| Basic Information | |
|---|---|
| Family ID | F063990 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPQIETWSRLPAAIRDHLVERMRDRNISLDDLNQLRIWIE |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 30.23 % |
| % of genes near scaffold ends (potentially truncated) | 80.62 % |
| % of genes from short scaffolds (< 2000 bps) | 85.27 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.674 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.302 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.031 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.488 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 5.43 |
| PF04253 | TFR_dimer | 3.10 |
| PF04014 | MazE_antitoxin | 3.10 |
| PF00005 | ABC_tran | 2.33 |
| PF00072 | Response_reg | 1.55 |
| PF13620 | CarboxypepD_reg | 1.55 |
| PF08308 | PEGA | 1.55 |
| PF01053 | Cys_Met_Meta_PP | 1.55 |
| PF13560 | HTH_31 | 0.78 |
| PF04166 | PdxA | 0.78 |
| PF03030 | H_PPase | 0.78 |
| PF13520 | AA_permease_2 | 0.78 |
| PF02786 | CPSase_L_D2 | 0.78 |
| PF04326 | AlbA_2 | 0.78 |
| PF03841 | SelA | 0.78 |
| PF08240 | ADH_N | 0.78 |
| PF01266 | DAO | 0.78 |
| PF06250 | YhcG_C | 0.78 |
| PF00575 | S1 | 0.78 |
| PF05685 | Uma2 | 0.78 |
| PF01351 | RNase_HII | 0.78 |
| PF02776 | TPP_enzyme_N | 0.78 |
| PF03590 | AsnA | 0.78 |
| PF01850 | PIN | 0.78 |
| PF03176 | MMPL | 0.78 |
| PF13515 | FUSC_2 | 0.78 |
| PF07748 | Glyco_hydro_38C | 0.78 |
| PF05496 | RuvB_N | 0.78 |
| PF02201 | SWIB | 0.78 |
| PF14827 | dCache_3 | 0.78 |
| PF02472 | ExbD | 0.78 |
| PF11645 | PDDEXK_5 | 0.78 |
| PF01019 | G_glu_transpept | 0.78 |
| PF00107 | ADH_zinc_N | 0.78 |
| PF01112 | Asparaginase_2 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 2.33 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 1.55 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 1.55 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.55 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 1.55 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 1.55 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.55 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.55 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.55 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 1.55 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
| COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.78 |
| COG4804 | Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 family | General function prediction only [R] | 0.78 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.78 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.78 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.78 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.78 |
| COG2502 | Asparagine synthetase A | Amino acid transport and metabolism [E] | 0.78 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.78 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.78 |
| COG0383 | Alpha-mannosidase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG1995 | 4-hydroxy-L-threonine phosphate dehydrogenase PdxA | Coenzyme transport and metabolism [H] | 0.78 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.78 |
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.78 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.78 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.78 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.67 % |
| Unclassified | root | N/A | 2.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001131|JGI12631J13338_1008467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1516 | Open in IMG/M |
