga0116227_113735651 | 3300009709 | Host-Associated | MPILWLRIALCCYAVGLLYALIALTRRAPDVLSKVALHAAYLGMIFQIVSIS |
| Ga0116130_11935832 | 3300009762 | Peatland | MMTLIWLRVALVCYAAGLLYALVALTRTSEILSKVALH |
| Ga0116219_106223792 | 3300009824 | Peatlands Soil | MMTLIWLRVALVFYAAGLLYALVALTRTTEILGKIA |
| Ga0116219_107434901 | 3300009824 | Peatlands Soil | MMTLIWLRVALVCYAAGLLYALVALTRTSEILGKI |
| Ga0126384_114124061 | 3300010046 | Tropical Forest Soil | MPLLWLRVALGCYAVGLIYALVALSRTSDLLGRIALHAAYLGM |
| Ga0126373_117771161 | 3300010048 | Tropical Forest Soil | MSIFWLRVALGLYGVGRRCALVALARTSDLLNRVARHAAYLGMVFHLVS |
| Ga0134080_101081742 | 3300010333 | Grasslands Soil | MPLLWLRVALGCYAIGLLYALLALTQRRYLLNRIALPAM |
| Ga0074045_100900461 | 3300010341 | Bog Forest Soil | MMTLIWLRVALVCYAAGLLYALVALTRTSEILGKIALHSSYLGM |
| Ga0074045_106255012 | 3300010341 | Bog Forest Soil | MMTLIWLRVALVFYAAGLVYALVALTRASEILSKVA |
| Ga0074044_101912351 | 3300010343 | Bog Forest Soil | VALGCYAVGLLYALVALTHFSELLSRIALHAAYLGMVFHLV |
| Ga0126376_121215322 | 3300010359 | Tropical Forest Soil | MPLLWLRVALCFYAVGLLYALLALTRGSELLSRIA |
| Ga0126378_112467181 | 3300010361 | Tropical Forest Soil | MSLVWLRVALLCYTVGLLYALVALTRTSEILSKIALHAAYLGMV |
| Ga0126379_124919871 | 3300010366 | Tropical Forest Soil | VALGCYGVGLIYALVALTRTSELLSKIALHAAYLGM |
| Ga0134125_115160312 | 3300010371 | Terrestrial Soil | VALGCYAVGLLYALLALTRTSSLLNRVALPAMSLG |
| Ga0126381_1042656031 | 3300010376 | Tropical Forest Soil | MSLLWLRVALACYGIGLLYAIFALTRTSEAFHKIALHAAY |
| Ga0134122_100074401 | 3300010400 | Terrestrial Soil | MPILWLRVALCCYAVGLIYALLALTRTSSLLNRVAL |
| Ga0137392_102085482 | 3300011269 | Vadose Zone Soil | MMTVIWLRVALVCYAAGLLYALVALTRTSEILSMVALHASYLGMVF |
| Ga0137392_110608111 | 3300011269 | Vadose Zone Soil | MMTLIWLRVALVCYAAGLLYALVALTRTSEILSMVALHASYLGMVF |
| Ga0137384_109212582 | 3300012357 | Vadose Zone Soil | MPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIALPAMS |
| Ga0137398_110748821 | 3300012683 | Vadose Zone Soil | MMTLIWLRVALTCYAAGLIYALVALTRTSEILSKIALHASYLGMVF |
| Ga0137404_102327171 | 3300012929 | Vadose Zone Soil | MSIFWLRVALGFYGVGLLYALTAITRTSDLLNRVALHASYLGMI |
| Ga0181536_105195002 | 3300014638 | Bog | MMTLIWLRVALVCYAAGLLYALVALTRTSEILGKIALHSSY |
| Ga0137405_139195810 | 3300015053 | Vadose Zone Soil | MPIIWLRVALGFYAIGLLYSLLVLTRKSNALGRIAVPAMT* |
| Ga0173483_108500471 | 3300015077 | Soil | MSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALHASY |
| Ga0132257_1011294431 | 3300015373 | Arabidopsis Rhizosphere | MSLLWLRVALGCYGVRLLYALFALTRTSESFNRVALH |
| Ga0182035_101794871 | 3300016341 | Soil | MSVLWLRVALGCYAVGLLYALVALTRTAELLNRIALHAAYLGMV |
| Ga0187849_10960993 | 3300017929 | Peatland | MMTLIWLRVALVCYAAGLLYALVALTRTSEVLGKV |
| Ga0187803_101827472 | 3300017934 | Freshwater Sediment | MALIWLRVALVFYAVGLLYALVALTRTSEILSKVALH |
| Ga0187819_101568652 | 3300017943 | Freshwater Sediment | MTLTWLRVALVCYAAGLLYALVALTRTSEILSKVALHAS |
| Ga0187779_100731464 | 3300017959 | Tropical Peatland | MSVLWLRVALGCYAVGLLYALVALTRTAELLNRIALH |
| Ga0187779_102776951 | 3300017959 | Tropical Peatland | MTLVWLRVALVCYAAGLLYALVALTRTSETLSKVA |
| Ga0187778_107616191 | 3300017961 | Tropical Peatland | MPVLWLRVALGCYAVGLLYALVALTRSSDLLNRIALHA |
