NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064020

Metagenome / Metatranscriptome Family F064020

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064020
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 40 residues
Representative Sequence MPLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASY
Number of Associated Samples 117
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 55.04 %
% of genes near scaffold ends (potentially truncated) 98.45 %
% of genes from short scaffolds (< 2000 bps) 86.05 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.147 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(7.752 % of family members)
Environment Ontology (ENVO) Unclassified
(25.581 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.364 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.88%    β-sheet: 0.00%    Coil/Unstructured: 44.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF13354Beta-lactamase2 10.85
PF00069Pkinase 4.65
PF00582Usp 2.33
PF01624MutS_I 2.33
PF14310Fn3-like 2.33
PF05649Peptidase_M13_N 1.55
PF07732Cu-oxidase_3 1.55
PF08240ADH_N 1.55
PF13414TPR_11 1.55
PF07731Cu-oxidase_2 1.55
PF10067DUF2306 1.55
PF03544TonB_C 1.55
PF00496SBP_bac_5 1.55
PF00072Response_reg 1.55
PF11741AMIN 0.78
PF10094DUF2332 0.78
PF01578Cytochrom_C_asm 0.78
PF05188MutS_II 0.78
PF02518HATPase_c 0.78
PF00933Glyco_hydro_3 0.78
PF08241Methyltransf_11 0.78
PF04253TFR_dimer 0.78
PF01676Metalloenzyme 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 18.60
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 3.10
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 3.10
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 1.55
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 1.55
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.15 %
UnclassifiedrootN/A10.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000651|AP72_2010_repI_A10DRAFT_1029571Not Available703Open in IMG/M
3300000789|JGI1027J11758_12122289All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300000953|JGI11615J12901_10224792Not Available536Open in IMG/M
3300001131|JGI12631J13338_1000620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis10507Open in IMG/M
3300001593|JGI12635J15846_10765138All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300004091|Ga0062387_101373375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae561Open in IMG/M
3300004091|Ga0062387_101432383All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300004152|Ga0062386_101403253All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300004635|Ga0062388_102330547All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300005356|Ga0070674_100381660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1147Open in IMG/M
3300005541|Ga0070733_10194974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1323Open in IMG/M
3300005561|Ga0066699_11175626All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005568|Ga0066703_10076310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1931Open in IMG/M
3300005576|Ga0066708_10258790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1108Open in IMG/M
3300005921|Ga0070766_10131705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1513Open in IMG/M
3300005921|Ga0070766_11283901Not Available507Open in IMG/M
3300006032|Ga0066696_10080320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1913Open in IMG/M
3300006041|Ga0075023_100424664All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300006173|Ga0070716_100243109All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300006794|Ga0066658_10012910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3120Open in IMG/M