| 3300001175|JGI12649J13570_1023988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300001546|JGI12659J15293_10085824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101257857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10355835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300004080|Ga0062385_10176077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300004080|Ga0062385_10293228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300004080|Ga0062385_10540861 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300004082|Ga0062384_100559304 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300004091|Ga0062387_101273355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300004092|Ga0062389_101579381 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300004152|Ga0062386_101835954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300004468|Ga0068977_1212432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005176|Ga0066679_10539861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300005181|Ga0066678_10037639 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
| 3300005331|Ga0070670_101017028 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005454|Ga0066687_10853728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300005541|Ga0070733_10948961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300005557|Ga0066704_10266723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1162 | Open in IMG/M |
| 3300005921|Ga0070766_10048003 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300005944|Ga0066788_10003391 | All Organisms → cellular organisms → Bacteria | 3136 | Open in IMG/M |
| 3300006052|Ga0075029_100652370 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300006059|Ga0075017_100771030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300006086|Ga0075019_10099561 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300006162|Ga0075030_100020986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5617 | Open in IMG/M |
| 3300006173|Ga0070716_101154234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300006893|Ga0073928_10212472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1506 | Open in IMG/M |
| 3300009137|Ga0066709_103803007 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300009518|Ga0116128_1049797 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300009521|Ga0116222_1185215 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300009621|Ga0116116_1200469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300009631|Ga0116115_1151981 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300009665|Ga0116135_1054424 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300009700|Ga0116217_10128207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1711 | Open in IMG/M |
| 3300010048|Ga0126373_13043352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300010303|Ga0134082_10476602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300010343|Ga0074044_10108935 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300010359|Ga0126376_13187341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300011073|Ga0138584_1069335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300011088|Ga0138576_1010011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300011269|Ga0137392_11596147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300011271|Ga0137393_10185737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1750 | Open in IMG/M |
