| Basic Information | |
|---|---|
| Family ID | F063962 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 49 residues |
| Representative Sequence | GNPILRGQRACLFQHIFNDRFYGYDCHLETPDRWVLEEVEAPLP |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.65 % |
| % of genes near scaffold ends (potentially truncated) | 95.35 % |
| % of genes from short scaffolds (< 2000 bps) | 82.95 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.674 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (8.527 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.132 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.837 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 40.28% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 31.01 |
| PF17189 | Glyco_hydro_30C | 3.88 |
| PF07221 | GlcNAc_2-epim | 2.33 |
| PF08843 | AbiEii | 1.55 |
| PF03551 | PadR | 1.55 |
| PF00871 | Acetate_kinase | 1.55 |
| PF12704 | MacB_PCD | 1.55 |
| PF10091 | Glycoamylase | 0.78 |
| PF02739 | 5_3_exonuc_N | 0.78 |
| PF00076 | RRM_1 | 0.78 |
| PF04909 | Amidohydro_2 | 0.78 |
| PF00916 | Sulfate_transp | 0.78 |
| PF02310 | B12-binding | 0.78 |
| PF13358 | DDE_3 | 0.78 |
| PF13424 | TPR_12 | 0.78 |
| PF00999 | Na_H_Exchanger | 0.78 |
| PF00069 | Pkinase | 0.78 |
| PF08241 | Methyltransf_11 | 0.78 |
| PF12697 | Abhydrolase_6 | 0.78 |
| PF07690 | MFS_1 | 0.78 |
| PF08734 | GYD | 0.78 |
| PF04185 | Phosphoesterase | 0.78 |
| PF00150 | Cellulase | 0.78 |
| PF00589 | Phage_integrase | 0.78 |
| PF13784 | Fic_N | 0.78 |
| PF01740 | STAS | 0.78 |
| PF08450 | SGL | 0.78 |
| PF16586 | DUF5060 | 0.78 |
| PF07978 | NIPSNAP | 0.78 |
| PF13570 | PQQ_3 | 0.78 |
| PF04223 | CitF | 0.78 |
| PF02837 | Glyco_hydro_2_N | 0.78 |
| PF08239 | SH3_3 | 0.78 |
| PF00092 | VWA | 0.78 |
| PF00196 | GerE | 0.78 |
| PF17132 | Glyco_hydro_106 | 0.78 |
| PF08238 | Sel1 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.10 |
| COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 2.33 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 1.55 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.55 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.55 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.55 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 1.55 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 1.55 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.78 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.78 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.78 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.78 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.78 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.78 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG3051 | Citrate lyase, alpha subunit | Energy production and conversion [C] | 0.78 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.78 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.78 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.78 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.78 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.78 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.78 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.67 % |
| Unclassified | root | N/A | 2.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0303552 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300004091|Ga0062387_100529053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 829 | Open in IMG/M |