3300006796|Ga0066665_10329079All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300009038|Ga0099829_11688628All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300009137|Ga0066709_101299115All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300009521|Ga0116222_1124405All Organisms → cellular organisms → Bacteria → Acidobacteria1110Open in IMG/M
3300009522|Ga0116218_1182732All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300009524|Ga0116225_1454603All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300009634|Ga0116124_1140406All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300009646|Ga0116132_1022996All Organisms → cellular organisms → Bacteria → Acidobacteria2187Open in IMG/M
3300009683|Ga0116224_10232922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2880Open in IMG/M
3300009700|Ga0116217_10906685Not Available541Open in IMG/M
3300009709|Ga0116227_11373565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300009762|Ga0116130_1193583All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300009824|Ga0116219_10622379Not Available593Open in IMG/M
3300009824|Ga0116219_10743490All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300010046|Ga0126384_11412406All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300010048|Ga0126373_11777116All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300010333|Ga0134080_10108174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1149Open in IMG/M
3300010341|Ga0074045_10090046All Organisms → cellular organisms → Bacteria → Acidobacteria2135Open in IMG/M
3300010341|Ga0074045_10625501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300010343|Ga0074044_10191235All Organisms → cellular organisms → Bacteria → Acidobacteria1361Open in IMG/M
3300010359|Ga0126376_12121532All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300010361|Ga0126378_11246718Not Available840Open in IMG/M
3300010366|Ga0126379_12491987All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300010371|Ga0134125_11516031All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300010376|Ga0126381_104265603All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300010400|Ga0134122_10007440All Organisms → cellular organisms → Bacteria8143Open in IMG/M
3300011269|Ga0137392_10208548All Organisms → cellular organisms → Bacteria → Acidobacteria1600Open in IMG/M
3300011269|Ga0137392_11060811All Organisms → cellular organisms → Bacteria → Acidobacteria665Open in IMG/M
3300012357|Ga0137384_10921258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300012683|Ga0137398_11074882All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300012929|Ga0137404_10232717All Organisms → cellular organisms → Bacteria → Acidobacteria1575Open in IMG/M
3300014638|Ga0181536_10519500All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300015053|Ga0137405_1391958All Organisms → cellular organisms → Bacteria → Acidobacteria5933Open in IMG/M
3300015077|Ga0173483_10850047All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300015373|Ga0132257_101129443All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300016341|Ga0182035_10179487All Organisms → cellular organisms → Bacteria → Acidobacteria1656Open in IMG/M
3300017929|Ga0187849_1096099All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300017934|Ga0187803_10182747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella826Open in IMG/M
3300017943|Ga0187819_10156865All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1354Open in IMG/M
3300017959|Ga0187779_10073146All Organisms → cellular organisms → Bacteria2027Open in IMG/M
