NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063997

Metagenome / Metatranscriptome Family F063997

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063997
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 48 residues
Representative Sequence VMRLAPWAPFLNQEETDFFSARVKLGCYVNNVLYEFDYASICVSKK
Number of Associated Samples 120
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.65 %
% of genes near scaffold ends (potentially truncated) 93.80 %
% of genes from short scaffolds (< 2000 bps) 91.47 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(11.628 % of family members)
Environment Ontology (ENVO) Unclassified
(26.357 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.961 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 20.27%    Coil/Unstructured: 79.73%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF00496SBP_bac_5 51.16
PF00196GerE 15.50
PF12911OppC_N 2.33
PF00929RNase_T 0.78
PF00528BPD_transp_1 0.78



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig12354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1476Open in IMG/M
2170459019|G14TP7Y02JBV3YAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10164840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300002568|C688J35102_118126109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300002568|C688J35102_119265358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300005176|Ga0066679_11022370All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300005332|Ga0066388_101629997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1137Open in IMG/M
3300005336|Ga0070680_100216910All Organisms → cellular organisms → Bacteria → Terrabacteria group1615Open in IMG/M
3300005339|Ga0070660_100745634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium822Open in IMG/M
3300005341|Ga0070691_10214833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1016Open in IMG/M
3300005344|Ga0070661_100227453All Organisms → cellular organisms → Bacteria → Terrabacteria group1433Open in IMG/M
3300005344|Ga0070661_101302402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300005366|Ga0070659_100328947All Organisms → cellular organisms → Bacteria → Terrabacteria group1278Open in IMG/M
3300005435|Ga0070714_101822954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300005436|Ga0070713_100606305All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300005436|Ga0070713_101626589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300005447|Ga0066689_10612145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300005450|Ga0066682_10464268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium804Open in IMG/M
3300005530|Ga0070679_100095083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2967Open in IMG/M
3300005556|Ga0066707_10856385All Organisms → cellular organisms → Bacteria → Terrabacteria group559Open in IMG/M
3300005556|Ga0066707_11003481All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005568|Ga0066703_10514303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M
3300005569|Ga0066705_10969584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300005574|Ga0066694_10232084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300005586|Ga0066691_10964014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300005614|Ga0068856_102517750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300005616|Ga0068852_102000530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300005764|Ga0066903_100106523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium3818Open in IMG/M
3300005764|Ga0066903_106395006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300005841|Ga0068863_100059277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. JS6233622Open in IMG/M