| 3300012189|Ga0137388_10084430 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
| 3300012189|Ga0137388_12025724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300012199|Ga0137383_11182806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300012207|Ga0137381_10034476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4104 | Open in IMG/M |
| 3300012357|Ga0137384_10118580 | Not Available | 2213 | Open in IMG/M |
| 3300012357|Ga0137384_11473216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300012685|Ga0137397_11184079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300012929|Ga0137404_10851766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300012929|Ga0137404_11337112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012931|Ga0153915_11618052 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300012972|Ga0134077_10005735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3836 | Open in IMG/M |
| 3300014201|Ga0181537_10108140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1896 | Open in IMG/M |
| 3300014499|Ga0182012_10186383 | Not Available | 1466 | Open in IMG/M |
| 3300015241|Ga0137418_10648667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300017659|Ga0134083_10032755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1902 | Open in IMG/M |
| 3300017928|Ga0187806_1357459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300017938|Ga0187854_10097281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1384 | Open in IMG/M |
| 3300017943|Ga0187819_10843142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300017972|Ga0187781_10743198 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300017972|Ga0187781_10855410 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300017974|Ga0187777_10784356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300018008|Ga0187888_1398100 | Not Available | 520 | Open in IMG/M |
| 3300018034|Ga0187863_10665168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300018042|Ga0187871_10203643 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300018042|Ga0187871_10831764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300018047|Ga0187859_10117547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
| 3300018058|Ga0187766_10365862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300018064|Ga0187773_10168511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300018088|Ga0187771_10994941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300020581|Ga0210399_10928964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300020582|Ga0210395_10007911 | All Organisms → cellular organisms → Bacteria | 8037 | Open in IMG/M |
| 3300021178|Ga0210408_11182310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300021181|Ga0210388_11731242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300021403|Ga0210397_10450708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300021407|Ga0210383_10546668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300025412|Ga0208194_1037566 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300025612|Ga0208691_1111480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300025857|Ga0209014_10205137 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300025939|Ga0207665_11085317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300026067|Ga0207678_10387358 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300026538|Ga0209056_10693838 