3300017959|Ga0187779_10277695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1066Open in IMG/M
3300017961|Ga0187778_10761619All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300017993|Ga0187823_10007027All Organisms → cellular organisms → Bacteria2609Open in IMG/M
3300018012|Ga0187810_10032903All Organisms → cellular organisms → Bacteria1910Open in IMG/M
3300018012|Ga0187810_10504837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300018024|Ga0187881_10071840All Organisms → cellular organisms → Bacteria → Acidobacteria1617Open in IMG/M
3300018035|Ga0187875_10002683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13007Open in IMG/M
3300018038|Ga0187855_10308241Not Available926Open in IMG/M
3300018047|Ga0187859_10484333All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300018060|Ga0187765_10601779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300018062|Ga0187784_11090622Not Available634Open in IMG/M
3300018085|Ga0187772_10075567All Organisms → cellular organisms → Bacteria → Acidobacteria2125Open in IMG/M
3300018088|Ga0187771_10837774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
3300018088|Ga0187771_11478629All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300019082|Ga0187852_1052726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1886Open in IMG/M
3300019268|Ga0181514_1028361All Organisms → cellular organisms → Bacteria → Acidobacteria1440Open in IMG/M
3300019787|Ga0182031_1558169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1968Open in IMG/M
3300020580|Ga0210403_10978118All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300020581|Ga0210399_10212893All Organisms → cellular organisms → Bacteria → Acidobacteria1609Open in IMG/M
3300020583|Ga0210401_11475591Not Available537Open in IMG/M
3300021171|Ga0210405_10953082All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300021405|Ga0210387_10801864All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300021478|Ga0210402_10227475All Organisms → cellular organisms → Bacteria → Acidobacteria1719Open in IMG/M
3300021560|Ga0126371_10224174All Organisms → cellular organisms → Bacteria → Acidobacteria1985Open in IMG/M
3300025496|Ga0208191_1009419All Organisms → cellular organisms → Bacteria → Acidobacteria2808Open in IMG/M
3300025507|Ga0208188_1143523All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025900|Ga0207710_10042132All Organisms → cellular organisms → Bacteria → Acidobacteria2027Open in IMG/M
3300025911|Ga0207654_10094496All Organisms → cellular organisms → Bacteria → Acidobacteria1830Open in IMG/M
3300025944|Ga0207661_10040803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3651Open in IMG/M
3300026309|Ga0209055_1022048All Organisms → cellular organisms → Bacteria3043Open in IMG/M
3300026309|Ga0209055_1217979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300026998|Ga0208369_1012518All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300027737|Ga0209038_10203544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300027738|Ga0208989_10095854All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1011Open in IMG/M
3300027854|Ga0209517_10048209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3254Open in IMG/M
3300027854|Ga0209517_10547616All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300027867|Ga0209167_10129784All Organisms → cellular organisms → Bacteria → Acidobacteria1310Open in IMG/M
3300027869|Ga0209579_10687531All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300027882|Ga0209590_10906113All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300027889|Ga0209380_10121296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1520Open in IMG/M