3300005898|Ga0075276_10096148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300005905|Ga0075269_10048830All Organisms → cellular organisms → Bacteria → Terrabacteria group730Open in IMG/M
3300006028|Ga0070717_12047251All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300006032|Ga0066696_10787664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300006034|Ga0066656_10499795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium793Open in IMG/M
3300006048|Ga0075363_100901793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300006173|Ga0070716_100929816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300006606|Ga0074062_10023185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300006796|Ga0066665_10653469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium837Open in IMG/M
3300006800|Ga0066660_10024442All Organisms → cellular organisms → Bacteria3600Open in IMG/M
3300006804|Ga0079221_11029418All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300006881|Ga0068865_100367295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1170Open in IMG/M
3300007076|Ga0075435_101239724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300009093|Ga0105240_10185842All Organisms → cellular organisms → Bacteria → Terrabacteria group2448Open in IMG/M
3300009137|Ga0066709_100164668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2860Open in IMG/M
3300009143|Ga0099792_10512170All Organisms → cellular organisms → Bacteria → Terrabacteria group753Open in IMG/M
3300009174|Ga0105241_12671280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300010143|Ga0126322_1005446All Organisms → cellular organisms → Bacteria → Terrabacteria group2000Open in IMG/M
3300010323|Ga0134086_10263494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300010335|Ga0134063_10103652All Organisms → cellular organisms → Bacteria → Terrabacteria group1292Open in IMG/M
3300010337|Ga0134062_10623120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300010358|Ga0126370_12186396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300010361|Ga0126378_11529021All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300010371|Ga0134125_12309407All Organisms → cellular organisms → Bacteria → Terrabacteria group585Open in IMG/M
3300010396|Ga0134126_10178885All Organisms → cellular organisms → Bacteria2552Open in IMG/M
3300010398|Ga0126383_13079423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300010866|Ga0126344_1423509All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300012201|Ga0137365_11126738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300012207|Ga0137381_10176842All Organisms → cellular organisms → Bacteria → Terrabacteria group1845Open in IMG/M
3300012207|Ga0137381_11162456All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012955|Ga0164298_10357833All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300012960|Ga0164301_11686750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300012971|Ga0126369_11116648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium878Open in IMG/M
3300013306|Ga0163162_10886586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1006Open in IMG/M
3300013768|Ga0120155_1046809All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300014166|Ga0134079_10186193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium862Open in IMG/M
3300015372|Ga0132256_102150339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300016294|Ga0182041_10579414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium983Open in IMG/M
3300016357|Ga0182032_11083219All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300017656|Ga0134112_10421058All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300017959|Ga0187779_10240464All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300017959|Ga0187779_10373643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium925Open in IMG/M