| 3300004152|Ga0062386_101588511 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005434|Ga0070709_10216063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300005434|Ga0070709_10526947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300005436|Ga0070713_100173469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1933 | Open in IMG/M |
| 3300005540|Ga0066697_10775982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005546|Ga0070696_100532301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300005556|Ga0066707_10128422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1587 | Open in IMG/M |
| 3300005557|Ga0066704_10748201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300005578|Ga0068854_100178479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1657 | Open in IMG/M |
| 3300005712|Ga0070764_10527045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300005764|Ga0066903_100319647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2477 | Open in IMG/M |
| 3300005921|Ga0070766_10754138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300006028|Ga0070717_10288782 | Not Available | 1456 | Open in IMG/M |
| 3300006050|Ga0075028_100916284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300006174|Ga0075014_100141257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1167 | Open in IMG/M |
| 3300006174|Ga0075014_100297089 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300006642|Ga0075521_10224377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 895 | Open in IMG/M |
| 3300006893|Ga0073928_10101757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2409 | Open in IMG/M |
| 3300006893|Ga0073928_10192997 | Not Available | 1602 | Open in IMG/M |
| 3300009012|Ga0066710_100484886 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300009616|Ga0116111_1010636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3776 | Open in IMG/M |
| 3300009632|Ga0116102_1112855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300009645|Ga0116106_1135934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300009683|Ga0116224_10542244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 555 | Open in IMG/M |
| 3300009792|Ga0126374_10733943 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300009824|Ga0116219_10148002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1360 | Open in IMG/M |
| 3300009839|Ga0116223_10074251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2178 | Open in IMG/M |
| 3300010046|Ga0126384_11423492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300010343|Ga0074044_10032995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3631 | Open in IMG/M |
| 3300010360|Ga0126372_10937744 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300010361|Ga0126378_11405719 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300010376|Ga0126381_102492772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300010379|Ga0136449_100467169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2206 | Open in IMG/M |
| 3300011271|Ga0137393_10380892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300012096|Ga0137389_10772297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300012199|Ga0137383_10313364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1149 | Open in IMG/M |
| 3300012203|Ga0137399_11125437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012205|Ga0137362_11535676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300012925|Ga0137419_10377933 | Not Available | 1102 | Open in IMG/M |
| 3300012971|Ga0126369_10403459 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300012976|Ga0134076_10342937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300013307|Ga0157372_10322582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1798 | Open in IMG/M |