3300027895|Ga0209624_10226500All Organisms → cellular organisms → Bacteria → Acidobacteria1243Open in IMG/M
3300028047|Ga0209526_10348400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium993Open in IMG/M
3300028572|Ga0302152_10241649All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300028788|Ga0302189_10327892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium611Open in IMG/M
3300028860|Ga0302199_1110451All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300029817|Ga0247275_1131585Not Available641Open in IMG/M
3300030507|Ga0302192_10133461All Organisms → cellular organisms → Bacteria → Proteobacteria1121Open in IMG/M
3300030509|Ga0302183_10058231All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1532Open in IMG/M
3300030618|Ga0311354_11798430Not Available532Open in IMG/M
3300031616|Ga0307508_10922540All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031668|Ga0318542_10486757All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300031718|Ga0307474_11057359All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300031726|Ga0302321_101455992Not Available789Open in IMG/M
3300031781|Ga0318547_10352566Not Available899Open in IMG/M
3300031797|Ga0318550_10284255All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300031902|Ga0302322_103592615All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300032075|Ga0310890_10392782All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300032076|Ga0306924_10180869All Organisms → cellular organisms → Bacteria2420Open in IMG/M
3300032174|Ga0307470_11303748All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300032174|Ga0307470_11634713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300032180|Ga0307471_100163955All Organisms → cellular organisms → Bacteria → Acidobacteria2163Open in IMG/M
3300032205|Ga0307472_100463968All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300032805|Ga0335078_10065398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5333Open in IMG/M
3300032828|Ga0335080_11257643Not Available741Open in IMG/M
3300032829|Ga0335070_10695260All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300032829|Ga0335070_11859891All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300033004|Ga0335084_10960742All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300033405|Ga0326727_10464931All Organisms → cellular organisms → Bacteria → Acidobacteria1120Open in IMG/M
3300033433|Ga0326726_10892531All Organisms → cellular organisms → Bacteria862Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.75%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.20%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.20%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.43%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.65%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.10%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.88%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.33%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.55%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.55%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.55%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.78%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001131Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026998Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AP72_2010_repI_A10DRAFT_102957123300000651Forest SoilMSIFWLRIALGLYGFGLLYALVALTRTSDLFNKVALHAAYL
JGI1027J11758_1212228913300000789SoilMSLFWLRISLGCYGIGLLYALFALTRTSEWFNRVALHAAYLGMVF