3300017961|Ga0187778_10631261All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300017966|Ga0187776_10427529All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300017974|Ga0187777_10495377All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300017994|Ga0187822_10287447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300018001|Ga0187815_10148891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria990Open in IMG/M
3300018060|Ga0187765_10962706All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300018468|Ga0066662_12868363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300020075|Ga0206349_1288944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3259Open in IMG/M
3300020077|Ga0206351_10962173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium712Open in IMG/M
3300021560|Ga0126371_11080490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium942Open in IMG/M
3300024055|Ga0247794_10229187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300024245|Ga0247677_1012822All Organisms → cellular organisms → Bacteria → Terrabacteria group1180Open in IMG/M
3300025916|Ga0207663_10008710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5325Open in IMG/M
3300025919|Ga0207657_10682146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300025927|Ga0207687_10966867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium730Open in IMG/M
3300025928|Ga0207700_11437611All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300025934|Ga0207686_11406772All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300025939|Ga0207665_10878508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300025941|Ga0207711_10470608All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300025941|Ga0207711_11918979All Organisms → cellular organisms → Bacteria → Terrabacteria group535Open in IMG/M
3300026021|Ga0208140_1018356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium987Open in IMG/M
3300026023|Ga0207677_12207230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300026121|Ga0207683_10894868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium824Open in IMG/M
3300026142|Ga0207698_10793745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium948Open in IMG/M
3300026538|Ga0209056_10706217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300026547|Ga0209156_10311493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300027821|Ga0209811_10036380All Organisms → cellular organisms → Bacteria1651Open in IMG/M
3300027857|Ga0209166_10309546All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300027867|Ga0209167_10419167All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300028293|Ga0247662_1052685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300028558|Ga0265326_10060417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1072Open in IMG/M
3300028573|Ga0265334_10187225All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300028881|Ga0307277_10174051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium938Open in IMG/M
3300031057|Ga0170834_105755520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium886Open in IMG/M
3300031231|Ga0170824_121611499All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300031241|Ga0265325_10341647All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300031446|Ga0170820_17112515All Organisms → cellular organisms → Bacteria → Terrabacteria group1745Open in IMG/M
3300031469|Ga0170819_16366603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300031680|Ga0318574_10365493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium842Open in IMG/M