| 3300014156|Ga0181518_10515206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300014165|Ga0181523_10097995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1763 | Open in IMG/M |
| 3300014165|Ga0181523_10282198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
| 3300014491|Ga0182014_10034070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 3836 | Open in IMG/M |
| 3300014496|Ga0182011_10026461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 4196 | Open in IMG/M |
| 3300016319|Ga0182033_10892694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300016341|Ga0182035_10874804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300016445|Ga0182038_11332547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300017822|Ga0187802_10102203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_57_11 | 1079 | Open in IMG/M |
| 3300017934|Ga0187803_10001666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8722 | Open in IMG/M |
| 3300017934|Ga0187803_10284056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300017941|Ga0187850_10345409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300017943|Ga0187819_10215672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1129 | Open in IMG/M |
| 3300017943|Ga0187819_10610538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300017946|Ga0187879_10245200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300017955|Ga0187817_10887185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300017959|Ga0187779_10271886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300017961|Ga0187778_10619396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 727 | Open in IMG/M |
| 3300017972|Ga0187781_10009659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6967 | Open in IMG/M |
| 3300017973|Ga0187780_10200265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1392 | Open in IMG/M |
| 3300017974|Ga0187777_10745903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300017995|Ga0187816_10117411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1145 | Open in IMG/M |
| 3300017995|Ga0187816_10285951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300018006|Ga0187804_10331626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300018022|Ga0187864_10174410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300018034|Ga0187863_10654244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300018042|Ga0187871_10393390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300018057|Ga0187858_10963337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300018088|Ga0187771_10190770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1698 | Open in IMG/M |
| 3300018090|Ga0187770_11003533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300019211|Ga0187799_1274022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300019258|Ga0181504_1137408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 600 | Open in IMG/M |
| 3300020150|Ga0187768_1079241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300021476|Ga0187846_10489954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300021479|Ga0210410_10368537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1288 | Open in IMG/M |
| 3300021559|Ga0210409_10349793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1328 | Open in IMG/M |
| 3300022557|Ga0212123_10009191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14621 | Open in IMG/M |
| 3300022557|Ga0212123_10099029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2387 | Open in IMG/M |
| 3300025472|Ga0208692_1014474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2556 | Open in IMG/M |