JGI11615J12901_1022479223300000953SoilMPILWLRFALMCYSVGLLYALLALTQRSNVLHRIALPAM
JGI12631J13338_100062083300001131Forest SoilMPLIWLRVALACYAAGLLYALVALTRTGEILSKIALHASY
JGI12635J15846_1076513823300001593Forest SoilMTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYLGMV
Ga0062387_10137337523300004091Bog Forest SoilMSVLWLRVALGCYAIGLLYALVALTRASDLLNRIALHAAYLGMV
Ga0062387_10143238313300004091Bog Forest SoilMPALWLRVALGCYAIGLLYALVALTRTSDLLSRIALHAAYLGM
Ga0062386_10140325323300004152Bog Forest SoilMMTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALHASY
Ga0062388_10233054723300004635Bog Forest SoilMPALWLRVALCCYAVGLLYALVALTRTSDLLNRIALHAAYLGMV
Ga0070674_10038166033300005356Miscanthus RhizosphereMSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALHASYLG
Ga0070733_1019497413300005541Surface SoilMSVLWLRVALGCYAVGLLYALVALTRAGDLLNRIA
Ga0066699_1117562613300005561SoilMSIFWLRVALGFYGVGLLYALVALTRTSDLLNRVALHAAYLG
Ga0066703_1007631033300005568SoilMSIFWLRVALGFYGVGLLYALVALTRTSDLLNRVALHA
Ga0066708_1025879033300005576SoilMPILWLRVALGCYAVGLLYALLALTRRGPLLNRIALPAM
Ga0070766_1013170513300005921SoilMMPLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHA
Ga0070766_1128390123300005921SoilMPLIWLRVALVCYAAGLLYALVAFTRTSERLTKVVLHSS
Ga0066696_1008032023300006032SoilMPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIA
Ga0075023_10042466423300006041WatershedsMPILWLRVALGFYAVGLLYALLALTRTSALLNRVALP
Ga0070716_10024310913300006173Corn, Switchgrass And Miscanthus RhizosphereMSIFWLRVALGFYGVGLLYALVALTRTSDLLNRVALHAS
Ga0066658_1001291033300006794SoilMPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIAL
Ga0066665_1032907913300006796SoilMPLLWLRVALGFYGVGLLYALVALTRGSDFLSRIA
Ga0099829_1168862813300009038Vadose Zone SoilMSLLWLRVALGCYAVGLLYALVTLTRSSDLLSRLA
Ga0066709_10129911533300009137Grasslands SoilMPILWLRVALGCYAVGLFYALLALTRRGHLLNKIALPA
Ga0116222_112440533300009521Peatlands SoilMMTLIWLRVALVCYAAGLLYALVALTRASEVLSKVALHASYLGM
Ga0116218_118273233300009522Peatlands SoilMPIIWLRVALGCYAVGLLYALVALTRTSDLLNKIAL
Ga0116225_145460323300009524Peatlands SoilMPILWLRVALGFYAVGLLYALVALTRASDLLNKIALHA
Ga0116124_114040623300009634PeatlandMMTLIWLRVALVCYAAGLLYALVALTRTSEILGKIA
Ga0116132_102299613300009646PeatlandMTLIWLRVALVCYAAGLLYALVALTRTSEVLGKVALH
Ga0116224_1023292223300009683Peatlands SoilMPILWLRVALGFYAVGLLYALVALTRSSDLLNKIALH
Ga0116217_1090668523300009700Peatlands SoilMMTLIWLRVALVCYAAGLLYALVALTRTSEILGKVAL
Ga0116227_1137356513300009709Host-AssociatedMPILWLRIALCCYAVGLLYALIALTRRAPDVLSKVALHAAYLGMIFQIVSIS
Ga0116130_119358323300009762PeatlandMMTLIWLRVALVCYAAGLLYALVALTRTSEILSKVALH
Ga0116219_1062237923300009824Peatlands SoilMMTLIWLRVALVFYAAGLLYALVALTRTTEILGKIA
Ga0116219_1074349013300009824Peatlands SoilMMTLIWLRVALVCYAAGLLYALVALTRTSEILGKI
Ga0126384_1141240613300010046Tropical Forest SoilMPLLWLRVALGCYAVGLIYALVALSRTSDLLGRIALHAAYLGM
Ga0126373_1177711613300010048Tropical Forest SoilMSIFWLRVALGLYGVGRRCALVALARTSDLLNRVARHAAYLGMVFHLVS
Ga0134080_1010817423300010333Grasslands SoilMPLLWLRVALGCYAIGLLYALLALTQRRYLLNRIALPAM
Ga0074045_1009004613300010341Bog Forest SoilMMTLIWLRVALVCYAAGLLYALVALTRTSEILGKIALHSSYLGM
Ga0074045_1062550123300010341Bog Forest SoilMMTLIWLRVALVFYAAGLVYALVALTRASEILSKVA
Ga0074044_1019123513300010343Bog Forest SoilVALGCYAVGLLYALVALTHFSELLSRIALHAAYLGMVFHLV
Ga0126376_1212153223300010359Tropical Forest SoilMPLLWLRVALCFYAVGLLYALLALTRGSELLSRIA
Ga0126378_1124671813300010361Tropical Forest SoilMSLVWLRVALLCYTVGLLYALVALTRTSEILSKIALHAAYLGMV
Ga0126379_1249198713300010366Tropical Forest SoilVALGCYGVGLIYALVALTRTSELLSKIALHAAYLGM
Ga0134125_1151603123300010371Terrestrial SoilVALGCYAVGLLYALLALTRTSSLLNRVALPAMSLG