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026869|Ga0207821_1018342 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300027432|Ga0209421_1116914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300027729|Ga0209248_10207401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300027867|Ga0209167_10426172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300027869|Ga0209579_10497886 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027884|Ga0209275_10170182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1164 | Open in IMG/M |
| 3300027895|Ga0209624_10472758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300027898|Ga0209067_10070971 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300027908|Ga0209006_11538913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300027908|Ga0209006_11548874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300027911|Ga0209698_10007192 | All Organisms → cellular organisms → Bacteria | 11724 | Open in IMG/M |
| 3300027911|Ga0209698_10024651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5617 | Open in IMG/M |
| 3300028566|Ga0302147_10193188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300028747|Ga0302219_10012745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3147 | Open in IMG/M |
| 3300028773|Ga0302234_10503610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300029908|Ga0311341_10301199 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300029939|Ga0311328_10029353 | All Organisms → cellular organisms → Bacteria | 5128 | Open in IMG/M |
| 3300029943|Ga0311340_10135152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2619 | Open in IMG/M |
| 3300029944|Ga0311352_11519570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300029987|Ga0311334_11138945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300030007|Ga0311338_11097721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300030043|Ga0302306_10014082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 3402 | Open in IMG/M |
| 3300030494|Ga0310037_10231833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300030659|Ga0316363_10089400 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300030706|Ga0310039_10186221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300030707|Ga0310038_10082740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1717 | Open in IMG/M |
| 3300030998|Ga0073996_12338103 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300031234|Ga0302325_10682963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium LiPW_15 | 1485 | Open in IMG/M |
| 3300031236|Ga0302324_101669452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300031525|Ga0302326_12288911 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300031708|Ga0310686_101942291 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300031708|Ga0310686_107837640 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031718|Ga0307474_10764595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300031753|Ga0307477_10117616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1852 | Open in IMG/M |
| 3300031754|Ga0307475_10487058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300032076|Ga0306924_10667041 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300032160|Ga0311301_11106223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300032163|Ga0315281_10488379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1313 | Open in IMG/M |