| 3300025604|Ga0207930_1135224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300025906|Ga0207699_11180456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300025928|Ga0207700_11018091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300026306|Ga0209468_1194604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300026371|Ga0257179_1044477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300026467|Ga0257154_1000663 | All Organisms → cellular organisms → Bacteria | 3559 | Open in IMG/M |
| 3300026528|Ga0209378_1071544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1594 | Open in IMG/M |
| 3300027514|Ga0208338_1012235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300027516|Ga0207761_1110913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300027696|Ga0208696_1200218 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300027703|Ga0207862_1135868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 737 | Open in IMG/M |
| 3300027812|Ga0209656_10353226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300027869|Ga0209579_10108313 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300027905|Ga0209415_10098692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3221 | Open in IMG/M |
| 3300027905|Ga0209415_10196796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1912 | Open in IMG/M |
| 3300028536|Ga0137415_10060724 | All Organisms → cellular organisms → Bacteria | 3646 | Open in IMG/M |
| 3300028906|Ga0308309_11046259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 706 | Open in IMG/M |
| 3300029817|Ga0247275_1167873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300029945|Ga0311330_10177438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1979 | Open in IMG/M |
| 3300029990|Ga0311336_11420442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300030494|Ga0310037_10318206 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300030706|Ga0310039_10284761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 629 | Open in IMG/M |
| 3300030760|Ga0265762_1035868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300031232|Ga0302323_100241962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1845 | Open in IMG/M |
| 3300031716|Ga0310813_10964805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300031726|Ga0302321_100653895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
| 3300031781|Ga0318547_10895047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300031912|Ga0306921_10898997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300031912|Ga0306921_12565655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031954|Ga0306926_10881291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
| 3300032160|Ga0311301_10559596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1667 | Open in IMG/M |
| 3300032160|Ga0311301_12178473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300032261|Ga0306920_100202948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2959 | Open in IMG/M |
| 3300032783|Ga0335079_11408428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300032805|Ga0335078_12067460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 607 | Open in IMG/M |
| 3300032828|Ga0335080_10127299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2826 | Open in IMG/M |
| 3300032828|Ga0335080_10440534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1392 | Open in IMG/M |
| 3300032828|Ga0335080_11658307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300032829|Ga0335070_10071577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3723 | Open in IMG/M |