Ga0126381_10426560313300010376Tropical Forest SoilMSLLWLRVALACYGIGLLYAIFALTRTSEAFHKIALHAAY
Ga0134122_1000744013300010400Terrestrial SoilMPILWLRVALCCYAVGLIYALLALTRTSSLLNRVAL
Ga0137392_1020854823300011269Vadose Zone SoilMMTVIWLRVALVCYAAGLLYALVALTRTSEILSMVALHASYLGMVF
Ga0137392_1106081113300011269Vadose Zone SoilMMTLIWLRVALVCYAAGLLYALVALTRTSEILSMVALHASYLGMVF
Ga0137384_1092125823300012357Vadose Zone SoilMPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIALPAMS
Ga0137398_1107488213300012683Vadose Zone SoilMMTLIWLRVALTCYAAGLIYALVALTRTSEILSKIALHASYLGMVF
Ga0137404_1023271713300012929Vadose Zone SoilMSIFWLRVALGFYGVGLLYALTAITRTSDLLNRVALHASYLGMI
Ga0181536_1051950023300014638BogMMTLIWLRVALVCYAAGLLYALVALTRTSEILGKIALHSSY
Ga0137405_1391958103300015053Vadose Zone SoilMPIIWLRVALGFYAIGLLYSLLVLTRKSNALGRIAVPAMT*
Ga0173483_1085004713300015077SoilMSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALHASY
Ga0132257_10112944313300015373Arabidopsis RhizosphereMSLLWLRVALGCYGVRLLYALFALTRTSESFNRVALH
Ga0182035_1017948713300016341SoilMSVLWLRVALGCYAVGLLYALVALTRTAELLNRIALHAAYLGMV
Ga0187849_109609933300017929PeatlandMMTLIWLRVALVCYAAGLLYALVALTRTSEVLGKV
Ga0187803_1018274723300017934Freshwater SedimentMALIWLRVALVFYAVGLLYALVALTRTSEILSKVALH
Ga0187819_1015686523300017943Freshwater SedimentMTLTWLRVALVCYAAGLLYALVALTRTSEILSKVALHAS
Ga0187779_1007314643300017959Tropical PeatlandMSVLWLRVALGCYAVGLLYALVALTRTAELLNRIALH
Ga0187779_1027769513300017959Tropical PeatlandMTLVWLRVALVCYAAGLLYALVALTRTSETLSKVA
Ga0187778_1076161913300017961Tropical PeatlandMPVLWLRVALGCYAVGLLYALVALTRSSDLLNRIALHA
Ga0187823_1000702733300017993Freshwater SedimentMSIFWLRVALGLYGVGLLYALVALTRTSDLLNKVA
Ga0187810_1003290313300018012Freshwater SedimentMPILWLRVALGCYAVGLLYALVALTRTSDLLNKIALH
Ga0187810_1050483713300018012Freshwater SedimentMMTLVCLRVALVSYAAGLLYALVALTRTSEILSKVALHA
Ga0187881_1007184013300018024PeatlandMMTLIWLRVALVCYAAGLLYALVALTRTSEILGKIALHASYLGMVF
Ga0187875_1000268313300018035PeatlandMTLIWLRVALVFYAVGLLYALVALTRTSEVLGKVALHASY
Ga0187855_1030824113300018038PeatlandMMTLVWLRVALFCYAAGLLYALVALTRTSEILSKVA
Ga0187859_1048433313300018047PeatlandMMTLIWLRVALVFYAAGLLYALVALTRTTEILGKIALHASYLG
Ga0187765_1060177923300018060Tropical PeatlandMSVLWLRVALGCYAVGLLYALVALTRASDLLNRIALHAAYLG
Ga0187784_1109062213300018062Tropical PeatlandMTLMWLRVALVFYGVGLLYALVALTRTSEILSKLALH
Ga0187772_1007556713300018085Tropical PeatlandMTLIWLRVALVFYGVGLLYALVALTRTSETLSKLAVHAAY
Ga0187771_1083777423300018088Tropical PeatlandMPILWLRVALGCYAVGLLYALVALTRSSDLLNRIALHAA
Ga0187771_1147862913300018088Tropical PeatlandMSILWLRVALGCYAVGLLYALVALTRSSDLLNRIALHAAYLGMVFH
Ga0187852_105272613300019082PeatlandMTLIWLRVALVCYAAGLLYALVALTRTSEVLGKVALHASYLGM
Ga0181514_102836113300019268PeatlandMPILWLRVALVCYGVGLLYALVALTRATDLLARIALHAAYL
Ga0182031_155816943300019787BogMMTLVWLRVALVFYAAGLLYALVALARTSSTSETLGKIALHASYSAWCFISFR
Ga0210403_1097811813300020580SoilMPILWLRVALGCYAVGLLYALVALTRTSDLLNKIALHAAYLGM
Ga0210399_1021289333300020581SoilMPALWLRVALGCYAVGLLYALVALTRTSDLLNRIALH
Ga0210401_1147559113300020583SoilMMSLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYL
Ga0210405_1095308213300021171SoilMPILWLRVALCFYAVGLLYALLALVRTAGLLNRIALPAMALH
Ga0210387_1080186413300021405SoilMPILWLRVALGCYAVGLLYALVALTRASDLLNRIALDAA
Ga0210402_1022747513300021478SoilMPILWLRVALGCYAVGLLYALVALTRASDLLNKIALH
Ga0126371_1022417413300021560Tropical Forest SoilMPLLWLRVALGCYAVGLIYALVALSRTSDLLGRIALHAAYLGMV
Ga0208191_100941943300025496PeatlandMTLIWLRVALVCYAAGLLYALVALTRTSEVLGKVALHASYLGMV
Ga0208188_114352323300025507PeatlandMMTLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHAS
Ga0207710_1004213243300025900Switchgrass RhizosphereMSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALHAS
Ga0207654_1009449613300025911Corn RhizosphereMSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALH
Ga0207661_1004080353300025944Corn RhizosphereMPILWLRVALCCYAVGLLYALLALTRTSSLLNRVAL
Ga0209055_102204823300026309SoilMPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIALPA
Ga0209055_121797913300026309SoilMPLLWLRVALGCYAIGLLYALLALTQRSYLLNRIALP
Ga0208369_101251833300026998Forest SoilMSIFWLRVALAFYGVGLLYALIAITRTSDLLNKIALHAA
Ga0209038_1020354413300027737Bog Forest SoilMMTLIWLRVALVCYAAGLLYALVALTRTSEILGKVALHASYLGM
Ga0208989_1009585423300027738Forest SoilMMTLVWLRVALICYAAGLLYALVALTRASEILSKVALHA
Ga0209517_1004820913300027854Peatlands SoilMMTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALHA
Ga0209517_1054761623300027854Peatlands SoilMTLIWLRVALVFYGVGLLYALVALTRTTEILSKIALHAA
Ga0209167_1012978433300027867Surface SoilMSVLWLRVALGCYAVGLLYALVALTRAGDLLNRIALHAAY
Ga0209579_1068753113300027869Surface SoilMPILWLRVALVCYGVGLLYALVALTRATDLLARIALHAAY
Ga0209590_1090611313300027882Vadose Zone SoilMSLLWLRVALGCYAVGLLYALVTLTRTSDLLSRIALHAAY
Ga0209380_1012129633300027889SoilMPLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASY
Ga0209624_1022650023300027895Forest SoilMTLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYLG
Ga0209526_1034840023300028047Forest SoilMMTLVWLRVALVCYAAGLLYALVALTRTSEILSKV
Ga0302152_1024164913300028572BogMMTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALH
Ga0302189_1032789223300028788BogMPILWLRIALCCYAVGLLYALIALTRRAPDVLSKVALHAAYLGMIFQIVSISEFA
Ga0302199_111045123300028860BogMMTLVWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYLGM
Ga0247275_113158513300029817SoilMMTLIWLRVALVCYAAGLLYALVALTRTSEILGKVALHASYLGMV
Ga0302192_1013346113300030507BogMTLVWLRVALVFYAAGLLYALVALTRTSELLGKIALHASY
Ga0302183_1005823113300030509PalsaMMTLIWLRVALVCYAAGLLYALVALTRTSEILSKVALHASYL
Ga0311354_1179843023300030618PalsaMTLIWLRVALVCYAAGLVYALVALTRTSEILSKVALH
Ga0307508_1092254013300031616EctomycorrhizaMMTLVWLRVALVCYAAGLLYALVALTRTSEILEKVALHASYLG
Ga0318542_1048675723300031668SoilMSVLWLRVALGCYAVGLLYALVALTRTAELLNRIALHAAYL
Ga0307474_1105735923300031718Hardwood Forest SoilVRTPIGLTYDMSIFWLRVALGFYGVGLLYALVALTRTSDLFNRVALHAAYL
Ga0302321_10145599223300031726FenMTLIWLRVALFCYAVGLLYALVALNRTAETLSKVALHAAYLG
Ga0318547_1035256613300031781SoilMSLLWLRVALGCYGVGLLYAIFALTRTSETFNKTALHAAYLGMV
Ga0318550_1028425523300031797SoilMSIFWLRVALGLYGVGLLYALVALTRTSDLLNRVALHAAYLGMV
Ga0302322_10359261513300031902FenMPILWLRVALGLYAVGLLYALVALTRTSDLLGKIA
Ga0310890_1039278213300032075SoilMSLFWLRVALGCYGIGLLYALIALTRSSDILNKIALHA
Ga0306924_1018086943300032076SoilMSLLWLRVALGCYGVGLLYAIFALTRTSETFNKTALHAAYLGM
Ga0307470_1130374823300032174Hardwood Forest SoilMPILWLRVALGCYAVGLLYALLALTRTSSLLNRVALPAM
Ga0307470_1163471313300032174Hardwood Forest SoilMTLIWLRVALVCYTAGLLYALVALTRTSEILSKVALHAS
Ga0307471_10016395543300032180Hardwood Forest SoilMTLIWLRVALICYAVGLLYALVALTRTSEILSKLALH
Ga0307472_10046396813300032205Hardwood Forest SoilMSIFWLRIALGFYGVGLLYALVAITRTSDLLNRVALHASYLGM
Ga0335078_1006539813300032805SoilMPILWLRVALGCYAFGLLYALVALSRSSELLGKIALHAAYL
Ga0335080_1125764333300032828SoilMSLIWLRVALVFYGVGLLYALVALTRTSEILSKVALH
Ga0335070_1069526013300032829SoilMRTNNMALIWLRVALLCYGVGLLYALVALTRASEILSKVALH
Ga0335070_1185989123300032829SoilMTLTWLRVALVFYGVGLLYALVALNRTTETLSKIALHAAYL
Ga0335084_1096074213300033004SoilMSIFWLRIALGFYGVGLLYALFAITRSSDLLNRIAL
Ga0326727_1046493133300033405Peat SoilMMSLTWLRVALVFYAAGLLYALFALTRTSEILGKVA
Ga0326726_1089253113300033433Peat SoilMALIWLRVALVFYGAGLLYALVALTRTSEILSKVALHA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.