3300031716|Ga0310813_10615503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium962Open in IMG/M
3300031724|Ga0318500_10433693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300031740|Ga0307468_101547450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300031754|Ga0307475_10080712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Defluviimonas → unclassified Defluviimonas → Defluviimonas sp. 20V172507Open in IMG/M
3300031782|Ga0318552_10607778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300031820|Ga0307473_11117689All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300031938|Ga0308175_101501440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium753Open in IMG/M
3300031962|Ga0307479_10507130All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300031996|Ga0308176_10364707All Organisms → cellular organisms → Bacteria → Terrabacteria group1430Open in IMG/M
3300032074|Ga0308173_11809128All Organisms → cellular organisms → Bacteria → Terrabacteria group576Open in IMG/M
3300032094|Ga0318540_10639825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300032421|Ga0310812_10272639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium748Open in IMG/M
3300032770|Ga0335085_11672875All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300032897|Ga0335071_10453874All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300032898|Ga0335072_10339148All Organisms → cellular organisms → Bacteria → Terrabacteria group1654Open in IMG/M
3300033004|Ga0335084_10935183All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300033004|Ga0335084_11675714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300033289|Ga0310914_10974151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium748Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.43%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.10%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.88%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.88%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.33%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.33%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.55%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.55%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.78%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.78%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.78%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005898Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405EnvironmentalOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010143Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026021Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028293Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0354.000015002166559005SimulatedMRLAPWAPFLTREETNFFSARVDLGCYVNNLLYEFDYASICVSKK
4MG_016203202170459019Switchgrass, Maize And Mischanthus LitterREIAKLTRRRGSTRPRDRRWARLDRRVMKLAPGLHSQPEYGLFSERVDLGCYVNNVLYEFDYASICVSKK
AF_2010_repII_A1DRAFT_1016484023300000597Forest SoilLAPWAPFLNQEGTDFFSKRVNLHCYVNNVLYEFDYASICASKK*
C688J35102_11812610923300002568SoilMRLAPWAPFLNQEGTDFFSTRVVLACYVNNVLYEFDYASICVSKK*
C688J35102_11926535813300002568SoilRRVMRRAPWAPFLNQEGTDFFSTRVRLACYVNNVLYEFDYASICLSKK*
Ga0066679_1102237013300005176SoilWAPFLNQEETDFFSPRVELGCYVNSVLYEFDYASICVKK*
Ga0066388_10162999713300005332Tropical Forest SoilVMRLAPWAPFLTREQTNFFGARVDLGCYVNNVLYEFDYASICVSKK*
Ga0070680_10021691023300005336Corn RhizosphereLDRRVMRLAPWAPFLNQEGTDFFSTRVELDCYVNNVLYEFDYASICVSKK*
Ga0070660_10074563413300005339Corn RhizosphereVMRLAPWAPFLNQEETDFFAERVDLGCYVNNVLYEFDYASICVKK*
Ga0070691_1021483323300005341Corn, Switchgrass And Miscanthus RhizosphereRWAAVDKKVMRLAPWAPFLNQEETDFFAERVDLGCYVNNVLYEFDYASICVKK*