| 3300032829|Ga0335070_11325615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 658 | Open in IMG/M |
| 3300032892|Ga0335081_10198314 | All Organisms → cellular organisms → Bacteria | 2782 | Open in IMG/M |
| 3300032955|Ga0335076_10816857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300033158|Ga0335077_10160439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2568 | Open in IMG/M |
| 3300033158|Ga0335077_10577511 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300033412|Ga0310810_10188496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2347 | Open in IMG/M |
| 3300033433|Ga0326726_10443549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1236 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.20% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.10% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.33% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.33% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.33% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.78% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.78% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019211 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300027514 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_03035522 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | QRACLFQNVFHGRFYGYDCHLESADHWVLEEVEAPLR* |
| Ga0062387_1005290532 | 3300004091 | Bog Forest Soil | GDFYPVAGNPILAGQRACLFQHIFNDRFYGYDCHLESPDHWVLEEVEAPLL* |
| Ga0062386_1015885111 | 3300004152 | Bog Forest Soil | AGNPVMRGQRACLFQHIFNNRLYGYDCHQVSQDKWELEEVEAPLP* |
| Ga0070709_102160632 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SPDGDFQPVQGNPIQSGQRACLFQHIFNGKFYGFDCHLVDPQQNHWILEETEAPLP* |
| Ga0070709_105269471 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PVLRGQRACLFQHVFNNHFYGFDCHLEDPEHWVLEFTEAALP* |
| Ga0070713_1001734691 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DPVLRGQRACLFQHVFHGRFYGYDCHLETPERWVLEEVEAPLP* |
| Ga0066697_107759822 | 3300005540 | Soil | RACLFQHVFHGRFYGYDCHLDSPDHWMLEEVEAPLP* |
| Ga0070696_1005323011 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RGQRACLFQHVFHGRFYGYDCHLETPDHWVLEEVEAPLP* |
| Ga0066707_101284221 | 3300005556 | Soil | GDFQPVAGNPIMRGQRACLFQNIFNHRFYGYDCHLETADKWVLEEVEAPLVAK* |
| Ga0066704_107482012 | 3300005557 | Soil | GQRACLFQHVFHGRFYGYDCHLDSPDHWMLEEVEAPLP* |
| Ga0068854_1001784792 | 3300005578 | Corn Rhizosphere | VADNPVMSGERACLFQHVFHGRFYGYDCHLDSPDHWVLEEVEADLP* |
| Ga0070764_105270451 | 3300005712 | Soil | QPVEGDPVMSGQRACLFQHVFRGRFYGYDCHLDSLDHWMLEEVEAPVQ* |
| Ga0066903_1003196473 | 3300005764 | Tropical Forest Soil | MRGQRACLFQHIFNGRFYGYDCHLDTTSNQWMLEEVEGPLP* |
| Ga0070766_107541382 | 3300005921 | Soil | MAEGNFQPVEGNPVLRRQRACLFQHVFANHFYGFDCHLDSPDHWVLELTDAPLP* |
| Ga0070717_102887824 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EGEWQVKVFAASSPDSDFQEVEGNPVMRGQRACLSQHIFNGRFYGYDCHLEAPDKWVLEEVEAPLP* |
| Ga0075028_1009162842 | 3300006050 | Watersheds | RGQRACLFQHVFNGRFYGYDCHLEAPDKWVLEEVEAPLP* |
| Ga0075014_1001412571 | 3300006174 | Watersheds | PVDGNPIMRGQRACLFQHIFNDRFYGYDCHLETPDHWVLEEVEAPLH* |
| Ga0075014_1002970891 | 3300006174 | Watersheds | DSPDGDFKPVTGDPVLRGQRACLFQHVFNNRFYGFDCHLDTPDHWELELTEAPLP* |
| Ga0075521_102243771 | 3300006642 | Arctic Peat Soil | PIMRGQRACLFQHVLNDRFYGYDCHLESPDHWVLEEVEASLP* |
| Ga0073928_101017574 | 3300006893 | Iron-Sulfur Acid Spring | DPVMSGQRACLFQHVFKGRFYGYDCHLDSLDHWMLEEVEAPLQ* |
| Ga0073928_101929971 | 3300006893 | Iron-Sulfur Acid Spring | DPVMSGQRACLFQHVFKGRFYGYDCHLDSLDHWMLEEVEAPVQ* |