| 3300032180|Ga0307471_100124265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2413 | Open in IMG/M |
| 3300032180|Ga0307471_102095601 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300032805|Ga0335078_10180608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2953 | Open in IMG/M |
| 3300032892|Ga0335081_10493032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1544 | Open in IMG/M |
| 3300033158|Ga0335077_12162942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300033233|Ga0334722_10056403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3076 | Open in IMG/M |
| 3300033977|Ga0314861_0065550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1951 | Open in IMG/M |
| 3300034091|Ga0326724_0537988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.30% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.98% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.98% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.20% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.33% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.33% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.78% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12631J13338_10084675 | 3300001131 | Forest Soil | MPQIETWSRLPAAVRAHLVERMHDRKVSLEDLNQLRLWMEGKPQVPEGAW |
| JGI12649J13570_10239882 | 3300001175 | Forest Soil | MPQIETWSRLPAAVRAHLVERMHDRKVSLEDLNQLRLWMEGKPPVPEGAWYKD |
| JGI12659J15293_100858241 | 3300001546 | Forest Soil | MPQIETWSRLPAAVRAHLVERMHDRKVSLEDLNQLRLWMEGKPQVP |
| JGIcombinedJ26739_1012578571 | 3300002245 | Forest Soil | MPQIETWSRLPAALRDHLVERMRDRNVTLQDLNQLRLWMETKPDV |
| JGIcombinedJ51221_103558351 | 3300003505 | Forest Soil | MPQIERWSGLPAAIRDYLVERMHDRNISLDDLNLLRLWMELRPEVPEGPW* |
| Ga0062385_101760773 | 3300004080 | Bog Forest Soil | MPQIEIWSGLPAAIRDHLTERMHDRNISLQDLNQLRVWIDSRPVVPEE |
| Ga0062385_102932282 | 3300004080 | Bog Forest Soil | MPQIETWSRLPAAIRGHLVERMHDRNISVQDLNQLRVWIEAKPIVPE* |
| Ga0062385_105408611 | 3300004080 | Bog Forest Soil | MPQIETWSRLSAALRDHLVERMHQRNVSLQDLNQLRLWME |
| Ga0062384_1005593041 | 3300004082 | Bog Forest Soil | MPQLETWPRIPAAVRDHLVERMHDRNISLDDLNQLRVWLE |
| Ga0062387_1012733552 | 3300004091 | Bog Forest Soil | MPQIETWSRFPAAIRDHLIERMHDRNVGLKDLNQLRAWIESKPNVPVGPWY |
| Ga0062389_1015793811 | 3300004092 | Bog Forest Soil | MPQIETWPRIPAPIRDHLADRMRDRNISLDDLNQLRVWLETRPTVPTGQ |
| Ga0062386_1018359542 | 3300004152 | Bog Forest Soil | MPQIETWPRLPAAVRDHLVKRMHHRNIYLQDLNQLRLWMETKPD |
| Ga0068977_12124321 | 3300004468 | Peatlands Soil | MKIETWSRLPAAIRDHLVERMHDRNIGLEDLNQLRLWMESKP |
| Ga0066679_105398611 | 3300005176 | Soil | MPQLESWPRIPAAIRDHLTERMRDRNISLDDLNQLRIWLETKPTV |
| Ga0066678_100376391 | 3300005181 | Soil | VPQIETWSRLPAAVRDHLVERMRDRNISISDLNQLRIWME |
| Ga0070670_1010170281 | 3300005331 | Switchgrass Rhizosphere | MPQIETWSNLPAAIRDHLVERMKDRKISVADLNQLRVWIETK |
| Ga0066687_108537282 | 3300005454 | Soil | VSSAQIASWSDLPIAIRDHLAERMRDRKISLTDLNQLRIWIESKPDVS |
| Ga0070733_109489611 | 3300005541 | Surface Soil | MPRIETWSRLPAAVRDHLVERMHDRNIGLQDLNHLRLWM |
| Ga0066704_102667233 | 3300005557 | Soil | MPNIETWDNFPRALRNHLIERLRDRRITLQDLNQLRLWNESKPEVPE |
| Ga0070766_100480031 | 3300005921 | Soil | MPQIETWSRLPAAVRAHLVERMHDRKISLEDLNQLRLWMEAKPLVPEGAW |
| Ga0066788_100033914 | 3300005944 | Soil | MPQIETWLRLPAALRKHLVERMHDRNISVDDLNQLRL* |
| Ga0075029_1006523701 | 3300006052 | Watersheds | MPQIESWPRIPAAIRDHLVERMRNRNISLDDLNQLRI* |
| Ga0075017_1007710303 | 3300006059 | Watersheds | MPQIETWSRLPAALREHLVGRMHDRNISLQDLNQRRVWMD |