Ga0070661_10022745313300005344Corn RhizosphereVDRRWATLDRRVMRLAPWAPFLNQEGTDFFSARVELDCYVNNVLYEFDYASICVSKK*
Ga0070661_10130240223300005344Corn RhizosphereRPTKLTPRVDRRWAALDRRVMRLAPWAPFLNQEGTDFFSTRVVLACYVNNVLYEFDYASICVSKK*
Ga0070659_10032894723300005366Corn RhizosphereLDRRVMRLAPWAPFLNQEGTDFFSTRVVLACYVNNVLYEFDYASICVSKK*
Ga0070714_10182295423300005435Agricultural SoilGWAALDRKVMRFAPWAPFLNQEETDFFSGRVELGCYVNNVLYEFDYASICVKK*
Ga0070713_10060630513300005436Corn, Switchgrass And Miscanthus RhizosphereAPWAPFLNREFTDFFNAKVDLGCYVNQVVYGFDYATICMR*
Ga0070713_10162658913300005436Corn, Switchgrass And Miscanthus RhizosphereRLAPWAPFLNQEGTDFFSTRVDLHCYVNNVLYEFDYASICVSKK*
Ga0066689_1061214523300005447SoilDRSWATLDRKVMRLAPWAPFLDQEATDFFSARVVLGCYVNNVLYEFDYASICVKK*
Ga0066682_1046426823300005450SoilPWAPFLNQEGTDFFNRRVNLNCYVNNVLYEFDYASICVSKK*
Ga0070679_10009508333300005530Corn RhizospherePWAPFLNQEGTDFFSTRVELDCYVNNVLYEFDYASICVSKK*
Ga0066707_1085638513300005556SoilEQWLRLDRKVMKLAPWAPFLNREQIDFFSDRVRLNCYVNNVLYGFDYASICIKKSP*
Ga0066707_1100348123300005556SoilSNQWAALDRRVMRLAPWAPFLNQEGTDFFNRRVNLNCYVNNVLYEFDYASICVSKK*
Ga0066703_1051430313300005568SoilKLTPEVDRSWATLDRKVMRLAPWAPFLDQEATDFFSARVVLGCYVNNVLYEFDYASICVKK*
Ga0066705_1096958413300005569SoilEVDSGWAALDRKVMRLAPWAPFLNQQETDFFSPRVELGCYVNSVLYEFDYASICVKK*
Ga0066694_1023208413300005574SoilALDRRVMRLAPWAPFLNQEGTDFFNRRVNLNCYVNNVLYEFDYASICVSKK*
Ga0066691_1096401423300005586SoilRKVMRFAPWAPFLNQEETDFFSGRVELGCYVNNVLYEFDYASICVKK*
Ga0068856_10251775013300005614Corn RhizosphereSWGALDRKIMRLAPWAPFLTREQTNFFSARVDLGCYVNNLLYEFDYASICVSKK*
Ga0068852_10200053023300005616Corn RhizosphereALDRRVMRLAPWAPFLNQEGTDFFSTRVVLACYVNNVLYEFDYASICVSKK*
Ga0066903_10010652343300005764Tropical Forest SoilWAALDRKVMKLAPWAPFLNGEETDFFSARVKLGCYVNNVLYEFDYASICVKK*
Ga0066903_10639500623300005764Tropical Forest SoilWARLDRRVMRLAPWAPFLNQEGTDFFSRRVDLHCYVNNVLYEFDYASICVSKK*
Ga0068863_10005927713300005841Switchgrass RhizosphereKLVPRVDRRWAALDRRVMRLAPWAPFLNQEGSDFFSSRVRLGCYVNNVLYEFDYAKICVNK*
Ga0075276_1009614823300005898Rice Paddy SoilNQEETDFFGARVVLGCYVNNVLYEFDYASICVRK*
Ga0075269_1004883013300005905Rice Paddy SoilMRLAPWAPFLNQEGTDFFSTRVVLGCYVNNVLYEFDYASICVKK*
Ga0070717_1204725123300006028Corn, Switchgrass And Miscanthus RhizosphereLDRRVMRLAPWAPFLNQEETDFFSSRVDLGCYVNNVLYEFDYARICVSKK*
Ga0066696_1078766413300006032SoilLDRKVMRFAPWAPFLNQEETDFFSGRVELGCYVNNVLYEFDYASICVKK*
Ga0066656_1049979523300006034SoilFLNQEETDFFSPRVELGCYVNSVLYEFDYASICVKK*
Ga0075363_10090179323300006048Populus EndospherePFLNQEGSDFFSSRVRLGCYVNNVLYEFDYASICVNK*
Ga0070716_10092981623300006173Corn, Switchgrass And Miscanthus RhizosphereWAPFLNQEETDFFSARVVLGCYVNNVLYEFDYASICVKK*
Ga0074062_1002318523300006606SoilQQAPWVPFLNQEGTDFFSPRVDLGCYVNNVLYEFDYASICVNK*
Ga0066665_1065346923300006796SoilDRKVMRLAPWAPFLDQEATDFFSARVVLGCYVNNVLYEFDYASICVKK*
Ga0066660_1002444243300006800SoilRLAPWAPFLNQEETDFFSPRVELGCYVNSVLYEFDYASICVKK*
Ga0079221_1102941813300006804Agricultural SoilAPFLNQEQTDFFSARDDLGCYVNNVLYEFDYASICVRKK*
Ga0068865_10036729513300006881Miscanthus RhizosphereRRWAALDRRVMRLAPWAPFLNQEGSDFFSSRVRLGCYVNNVLYEFDYASICVNK*
Ga0075435_10123972423300007076Populus RhizosphereLTPRVDRRWAALDRRVMRLAPWAPFLNQEGSDFFSSRVRLGCYVNNVLYEFDYASICVNK
Ga0105240_1018584213300009093Corn RhizosphereRRVMRLAPWAPFLNQEGTDFFSTRVVLACYVNNVLYEFDYASICVSKK*
Ga0066709_10016466813300009137Grasslands SoilALFLDQEATDFFSARVVLGCYVNNVLYEFDYASICVKK*
Ga0099792_1051217013300009143Vadose Zone SoilMRLAPWAPFLNQEETDFFSTRVNLGCYVNNVLYEFDYASICISKK*
Ga0105241_1267128013300009174Corn RhizosphereRWAALDRRVMRLAPWAPFLNQEGTDFFSTRVVLACYVNNVLYEFDYASICVSKK*
Ga0126322_100544623300010143SoilVMRLAPWAPFLNQEGSDFFSTRVELDCYVNNVLYEFDYARICVSKK*
Ga0134086_1026349413300010323Grasslands SoilRSVSNRWAALDRRVMRLAPWAPFLNQEGTDFFNRRVNLNCYVNNVLYEFDYASICVSKK*