| Ga0066710_1004848862 | 3300009012 | Grasslands Soil | GEWLVKVFAADSPDGNFQPVAGNPIMSGQRACLFQHIFNNRFYGFDCHLEVPAENHWILEETEAPLP |
| Ga0116111_10106362 | 3300009616 | Peatland | PVEGNPILRGQRACLFQHVFNHRFYGYDCHLETPDHWVLEEVEAPLP* |
| Ga0116102_11128551 | 3300009632 | Peatland | VKVFAANVPDGNFKPVAGNPILRGQRACLFQHIFDNRFYGYDCHQVSEDKWELEEVEAPLP* |
| Ga0116106_11359343 | 3300009645 | Peatland | WSDSPDGNFQPVQDNPVMKGQRACLFQHVFNGRFYGYDCHLESEDRWILEEVEAPLP* |
| Ga0116224_105422441 | 3300009683 | Peatlands Soil | DGDFQPVEGNPIMRGQRACLFQHIFDDRFYGYDCHLELPDHWVLEEVEAPLH* |
| Ga0126374_107339431 | 3300009792 | Tropical Forest Soil | PVDDNPVMSGQRACLFQHVFKGRFYGYDCHLDAPDHWLLEEVEASLP* |
| Ga0116219_101480021 | 3300009824 | Peatlands Soil | GQRACLFQHIFNDRFYGYDCHLETPDHWVLEEVEAPLH* |
| Ga0116223_100742512 | 3300009839 | Peatlands Soil | NPIMRGQRACLFQHVFNDRFYGYDCHLELPDHWVLEEVEAPLH* |
| Ga0126384_114234922 | 3300010046 | Tropical Forest Soil | VFAANTPDGNFEPVAGNPVMRGQRACLFQHIFNGRFYGYDCHLDTASDKWMLEEVEAPLP |
| Ga0074044_100329951 | 3300010343 | Bog Forest Soil | QRACLFQHVFNHRFYGYDCHLETPDRWVLEEVEAPLP* |
| Ga0126372_109377442 | 3300010360 | Tropical Forest Soil | VKVFAADSPDGGFQSVAGDPVMTGQRACLFQHIFNGRFYGDECHLETADKWILEEVEAPLP* |
| Ga0126378_114057191 | 3300010361 | Tropical Forest Soil | CLFQHIFNGRFYGYDCHLVAAIDKWMLEEVEAPLP* |
| Ga0126381_1024927723 | 3300010376 | Tropical Forest Soil | FVSDSPDGDFQPVAGDPVMKGQRACLFQYVFHSRFYGYDCHLDSPNHWILEEVESPLP* |
| Ga0136449_1004671693 | 3300010379 | Peatlands Soil | LFQHIFHGRFYGYDCHLDTATDRWMLEEVEAPLP* |
| Ga0137393_103808921 | 3300011271 | Vadose Zone Soil | DFQPVEGNPVMSGQRACLFQHVFHGRFYGYDCHVDSPGHWILEEVEAPLP* |
| Ga0137389_107722971 | 3300012096 | Vadose Zone Soil | CLFQHVFNGRFYGYDCHLETTDHWVLEEVEAALP* |
| Ga0137383_103133641 | 3300012199 | Vadose Zone Soil | DTPDGDFQPVAGNPIMRGQRACLFQNIFNHRFYGYDCHLETPDKWVLEEVEAPLVAK* |
| Ga0137399_111254371 | 3300012203 | Vadose Zone Soil | HRYSDNSEGEWQVKVFAAEAPDGDFQPVEGDPVPRGQRACLFQHIFHGRFYGYDCHLQPPSHWMLEEVETPLP* |
| Ga0137362_115356761 | 3300012205 | Vadose Zone Soil | GFAADSPDGNFQPVAGNPIMNGQRACLFQHIFNNRFYGFDCHLEVPAENHWILEETEAPLP* |
| Ga0137419_103779331 | 3300012925 | Vadose Zone Soil | VFAASSPDGDFQEVEGNPVMRGQRACLFQHIFGGRFYGYDCHLEGPDKWVLEEVEAPLP* |
| Ga0126369_104034592 | 3300012971 | Tropical Forest Soil | QVKVFAADSPDGILHPLAGNPVMRGQRACLFQHIFGNRFYGFDCHLDSPEHWVLEEVEAPLP* |
| Ga0134076_103429372 | 3300012976 | Grasslands Soil | CLFQHVFHGRFYGYDCHLDSPDHWMLEEVEAPLP* |
| Ga0157372_103225823 | 3300013307 | Corn Rhizosphere | CLFQHVFHGRFYGYDCHLDSPDHWVLEEVEADLP* |
| Ga0181518_105152062 | 3300014156 | Bog | FWSDSPDGNFQPVQDNPVMKGQRACLFQHVFNGRFYGYDCHLESEDRWILEEVEAPLP* |
| Ga0181523_100979952 | 3300014165 | Bog | PDGNFKPVAGNPILRGQRACLFQHIFDNRFYGYDCHQVSEDKWELEEVEAPLP* |
| Ga0181523_102821983 | 3300014165 | Bog | PDGNFKPVAGNPILRGQRACLFQHIFDNRFYGYDCHQVSEAKWELEEVEAPLP* |
| Ga0182014_100340701 | 3300014491 | Bog | DSPDGDFQPVDGNPIMSGQRACLFQHIFNDRFYGYDCHLETPDHWVLEEVEAPLPHK* |
| Ga0182011_100264611 | 3300014496 | Fen | GNPILRGQRACLFQHIFNDRFYGYDCHLETPDRWVLEEVEAPLP* |
| Ga0182033_108926941 | 3300016319 | Soil | PVAGNPILRGQRACLFQHIFNNRFYGFDCHLALDGQWQLEEVEAPLL |
| Ga0182035_108748041 | 3300016341 | Soil | NPGGEWQVQVFAASAPDGDFQPVVGNPVLRGQRACLFQHIFNNHFYGFDCHLALDGQWELEEVEAPLP |
| Ga0182038_113325471 | 3300016445 | Soil | EGEWQVQVFAASAPDGDFQPVVGNPVLRGQRACLFQHIFNNHFYGFDCHLALDGQWELEEVEAPLP |
| Ga0187802_101022032 | 3300017822 | Freshwater Sediment | DFRPVEGDPILRGQRACLFQHIFHDRFYGYDCHLDTASDRWMLEEVEAPLP |
| Ga0187803_1000166610 | 3300017934 | Freshwater Sediment | GNPIMRGQRACLFQHVFNGRFYGYDCHLETPDKWVLEEVEAPLPER |
| Ga0187803_102840561 | 3300017934 | Freshwater Sediment | VMRGQRACLFQHIFNNRFYGYDCHLEADGKWVLEEVEAPLP |