| Ga0075019_100995611 | 3300006086 | Watersheds | MPQIEAWSRLPVNLRDHLIERMRDRNITLQDLNQLRLWMETKPEVPQG |
| Ga0075030_1000209866 | 3300006162 | Watersheds | MPRIETWSRLPAAVRNHLIERMHDRNIGLADLNQPLDGVKA* |
| Ga0070716_1011542341 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQIETWSRLPAAVRNHLVERMHDRNISLDDLNQLRIWIE |
| Ga0073928_102124723 | 3300006893 | Iron-Sulfur Acid Spring | MPQIETWSRLPAAVRAHLVERMHDRKISLEDLNQLRLWMEAKPQVPAGARGGMVQGLRFV |
| Ga0066709_1038030072 | 3300009137 | Grasslands Soil | VPQIESRSRLPAGIREHLVERMRDRNISLDDLNQLRIWIESK |
| Ga0116128_10497975 | 3300009518 | Peatland | MPQIESWPRFPAAIRDHLIERMRDRNISLDDLNQLR |
| Ga0116222_11852153 | 3300009521 | Peatlands Soil | MSQIETWSRLPAALRNHLVERMRDRNISLHDLNLLRLWMETKPE |
| Ga0116116_12004691 | 3300009621 | Peatland | MPQIEIWPRIPAAIRNHLIERMRDRNISLDDLNQLRVWL |
| Ga0116115_11519813 | 3300009631 | Peatland | MPQIESWPRFPAAIRDHLIERMRDRNISLDDLNQLRVWLETKPIVPT |
| Ga0116135_10544243 | 3300009665 | Peatland | MPQIESWPRFPAAIRDHLIERMRDRNISFDDLNQLRVWL |
| Ga0116217_101282074 | 3300009700 | Peatlands Soil | MKIETWSRLPAAIRAHLVERMHDRNIGLEDLNQLRVWM |
| Ga0126373_130433521 | 3300010048 | Tropical Forest Soil | MPQIETWSRLPAALRAHLIERMHDRKISLDDLNQLRLWMEAKPEVPEGL* |
| Ga0134082_104766021 | 3300010303 | Grasslands Soil | VPQIQSWSRLPRAIRDHLIERMRERRISLDDLNQPRL |
| Ga0074044_101089351 | 3300010343 | Bog Forest Soil | MPQIESWPRIPAPIRNHLIECMRDRKIDLDDLNQLRAWLETKPN |
| Ga0126376_131873412 | 3300010359 | Tropical Forest Soil | MPQIETWSQLPQAIRWHLVERMHDRRIGLDDLNKLRIWMESRPEVPEGPW |
| Ga0138584_10693353 | 3300011073 | Peatlands Soil | MKIETWSRLPAAIRDHLVERMHDRNIGLEDLNQLRLWMESK |
| Ga0138576_10100113 | 3300011088 | Peatlands Soil | MKIETWSRLPAAIRDHLVERMHDRNIGLEDLNQLRVWM |
| Ga0137392_115961472 | 3300011269 | Vadose Zone Soil | MPQIEKWSGLPAALRDHLVERMHGRNISLNDLNQLRLWIESKPEVP |
| Ga0137393_101857371 | 3300011271 | Vadose Zone Soil | VPQIETWSRLPAAVRDHLVERMRDRNISISDLNQLRVWMESKPN |
| Ga0137388_100844303 | 3300012189 | Vadose Zone Soil | MPQIETWSRLPVGIRDHLIERMRDRSVNLEHLNQLRIWIESKPNVP* |
| Ga0137388_120257241 | 3300012189 | Vadose Zone Soil | MPQIESWARIPAAIRDHLVERLPDRNISLDDLNQLRIWLETRP |
| Ga0137383_111828061 | 3300012199 | Vadose Zone Soil | MPQIETWSRLPVGIRDHLIERMRDRSINLEDLNQLRIWIESKPNAPRTLV* |
| Ga0137381_100344761 | 3300012207 | Vadose Zone Soil | MPQIETWSRLPVGIRDHLIERMRDRSINLEDLNQLRIWIESKPNAPEGRWYKD |
| Ga0137384_101185804 | 3300012357 | Vadose Zone Soil | MPQIATWSQLPAGIRDHLVERMRDRKISLEDLNKLRVDGI |
| Ga0137384_114732161 | 3300012357 | Vadose Zone Soil | MPQIETWSKLPAGMRDHLVERMHDRNIGLKDLNQL |
| Ga0137397_111840791 | 3300012685 | Vadose Zone Soil | VPQIETWPRFPAAIRDHLVERMRDRKISLQDLNQLRLWIESRPEVPEEPGTRILA |
| Ga0137404_108517663 | 3300012929 | Vadose Zone Soil | MPQIETWSRLPVGIRDHLIERMRDRSINLEDLNQLRIWIESKPNAPEGRW |
| Ga0137404_113371121 | 3300012929 | Vadose Zone Soil | MRQIERWSQLPPGIRNHLVERMHDRKIGLKDLNQL |
| Ga0153915_116180521 | 3300012931 | Freshwater Wetlands | MAQIETWSRLPHAIRGHLVERMHDRNIGLDDLNHLRVWMESKPEVPE |
| Ga0134077_100057355 | 3300012972 | Grasslands Soil | MPQIETWSRLPVGIRDHLIERMRDRSINLEDLNQLRIWIESKPNAPEG |
| Ga0181537_101081402 | 3300014201 | Bog | MPQIETWSRLPAAIRDHLVERMRDRNISVADLNQLRVWINLKPNVPEGPW* |
| Ga0182012_101863831 | 3300014499 | Bog | VPFIKTWSELPDAIRNHLVERMHDRRISLEDLNLL |
| Ga0137418_106486672 | 3300015241 | Vadose Zone Soil | VPQIETWSQIPAGIRDHLVERMHDRSIGPQDLNQLRIWMEAKPIVREGLRLIQTLR* |
| Ga0134083_100327554 | 3300017659 | Grasslands Soil | MPQIETWSRLPVGIRDHLIERMRDRSINFEDLNQLRIWIES |