Ga0134063_1010365213300010335Grasslands SoilQTRSVSNRWAALDRRVMRLAPWAPFLNQEGTDFFNRRVNLACYVNNVLYEFDYASICVSKK*
Ga0134062_1062312023300010337Grasslands SoilRSVTNQWAALDRRVMRLAPWAPFLNQEGTDFFNRRVNLNCYVNNVLYEFDYASICVSKK*
Ga0126370_1218639613300010358Tropical Forest SoilQSRLNSRVDDEWATLDRKVMRLAPWAPFLNRDQTDFFSSRVVLGCYVNNVLYEFDYASICVSKK*
Ga0126378_1152902113300010361Tropical Forest SoilALDRRVMRLAPWAPFLNQEETDFFSSRVDLGCYVNNVLYEFDYASICVSKK*
Ga0134125_1230940723300010371Terrestrial SoilAPWAPFLNREQADFFSSRVGLACYVNNVLYEFDYSSICVK*
Ga0134126_1017888533300010396Terrestrial SoilMLQAPWAPFLNREFTDFFNAKVDLGCYVNQVVYGFDYATICMR*
Ga0126383_1307942313300010398Tropical Forest SoilDRRVMRLAPWAPFLNQEGTDFFSRRVDLHCYVNNVLYEFDYASICVSKK*
Ga0126344_142350913300010866Boreal Forest SoilPFLNREFTDFFNAKVDLGCYVNQVVYGFDYSTICMR*
Ga0137365_1112673813300012201Vadose Zone SoilRSAMRRAPWAPFLNQEETDFFSARVVLGCYVNNVLYEFDYAGICVKK*
Ga0137381_1017684213300012207Vadose Zone SoilAALDRNAMRHAPWAPFLNQEETEFFSARVVLRCYVNNVLYEFDYAGICVKK*
Ga0137381_1116245613300012207Vadose Zone SoilAPFLNQEETDFFSPRVELGCYVNSVLYEFDYASICVRK*
Ga0164298_1035783313300012955SoilRLLDRKVMEPAPWAPCLNREEADFFSARVELPCYVNNVLYGFDYATICVRK*
Ga0164301_1168675013300012960SoilKLTPRVDRSWAALDRRVMRLAPWAPFLNQEGTDFFSKRVELGCYVNNVLYEFDYASICVNK*
Ga0126369_1111664823300012971Tropical Forest SoilDRRWARLDRQVMRLAPWAPFLNQEGTDFFSRRVELRCYVNNVLYEFDYARICVNK*
Ga0163162_1088658623300013306Switchgrass RhizosphereRVDRRWAALDRRVMRLAPWAPFLNQEGSDFFSSRVRLGCYVNNVLYEFDYAKICVNK*
Ga0120155_104680923300013768PermafrostMRLAPWAPFLNQEETDFFSARVVLGCYVNNVLYEFDYASICVSKR*
Ga0134079_1018619323300014166Grasslands SoilLAPWAPFLNQEGTDFFNRRVNLACYVNNVLYEFDYASICVSKK*
Ga0132256_10215033913300015372Arabidopsis RhizosphereRRVDRRWARLDRQVMRLAPWAPFLNQEGTDFFSRRVDLGCYVNNVLYGFDYSKICVNK*
Ga0182041_1057941413300016294SoilLNQEGTDFFSRRVDLACYVNNVLYEFDYASICVSKK
Ga0182032_1108321913300016357SoilAPWAPFLNRENVDFFSARVRLQCYVNNVLYGFDYASICVKK
Ga0134112_1042105823300017656Grasslands SoilVNRNQTDFFGSRVDLGCYVNNVLYEFDYASICVVSKK
Ga0187779_1024046433300017959Tropical PeatlandPFLNLKETDYFSARVDLGCYVNNVLYEFDYATICVKKP
Ga0187779_1037364323300017959Tropical PeatlandLTRGIDGRWAALDRKVMRLAPWAPFLNQEETDFFSARVRLRCYVNNVLYEFDYASICVSK
Ga0187778_1063126113300017961Tropical PeatlandRRVMELAPWAPFLNSEGVDFFSARVQLKHHCYVNNVLYGFDYASICVKK
Ga0187776_1042752913300017966Tropical PeatlandIMLQAPWAPFLNREFTDFFNEKVDLGCYVNQVVYGFDYSTICMR
Ga0187777_1049537713300017974Tropical PeatlandVMELAPWAPFLNREEADFFSARVQLQCYVNNVLYGFDYASICVGK
Ga0187822_1028744723300017994Freshwater SedimentWAALDRKVMRLAPWAPFLSLDETDFFSARVVLDCYVNNVLYEFDYASICVSKK
Ga0187815_1014889123300018001Freshwater SedimentDATVMRQAPWAPFLNREFTDFFSRRVDLACYVNQVVYGFDYATICMR
Ga0187765_1096270613300018060Tropical PeatlandALDRRVMQRLAPWAPFLNQEETDFFSSRVNLGCYVNNVLYEFDYASICVRRK
Ga0066662_1286836313300018468Grasslands SoilTLDRKVMRFAPWAPFLNQEETDFFSGRVELGCYVNNVLYEFDYASICVKK
Ga0206349_128894413300020075Corn, Switchgrass And Miscanthus RhizosphereDSWERLDESVMRRAPWAPFLNQEDTDFFSDRVKLGCYVNNVLYEFDYASICVKK
Ga0206351_1096217313300020077Corn, Switchgrass And Miscanthus RhizosphereKKVMRLAPWAPFLNQEETDFFAERVDLGCYVNNVLYEFDYASICVKK
Ga0126371_1108049013300021560Tropical Forest SoilRLAPWAPFLNQEGTDFFSRRVDLHCYVNNVLYEFDYASICVSKK
Ga0247794_1022918723300024055SoilPWAPFLNQEGSDFFSSRVRLGCYVNNVLYEFDYAKICVNK
Ga0247677_101282223300024245SoilLDRRVMRLAPWAPFLNQEETDFFSSRVDLGCYVNNLLYEFDYASICVSKK
Ga0207663_1000871063300025916Corn, Switchgrass And Miscanthus RhizosphereRVSNRWAALDRRVMRLAPWAPFLNQEETDFFSPRVDLGCYVNNLLYEFDYASICVSKK
Ga0207657_1068214613300025919Corn RhizospherePFLNQEETDFFAERVDLGCYVNNVLYEFDYASICVKK
Ga0207687_1096686713300025927Miscanthus RhizosphereDRRVMRLAPWAPFLNQEGSDFFSSRVRLGCYVNNVLYEFDYASICVNK