| Ga0187850_103454092 | 3300017941 | Peatland | MRGQRACLFQHVFNDRFYGYDCHLETPDRWVLEEVEAPLP |
| Ga0187819_102156721 | 3300017943 | Freshwater Sediment | QRACLFQHIFHNRFYAYDCHLDTVSNKWMLEEVEAALP |
| Ga0187819_106105382 | 3300017943 | Freshwater Sediment | FSASAPDGDFRPVAGDPVMKGQRACLFQHVFNRRFYGYDCHLESNDKWVLEEVEAPLP |
| Ga0187879_102452001 | 3300017946 | Peatland | NPIMRGQRACLFQHVFNHRFYGYDCHLETPDRWVLEEVEAPLP |
| Ga0187817_108871851 | 3300017955 | Freshwater Sediment | PVSGNPVLPGQRACLFQHVFNHHFYGFDCHLDTPNHWELELTEAPLP |
| Ga0187779_102718861 | 3300017959 | Tropical Peatland | NPVMRGQRACLFQHIFHGRFYAYDCHLDTTSHKWMLEEVEAPLP |
| Ga0187778_106193962 | 3300017961 | Tropical Peatland | DGDPVMGGQRACLFQHIFNGRFYGYDCHLDTSTDQWMLEEVEAALP |
| Ga0187781_1000965913 | 3300017972 | Tropical Peatland | EGDPVMKGQRACLFQHVFNGRFYGYDCHLESEDRWILEEVEAPLP |
| Ga0187780_102002651 | 3300017973 | Tropical Peatland | VKVFAADAPDGNFHPVDGDPVMGGQRACLFQHIFNGRFYGYDCHLDTSTDQWMLEEVEAALP |
| Ga0187777_107459032 | 3300017974 | Tropical Peatland | GRACLFQHIFRDRFYGFDCHLATPDHWELEEVEAPLP |
| Ga0187816_101174111 | 3300017995 | Freshwater Sediment | RYTDDPQGEWQVKVFAADSPDGDFHPVAGDPVMRGQRACLFQHIFHNRYYAYDCHLDTVSNKWMLEEVEAALP |
| Ga0187816_102859512 | 3300017995 | Freshwater Sediment | DFQPLASNPVMRGQRACLFQHVFNGRFYGYDCHLEDPEHWVLEETEAPLP |
| Ga0187804_103316262 | 3300018006 | Freshwater Sediment | VKVFAADSPDGDFQPVRNDPVLRGQRACLFQHIFNDRFYGYDCHLDTATDRWMLEEVEAPLP |
| Ga0187864_101744101 | 3300018022 | Peatland | QPVQDNPVMKGQRACLFQHVFNGRFYGYDCHLESEDRWILEEVEAPLP |
| Ga0187863_106542442 | 3300018034 | Peatland | VEGNPIMRGQRACLFQHVFNHRFYGYDCHLETPDRWVLEEVEAPLP |
| Ga0187871_103933901 | 3300018042 | Peatland | RACLFQHVFNHRFYGYDCHLETPDRWVLEEVEAPLP |
| Ga0187858_109633372 | 3300018057 | Peatland | VMKGQRACLFQHVFNGRFYGYDCHLESEDRWILEEVEAPLP |
| Ga0187771_101907701 | 3300018088 | Tropical Peatland | ACLLQHIFQKRFYGFDCHLDSPDHWVLEEVEASLP |
| Ga0187770_110035331 | 3300018090 | Tropical Peatland | ACLFQHVFDGRFYGFDCHLETTDRWVLEEVEAPLP |
| Ga0187799_12740222 | 3300019211 | Peatland | SDSPDGDFEPVAGNPVMRGQRACLFQHVFNNRFYGFDCHLDSPDQWVLEEVEASLP |
| Ga0181504_11374081 | 3300019258 | Peatland | MRGQRACLIQHIFNGQFYGYDCHLETPDKWVLEEVEAVLP |
| Ga0187768_10792412 | 3300020150 | Tropical Peatland | ALRGQRACLFQHIFHNRFYGFDCHLDSPDHWVLEETEASLP |
| Ga0187846_104899541 | 3300021476 | Biofilm | EPLAGNPIMRGQRACLFQHIFKNRFYGFDCHLDSPDHWVLEEVEAPLP |
| Ga0210410_103685374 | 3300021479 | Soil | EQRACLFQHVFNGRFYGYDCHLETADHWVLEEVEAALP |
| Ga0210409_103497932 | 3300021559 | Soil | NAPDGDFQPLYGSPIETGQRACLFQHIFNGRFYGYQCHLESPNHWVLEEVEAPLP |
| Ga0212123_1000919111 | 3300022557 | Iron-Sulfur Acid Spring | GDPVMSGQRACLFQHVFKGRFYGYDCHLDSLDHWMLEEVEAPVQ |
| Ga0212123_100990294 | 3300022557 | Iron-Sulfur Acid Spring | GDPVMSGQRACLFQHVFKGRFYGYDCHLDSLDHWMLEEVEAPLQ |
| Ga0208692_10144742 | 3300025472 | Peatland | PIMRGQRACLFQHIFDDRFYGYDCHMDTPDHWMLEEVEAPLP |
| Ga0207930_11352241 | 3300025604 | Arctic Peat Soil | EPDGDFQPVEGNPIMRGQRACLFQHIFNDRFYGYDCHLESPDHWVLEEVEAPLP |
| Ga0207699_111804561 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PEGEWLVKVFAAASPDGDFQPVQGNPIQSGQRACLFQHIFNGKFYGFDCHLVDPQQNHWILEETEAPLP |
| Ga0207700_110180911 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LFQHIFNNRFYGFDCHLEVPAENHWILEETEAQLP |
| Ga0209468_11946041 | 3300026306 | Soil | RACLFQHVFHGRFYGYDCHLDSPDHWMLEEVEAPLP |
| Ga0257179_10444771 | 3300026371 | Soil | SDNSEGEWQVKVFAAEPPDGDFQPVEGDPVPRGQRACLFQHIFHGRFYGYDCHLEPPSHWMLEEVETPLP |
| Ga0257154_10006633 | 3300026467 | Soil | MSGQRACLFQHVFKGRFYGYDCHLDSLDHWMLEEVEAPVQ |