| Ga0187806_13574592 | 3300017928 | Freshwater Sediment | MKIETWSRLPRAVRDHLVERMHDRNIGLEDLNQLRLWMESKPDVPDG |
| Ga0187854_100972813 | 3300017938 | Peatland | MPQIEIWPRIPAAIRDHLAERMRDRNISLDDLNQLRIWLETKPI |
| Ga0187819_108431422 | 3300017943 | Freshwater Sediment | MPQIETWSRLPAAVRDHLVERMHDRKIGPEDLNQLRVWMES |
| Ga0187781_107431981 | 3300017972 | Tropical Peatland | MAQIETWSRLPPALRDHIVERMRDRNISLADLNLLRL |
| Ga0187781_108554103 | 3300017972 | Tropical Peatland | MPHIESWPRIPASIRDHLVERMRDRNIGLDDLNQLRLWLESHP |
| Ga0187777_107843561 | 3300017974 | Tropical Peatland | MPQIETWSRLPAAVRDHLVERMHDRNIGLQDLNLLRVWME |
| Ga0187888_13981002 | 3300018008 | Peatland | MPQIERWSGLPLALRDHLVERMHNRNISLRDLNLLRRCMDS |
| Ga0187863_106651683 | 3300018034 | Peatland | MAQIETWSRLPRAVRDHLVERMRDRNIGLEDLNQLRLWME |
| Ga0187871_102036431 | 3300018042 | Peatland | MPKIQTWDNLPVAARYHLVERMRDRSISLQDLNQLRLW |
| Ga0187871_108317642 | 3300018042 | Peatland | MPQIEVWSRLPAAIRHHLVERMRDRNVSLEDLNQLRLWMES |
| Ga0187859_101175473 | 3300018047 | Peatland | MPQIETWSRLPAAIRDHLVERMRDRNISVADLNQLRVWINLKPNVPEGPW |
| Ga0187766_103658623 | 3300018058 | Tropical Peatland | MPQIETWSRLPAALRDHLVERMHQRNISLHDLNQLRLWIET |
| Ga0187773_101685113 | 3300018064 | Tropical Peatland | MPQIETWSRLPTAVRDHLIERMRDRNIGLDDLNQLRLWMES |
| Ga0187771_109949411 | 3300018088 | Tropical Peatland | MPQIESWSRLPVALREHLVERMHDRKISLTDLNQLRLWI |
| Ga0210399_109289641 | 3300020581 | Soil | MPQIETWSRLPAAVRAHLVERMHDRKISLEDLNQLRLWM |
| Ga0210395_1000791113 | 3300020582 | Soil | MPQIERWSGLPAAIRDYLVERMHDRNISLDDLNLLRLW |
| Ga0210408_111823101 | 3300021178 | Soil | MKIETWSRLPSAVRDHLVERMHDRNIGFEDLNQLRLWVESKPDVP |
| Ga0210388_117312421 | 3300021181 | Soil | MKIEPWSRLPRAVRDHLVERMHDRHIGLEDLNQLRLWMES |
| Ga0210397_104507081 | 3300021403 | Soil | MPQIETWSRLPAAVRAHLVERMHDRKISLEDLNQLRLWKEAKPLVPEGAWYNFGS |
| Ga0210383_105466681 | 3300021407 | Soil | MPQIERWSGLPAAVRDHLVERMHDRHIGVADLNQLRLWMES |
| Ga0208194_10375663 | 3300025412 | Peatland | MPQIESWPRFPAAIRDHLIERMRDRNISLDDLNQLRVWLETKPI |
| Ga0208691_11114801 | 3300025612 | Peatland | MPQIETWSGLLAAVRDHLVERMHNRYIGLADLNQLRLWMESNPEVPEG |
| Ga0209014_102051373 | 3300025857 | Arctic Peat Soil | MPQIETWDNLPAAVRRHLVERMRDRSIGIADLNQLRLWI |
| Ga0207665_110853171 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQIETWSRLPAAVRNHLVERMHDRNISLDDLNQLRIWIESKPNVAEGR |
| Ga0207678_103873581 | 3300026067 | Corn Rhizosphere | MPQIETWSNLPAAIRSHLVERMKDRNISVADLNQLRVWIETKPEVPAG |
| Ga0209056_106938381 | 3300026538 | Soil | VPQIETWSRLPAAVRDHLVERMRDRNISISDLNQLRIWMESKPNVPEG |
| Ga0207821_10183423 | 3300026869 | Tropical Forest Soil | MPQIETWSGLPVALRNHLMERMRDRNISVADLNQLRLWMETKPNVPE |
| Ga0209421_11169141 | 3300027432 | Forest Soil | MPQIETWSRLSVGLREHLVKRMHDRNISVDDLNQLRLWMETKPEV |
| Ga0209248_102074012 | 3300027729 | Bog Forest Soil | MPQIETWSRLPAAIRGHLVERMHDRNISVQDLNQLRVWIEAKPIVPE |
| Ga0209167_104261723 | 3300027867 | Surface Soil | MPRIETWSRLPAAVRDHLVERMHDRNIGLQDLNHLRLWMETKPDVPE |
| Ga0209579_104978862 | 3300027869 | Surface Soil | MPQIETWSRLPTAIREHLVDRMRDRNISLDHLNQLRLWIESKPNVPEGP |
| Ga0209275_101701821 | 3300027884 | Soil | MPQIETWSHLPAAVRAHLVERMHDRKISLEDLNQLRL |
| Ga0209624_104727582 | 3300027895 | Forest Soil | MPQIETWSRLPPAIRSHLVERMHDRNISIEDLNQLRLWIES |
| Ga0209067_100709713 | 3300027898 | Watersheds | MPQIEAWSRLPVNLRDHLIERMRDRNITLQDLNQLRLWMETKPEVPQGRWYK |
| Ga0209006_115389132 | 3300027908 | Forest Soil | MPQIETWSRLPAAVRAHLVERMHDRKIGLEDLNHLRLWMEAKP |
| Ga0209006_115488741 | 3300027908 | Forest Soil | MPKIETWARLPAAVRNHLIERMHDRNIGLSDLNQLRL |