| Ga0187823_100070273 | 3300017993 | Freshwater Sediment | MSIFWLRVALGLYGVGLLYALVALTRTSDLLNKVA |
| Ga0187810_100329031 | 3300018012 | Freshwater Sediment | MPILWLRVALGCYAVGLLYALVALTRTSDLLNKIALH |
| Ga0187810_105048371 | 3300018012 | Freshwater Sediment | MMTLVCLRVALVSYAAGLLYALVALTRTSEILSKVALHA |
| Ga0187881_100718401 | 3300018024 | Peatland | MMTLIWLRVALVCYAAGLLYALVALTRTSEILGKIALHASYLGMVF |
| Ga0187875_100026831 | 3300018035 | Peatland | MTLIWLRVALVFYAVGLLYALVALTRTSEVLGKVALHASY |
| Ga0187855_103082411 | 3300018038 | Peatland | MMTLVWLRVALFCYAAGLLYALVALTRTSEILSKVA |
| Ga0187859_104843331 | 3300018047 | Peatland | MMTLIWLRVALVFYAAGLLYALVALTRTTEILGKIALHASYLG |
| Ga0187765_106017792 | 3300018060 | Tropical Peatland | MSVLWLRVALGCYAVGLLYALVALTRASDLLNRIALHAAYLG |
| Ga0187784_110906221 | 3300018062 | Tropical Peatland | MTLMWLRVALVFYGVGLLYALVALTRTSEILSKLALH |
| Ga0187772_100755671 | 3300018085 | Tropical Peatland | MTLIWLRVALVFYGVGLLYALVALTRTSETLSKLAVHAAY |
| Ga0187771_108377742 | 3300018088 | Tropical Peatland | MPILWLRVALGCYAVGLLYALVALTRSSDLLNRIALHAA |
| Ga0187771_114786291 | 3300018088 | Tropical Peatland | MSILWLRVALGCYAVGLLYALVALTRSSDLLNRIALHAAYLGMVFH |
| Ga0187852_10527261 | 3300019082 | Peatland | MTLIWLRVALVCYAAGLLYALVALTRTSEVLGKVALHASYLGM |
| Ga0181514_10283611 | 3300019268 | Peatland | MPILWLRVALVCYGVGLLYALVALTRATDLLARIALHAAYL |
| Ga0182031_15581694 | 3300019787 | Bog | MMTLVWLRVALVFYAAGLLYALVALARTSSTSETLGKIALHASYSAWCFISFR |
| Ga0210403_109781181 | 3300020580 | Soil | MPILWLRVALGCYAVGLLYALVALTRTSDLLNKIALHAAYLGM |
| Ga0210399_102128933 | 3300020581 | Soil | MPALWLRVALGCYAVGLLYALVALTRTSDLLNRIALH |
| Ga0210401_114755911 | 3300020583 | Soil | MMSLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYL |
| Ga0210405_109530821 | 3300021171 | Soil | MPILWLRVALCFYAVGLLYALLALVRTAGLLNRIALPAMALH |
| Ga0210387_108018641 | 3300021405 | Soil | MPILWLRVALGCYAVGLLYALVALTRASDLLNRIALDAA |
| Ga0210402_102274751 | 3300021478 | Soil | MPILWLRVALGCYAVGLLYALVALTRASDLLNKIALH |
| Ga0126371_102241741 | 3300021560 | Tropical Forest Soil | MPLLWLRVALGCYAVGLIYALVALSRTSDLLGRIALHAAYLGMV |
| Ga0208191_10094194 | 3300025496 | Peatland | MTLIWLRVALVCYAAGLLYALVALTRTSEVLGKVALHASYLGMV |
| Ga0208188_11435232 | 3300025507 | Peatland | MMTLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHAS |
| Ga0207710_100421324 | 3300025900 | Switchgrass Rhizosphere | MSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALHAS |
| Ga0207654_100944961 | 3300025911 | Corn Rhizosphere | MSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALH |
| Ga0207661_100408035 | 3300025944 | Corn Rhizosphere | MPILWLRVALCCYAVGLLYALLALTRTSSLLNRVAL |
| Ga0209055_10220482 | 3300026309 | Soil | MPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIALPA |
| Ga0209055_12179791 | 3300026309 | Soil | MPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIALP |
| Ga0208369_10125183 | 3300026998 | Forest Soil | MSIFWLRVALAFYGVGLLYALIAITRTSDLLNKIALHAA |
| Ga0209038_102035441 | 3300027737 | Bog Forest Soil | MMTLIWLRVALVCYAAGLLYALVALTRTSEILGKVALHASYLGM |
| Ga0208989_100958542 | 3300027738 | Forest Soil | MMTLVWLRVALICYAAGLLYALVALTRASEILSKVALHA |
| Ga0209517_100482091 | 3300027854 | Peatlands Soil | MMTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALHA |
| Ga0209517_105476162 | 3300027854 | Peatlands Soil | MTLIWLRVALVFYGVGLLYALVALTRTTEILSKIALHAA |
| Ga0209167_101297843 | 3300027867 | Surface Soil | MSVLWLRVALGCYAVGLLYALVALTRAGDLLNRIALHAAY |
| Ga0209579_106875311 | 3300027869 | Surface Soil | MPILWLRVALVCYGVGLLYALVALTRATDLLARIALHAAY |
| Ga0209590_109061131 | 3300027882 | Vadose Zone Soil | MSLLWLRVALGCYAVGLLYALVTLTRTSDLLSRIALHAAY |
| Ga0209380_101212963 | 3300027889 | Soil | MPLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASY |
| Ga0209624_102265002 | 3300027895 | Forest Soil | MTLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYLG |
| Ga0209526_103484002 | 3300028047 | Forest Soil | MMTLVWLRVALVCYAAGLLYALVALTRTSEILSKV |
| Ga0302152_102416491 | 3300028572 | Bog | MMTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALH |
| Ga0302189_103278922 | 3300028788 | Bog | MPILWLRIALCCYAVGLLYALIALTRRAPDVLSKVALHAAYLGMIFQIVSISEFA |
| Ga0302199_11104512 | 3300028860 | Bog | MMTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYLGM |
| Ga0247275_11315851 | 3300029817 | Soil | MMTLIWLRVALVCYAAGLLYALVALTRTSEILGKVALHASYLGMV |
| Ga0302192_101334611 | 3300030507 | Bog | MTLVWLRVALVFYAAGLLYALVALTRTSELLGKIALHASY |
| Ga0302183_100582311 | 3300030509 | Palsa | MMTLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYL |
| Ga0311354_117984302 | 3300030618 | Palsa | MTLIWLRVALVCYAAGLVYALVALTRTSEILSKVALH |
| Ga0307508_109225401 | 3300031616 | Ectomycorrhiza | MMTLVWLRVALVCYAAGLLYALVALTRTSEILEKVALHASYLG |
| Ga0318542_104867572 | 3300031668 | Soil | MSVLWLRVALGCYAVGLLYALVALTRTAELLNRIALHAAYL |
| Ga0307474_110573592 | 3300031718 | Hardwood Forest Soil | VRTPIGLTYDMSIFWLRVALGFYGVGLLYALVALTRTSDLFNRVALHAAYL |
| Ga0302321_1014559922 | 3300031726 | Fen | MTLIWLRVALFCYAVGLLYALVALNRTAETLSKVALHAAYLG |
| Ga0318547_103525661 | 3300031781 | Soil | MSLLWLRVALGCYGVGLLYAIFALTRTSETFNKTALHAAYLGMV |
| Ga0318550_102842552 | 3300031797 | Soil | MSIFWLRVALGLYGVGLLYALVALTRTSDLLNRVALHAAYLGMV |
| Ga0302322_1035926151 | 3300031902 | Fen | MPILWLRVALGLYAVGLLYALVALTRTSDLLGKIA |
| Ga0310890_103927821 | 3300032075 | Soil | MSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALHA |
| Ga0306924_101808694 | 3300032076 | Soil | MSLLWLRVALGCYGVGLLYAIFALTRTSETFNKTALHAAYLGM |
| Ga0307470_113037482 | 3300032174 | Hardwood Forest Soil | MPILWLRVALGCYAVGLLYALLALTRTSSLLNRVALPAM |
| Ga0307470_116347131 | 3300032174 | Hardwood Forest Soil | MTLIWLRVALVCYTAGLLYALVALTRTSEILSKVALHAS |
| Ga0307471_1001639554 | 3300032180 | Hardwood Forest Soil | MTLIWLRVALICYAVGLLYALVALTRTSEILSKLALH |
| Ga0307472_1004639681 | 3300032205 | Hardwood Forest Soil | MSIFWLRIALGFYGVGLLYALVAITRTSDLLNRVALHASYLGM |
| Ga0335078_100653981 | 3300032805 | Soil | MPILWLRVALGCYAFGLLYALVALSRSSELLGKIALHAAYL |
| Ga0335080_112576433 | 3300032828 | Soil | MSLIWLRVALVFYGVGLLYALVALTRTSEILSKVALH |
| Ga0335070_106952601 | 3300032829 | Soil | MRTNNMALIWLRVALLCYGVGLLYALVALTRASEILSKVALH |
| Ga0335070_118598912 | 3300032829 | Soil | MTLTWLRVALVFYGVGLLYALVALNRTTETLSKIALHAAYL |
| Ga0335084_109607421 | 3300033004 | Soil | MSIFWLRIALGFYGVGLLYALFAITRSSDLLNRIAL |
| Ga0326727_104649313 | 3300033405 | Peat Soil | MMSLTWLRVALVFYAAGLLYALFALTRTSEILGKVA |
| Ga0326726_108925311 | 3300033433 | Peat Soil | MALIWLRVALVFYGAGLLYALVALTRTSEILSKVALHA |
| ⦗Top⦘ |