Ga0207700_1143761123300025928Corn, Switchgrass And Miscanthus RhizosphereLNQEETDFFSSRVDLGCYVNNILYEFDYARICVSKK
Ga0207686_1140677223300025934Miscanthus RhizosphereMELAPWAPFLNRDQVDFFSDRVRLHHCYVNNVLYGFDYASICLKKQP
Ga0207665_1087850823300025939Corn, Switchgrass And Miscanthus RhizospherePKLTPKVNGLWAALDRNAMRRAPWAPFLNQEETDFFSARVVLGCYVNNVLYEFDYASICVKK
Ga0207711_1047060813300025941Switchgrass RhizosphereWRRLDRQVMKLAPWAPFLNRDGTDFFSARVRLHCYVNNVLYGFDYASICLKKQP
Ga0207711_1191897923300025941Switchgrass RhizosphereMRLAPWAPFLTREQTNFFSARVDLGCYVNNLLYEFDYASICVSKK
Ga0208140_101835623300026021Rice Paddy SoilLNQEGTDFFSTRVNLHCYVNNLLYEFDYASICVKK
Ga0207677_1220723013300026023Miscanthus RhizosphereGRWAALDRRVMRLAPWAPFLNQEGTDFFSTRVVLACYVNNVLYEFDYASICVSKK
Ga0207683_1089486813300026121Miscanthus RhizosphereRLAPWAPFLNQEGSDFFSSRVRLGCYVNNVLYEFDYAKICVNK
Ga0207698_1079374523300026142Corn RhizospherePTKLTPRVDRRWAALDRRVMRLAPWAPFLNQEGTDFFSTRVELDCYVNNVLYEFDYASICVSKK
Ga0209056_1070621713300026538SoilLDRKVMRLAPWAPFLDQEATDFFSARVVLGCYVNNVLYEFDYASICVKK
Ga0209156_1031149323300026547SoilPFLNQEETDFFSPRVELGCYVNSVLYEFDYASICVRK
Ga0209811_1003638013300027821Surface SoilTLTPPVDAQWRRLDLQVMKVAPWAPFLNREATDFFSARVQLHCYVNNVLYGFDYASICVK
Ga0209166_1030954623300027857Surface SoilAPWAPFLNPEEVDFFSDRVRLNCYVNNVLYGFDYASICVKKSP
Ga0209167_1041916723300027867Surface SoilDRKVMQLAPWAPFLNREEVDFFSARVRSQCYVNNVLYGFDYASICVK
Ga0247662_105268513300028293SoilRLAPWAPFLNQEETDFFSSRVDLGCYVNNLLYEFDYASICVSKK
Ga0265326_1006041723300028558RhizospherePWAPFLNRQFTDFFSRRVDLACYVNQLVYGFDYATICVR
Ga0265334_1018722523300028573RhizospherePWAPFLNREYTDFFNEKVDLGCYVNHVVYGFDYATICMR
Ga0307277_1017405113300028881SoilPFLNQEGTDFFSTRVRLACYVNNVLYEFDYASICLSKK
Ga0170834_10575552013300031057Forest SoilPFLNQKSTDFFSSRVDLGCYVNNVLYEFDYASICVNK
Ga0170824_12161149923300031231Forest SoilRQIMLQAPWAPFLNREFTDYFNARVDLGCYVNQVVYGFDYSTICMR
Ga0265325_1034164723300031241RhizospherePFLNREYTDFFNEKVDLGCYVNHVVYGFDYATICMR
Ga0170820_1711251513300031446Forest SoilRLAPWVPFLNQEGTDFFSTRVDLACYVNNVLYEFDYASICVNK
Ga0170819_1636660313300031469Forest SoilLDRKIMRLAPWAPFLTREETNFFGARVDLGCYVNNLLYEFDYASICVSKK
Ga0318574_1036549323300031680SoilAPWAPFLNQEGTDFFSRRVDLACYVNNVLYEFDYASICVSKK
Ga0310813_1061550323300031716SoilWAALDRRVMRLAPWAPFLNQEGTDFFSTRVVLACYVNNVLYEFDYASICVSKK
Ga0318500_1043369313300031724SoilLTRSVDRRWARLDRQVMRLAQWAPFLNQEGTDFFSRRVDLACYVNNVLYEFDYASICVSK
Ga0307468_10154745013300031740Hardwood Forest SoilTREQTNFFSARVDLGCYVNNLLYEFDYASICVSKK
Ga0307475_1008071213300031754Hardwood Forest SoilAPWAPFLNREFTDFFNSKVDLGCYVNQVVYGFDYSTICMR
Ga0318552_1060777823300031782SoilDRSWARLDRQVMRLAPWAPFLNQEGTDFFSRRVDLHCYVNNVLYEFDYASICVSKK
Ga0307473_1111768913300031820Hardwood Forest SoilWAPFLNRKQADFFSARVQLQCYVNNLLYGFDYASICVRK
Ga0308175_10150144023300031938SoilWAPFLNQEQTDFFSARVDLGCYVNNLLYELDYSSICVNKK
Ga0307479_1050713013300031962Hardwood Forest SoilMLQAPWAPFLNREFTDFFNEKVEVACYVNQVVYGFDYSTICMR
Ga0308176_1036470713300031996SoilVMRLAPWAPFLNQEETDFFSARVKLGCYVNNVLYEFDYASICVSKK
Ga0308173_1180912813300032074SoilMRLAPWAPFVNQRATNFFSGRVDLGCYVNNVLYEFDYASICVNK
Ga0318540_1063982523300032094SoilMRLAPWAPFLNQEGTDFFSRRVDLACYVNNVLYEFDYASICVSKK
Ga0310812_1027263913300032421SoilTRPTKLTPRVDRRWAALDRRVMRLAPWAPFLNQEGTDFFSTRVVLACYVNNVLYEFDYASICVSKK
Ga0335085_1167287513300032770SoilPFLNREYTDFFNQKVDLGCYANQVVYGFDYATICMR
Ga0335071_1045387413300032897SoilLNQEETDFFSSRVDLGCYVNNVLYEFDYASICVRKK
Ga0335072_1033914813300032898SoilRLDRQVMRLAPWAPFLNQKDTDFFSGRVDLGCYVNNVLYEFDYASVCVNK
Ga0335084_1093518313300033004SoilDRKVMQFAPWAPFLNTEGVDFFSARVQLRCYVDNVLYGFDYASICVKK
Ga0335084_1167571413300033004SoilGIDRRWASLDRKVMRLAPWAPFLNQEETDFFSPRVDLSCYVNNVLYEFDYASICVKQK
Ga0310914_1097415123300033289SoilRQVMRLAPWAPFLNQEGTDFFSRRVDLACYVNNVLYEFDYASICVSKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.