| Ga0209698_100071926 | 3300027911 | Watersheds | MPQIESWPRIPAAIRDHLVERMRNRNISLDDLNQLRI |
| Ga0209698_100246515 | 3300027911 | Watersheds | MPRIETWSRLPAAVRNHLIERMHDRNIGLADLNQPLDGVKA |
| Ga0302147_101931882 | 3300028566 | Bog | MPQIETWWGLPAAVRDHLVERMHDRYIGLADLNQLRLWMESKPEVPEGP |
| Ga0302219_100127454 | 3300028747 | Palsa | MPQIETWSRLPAAVRDHLVERMRDRNISVEDLNQLRVWIESKPIVPEGP |
| Ga0302234_105036101 | 3300028773 | Palsa | MPQIETWSRLPAAVRDHLVERMRDRNISVEDLNQL |
| Ga0311341_103011991 | 3300029908 | Bog | VPFIKTWSELPDAIRNHLVERMHDRRISLEDLNLLRRWIESKPD |
| Ga0311328_100293531 | 3300029939 | Bog | MPQIETWWGLPAAVRDHLVERMHDRYIGLADLNQLRLWMESKPEVPEGPW |
| Ga0311340_101351524 | 3300029943 | Palsa | MPQIETWSRLPAAVRDHLVERMRDRNISVEDLNQLRVWIESKPIVPEG |
| Ga0311352_115195701 | 3300029944 | Palsa | MPQIEAWSRLPAAVRAHLVERMHGRKIRLEDLNQLRLWMEAKPQVPEG |
| Ga0311334_111389451 | 3300029987 | Fen | MPRIETWSRLPAAVRAHLVERMHDRKISLEDLNQLRL |
| Ga0311338_110977212 | 3300030007 | Palsa | WSRLPAAVRDHLVERMRDRNISVEDLNQLRVWIESKPIVPEGP |
| Ga0302306_100140821 | 3300030043 | Palsa | MPQIETWSRLPAAVRDHLVERMRDRNISVEDLNQLRVWIESKPIV |
| Ga0310037_102318333 | 3300030494 | Peatlands Soil | MKIETWSRLPRAVRDHLVERMHDRNIGLEDLNQLRLWMESNPDVPEGP |
| Ga0316363_100894001 | 3300030659 | Peatlands Soil | MKIETWSRLPRAVRDHLVERMHDRNIGLEDLNQLRLWMES |
| Ga0310039_101862213 | 3300030706 | Peatlands Soil | MKIETWSRLPRAVRDHLVERMHDRNIGLEDLNQLRLWME |
| Ga0310038_100827401 | 3300030707 | Peatlands Soil | MKIETWSRLPAAIRAHLVERMHDRNIGLEDLNQLRVWMESKPDVPDG |
| Ga0073996_123381033 | 3300030998 | Soil | MPQIATWSELPAGIRDHLVERMRDRKISLGDLNQLRVWIESRPN |
| Ga0302325_106829631 | 3300031234 | Palsa | MPQIETWSGLAAAVRDHLIERMHDRHIGLADLNQLRLWMESNPEVPE |
| Ga0302324_1016694521 | 3300031236 | Palsa | MPQIEAWSRLPAAVRAHLVERMHGRKIRLEDLNQLRLWMEAKPQVPEGAWY |
| Ga0302326_122889111 | 3300031525 | Palsa | MPQIESWPRIPAAICDHLIERMRDRNISLDDLNQLRGW |
| Ga0310686_1019422911 | 3300031708 | Soil | MPQIESWPRIPAAIRDHLIDRMRERHISLEDLSELEFFARS |
| Ga0310686_1078376402 | 3300031708 | Soil | MPQIETWSRLAAAVRAHLVERMHDRKISLEDLNQLRLSMEAKP |
| Ga0307474_107645951 | 3300031718 | Hardwood Forest Soil | MPQIEPWSGLPVAIRDHLVERMHERIRIEDLNRLRIW |
| Ga0307477_101176163 | 3300031753 | Hardwood Forest Soil | MLQIETWSGLPRALRDHLVERMRDRNINSDHLNQLRLWMAGKPEVPERSLV |
| Ga0307475_104870584 | 3300031754 | Hardwood Forest Soil | MPQIERWSGRPAAVRDHRVERMHDRNISLADLNQLRLWME |
| Ga0306924_106670413 | 3300032076 | Soil | MPQIATWSHLPAAVRAHLVERMHDRRISLQDLDRLRV |
| Ga0311301_111062231 | 3300032160 | Peatlands Soil | MPQIETWPRLPAAVRDHLIERMRDRNIGLEDLNQLRL |
| Ga0315281_104883793 | 3300032163 | Sediment | MPQIETWSRLPAAIRDHLVERMRDRNISLDDLNQLRIWIE |
| Ga0307471_1001242651 | 3300032180 | Hardwood Forest Soil | MPQIETWSRLPRTLRDHLVKRMHDRNISLDHLNQLRLWMASKPEVPEGPWY |
| Ga0307471_1020956013 | 3300032180 | Hardwood Forest Soil | MPNIETWDNFPRALRDHLIERLRDRRITLQDLNQLRLWIESKPEVPEDK |
| Ga0335078_101806083 | 3300032805 | Soil | MPQIETWSRLPTAIRDHLVERMHDRNIGLEDLNQLRVG |
| Ga0335081_104930321 | 3300032892 | Soil | MPKIETWPRIPAAIRDHLIERMRDRNIRVEDLNALRLWLESKPT |
| Ga0335077_121629422 | 3300033158 | Soil | MPQIESWSRLPAGIRDHLIERMRDRDINLENLNQLRLWIESKP |
| Ga0334722_100564032 | 3300033233 | Sediment | MPQIETWSRLPAAIRDHLVERMRDRNISLDDLNQLRIWIESKPSVPDGLW |
| Ga0314861_0065550_909_1058 | 3300033977 | Peatland | MPQIETWPRFPGAIRDHLIECMRDRNTSIQDLNGLRLWLESKPNVPEGP |
| Ga0326724_0537988_1_138 | 3300034091 | Peat Soil | MPQIESWPCIPVAIRDHLIERMRERNISLDDLNQLRVWLETRPIVP |
| ⦗Top⦘ |