| Ga0209378_10715441 | 3300026528 | Soil | GDFQPVAGNPIMRGQRACLFQNIFNHRFYGYDCHLETADKWVLEEVEAPLVAK |
| Ga0208338_10122351 | 3300027514 | Soil | ACLFQHIFKGRFYGYDCHLEAAERWVLEEVEAALP |
| Ga0207761_11109131 | 3300027516 | Tropical Forest Soil | KVFFADAPDGDFQPVAGNPVLRGQRACLFQHIFNHHLYGFDCHLDSADHWMLEVTEAPLP |
| Ga0208696_12002182 | 3300027696 | Peatlands Soil | QPVSNNPVMRGQRACLFQHIFHGRFYGYDCHLEAPDKWVLEEVEAALP |
| Ga0207862_11358681 | 3300027703 | Tropical Forest Soil | DGDFQPVAGNPVMSGQRACLFQHIFEGRFYGYDCHLDTASDKWMLEEVEAPLP |
| Ga0209656_103532261 | 3300027812 | Bog Forest Soil | ANAPDGDFEAVAGNPVMRGQRACLFQHIFNDRFYGYDCHLETNDKWVLEEVEAPLP |
| Ga0209579_101083133 | 3300027869 | Surface Soil | PVEGDPVLRGQRACLFQHVFHGRFYGYDCHLETPDHWVLEEVEAPLP |
| Ga0209415_100986921 | 3300027905 | Peatlands Soil | VMRGQRACLFQHIFHGRFYGYDCHLEAPDKWVLEEVEAALP |
| Ga0209415_101967962 | 3300027905 | Peatlands Soil | PVEGNPIMRGQRACLFQHIFHGRFYGYDCHLDTATDRWMLEEVEAPLP |
| Ga0137415_100607243 | 3300028536 | Vadose Zone Soil | VKVFAAEAPDGDFQPVEGDPVPRGQRACLFQHIFHGRFYGYDCHLQPPSHWMLEEVEAPL |
| Ga0308309_110462591 | 3300028906 | Soil | HGQRACLFQHVFHDRFYGFDCHLTSHDQWVMEETEASLP |
| Ga0247275_11678733 | 3300029817 | Soil | RACLFQHVFENRFYGYDCHQVSEDKWELEEVEAPLP |
| Ga0311330_101774383 | 3300029945 | Bog | VQGNPVLRGQRACLFQHVFDGRFYGYDCHLESPDHWVLEEVEAPLP |
| Ga0311336_114204422 | 3300029990 | Fen | GDFQPVEGSPTMQGQRACLFQHIFNNRFYGYDCHLETPEHWVLEEVEAALPKK |
| Ga0310037_103182062 | 3300030494 | Peatlands Soil | DSADGDFQPVSNNPVMRGQRACLFQHIFHGRFYGYDCHLEAPDKWVLEEVEAALP |
| Ga0310039_102847611 | 3300030706 | Peatlands Soil | FQPVAENPIMRGQRACLFQHIFNDRFYGYDCHLETPDHWVLEEVEAPLP |
| Ga0265762_10358681 | 3300030760 | Soil | KVFAASAPDGDFHEVEGNPIMRGQRACLFQHIFNDRFYGYDCHLDAPGKWVLEEVEAALP |
| Ga0302323_1002419621 | 3300031232 | Fen | FQPVEGNPIMSGQRACLFQHVFNGRFYGYDCHLESADKWVLEEVEAPLP |
| Ga0310813_109648052 | 3300031716 | Soil | EGDPVLRGQRACLFQHVFHGRFYGYDCHLETPEKWVLEEVEAPLP |
| Ga0302321_1006538951 | 3300031726 | Fen | RACLFQHVFNGRFYGYDCHLESADKWVLEEVEAPLP |
| Ga0318547_108950471 | 3300031781 | Soil | VFYASAPDGDFQPVAGDPIMRGQRACLFQHIFHDRFYGFDCHLSTPDHWELEEVEAPLP |
| Ga0306921_108989971 | 3300031912 | Soil | QNPEGEWQVKVFAASAPDGDFQPVAGNPILRGQRACLFQHIFNNRFYGFDCHLALDGQWQLEEVEAPLL |
| Ga0306921_125656551 | 3300031912 | Soil | EIYPHRYTQNPEGEWQVQVFAASAPEGDFQPVVGNPILRGQRACLFQHIFNNRFYGFDCHLALDGQWELEQVEAPLL |
| Ga0306926_108812912 | 3300031954 | Soil | HRYTQNPEGEWQVQVFAASAPEGDFQPVVGNPILRGQRACLFQHIFNNRFYGFDCHLALDGQWELEQVEAPLL |
| Ga0311301_105595961 | 3300032160 | Peatlands Soil | RACLFQHIFHGRFYGYDCHLDTATDRWMLEEVEAPLP |
| Ga0311301_121784732 | 3300032160 | Peatlands Soil | FEPVDGNPIMRGQRACLFQHIFNDRFYGYDCHLETPDHWVLEEVEAPLH |
| Ga0306920_1002029484 | 3300032261 | Soil | QRACLFQHIFNNRFYGFDCHLALDGQWELEEVEAPLL |
| Ga0335079_114084282 | 3300032783 | Soil | WQVRLFAADAPDGVFQPVAENPILRGQRACLFQHVFNKRFYGFDCHLESPDHWMLELTEGPLP |
| Ga0335078_120674602 | 3300032805 | Soil | QPVDGNPVMKGQRACLFQNVFNDRFYGYDCHMDSPEHWVLEEVEAPLP |
| Ga0335080_101272993 | 3300032828 | Soil | VFAADAPGGNFEPVAGNPAMHGQRACLFQHIFNGRFYGYYCHLETINNKWMIEEVEASLP |
| Ga0335080_104405342 | 3300032828 | Soil | GNPIMTGQRACLFQHVFNNRFYGYDCHMESPDRWVLEEVEAPLP |
| Ga0335080_116583071 | 3300032828 | Soil | FQPVEGNPVLRGQRACLFQHVFSSRFYGFDCHLDTSGDKWMLEEVEAPIP |
| Ga0335070_100715772 | 3300032829 | Soil | KGQRACLFQHIFNGRFYGYDCHLETPDKWVLEEVEAPLP |
| Ga0335070_113256151 | 3300032829 | Soil | VIRGQRACLFQHIFNNRFYGYDCHLDTSANKWMLEEVEAPLP |
| Ga0335081_101983143 | 3300032892 | Soil | PILRGQRACLFQHIFDGRFYGYDCHLDSPDHRVLEEVEADLP |
| Ga0335076_108168573 | 3300032955 | Soil | RACLFQHVFDGRFYGFDCHLETPDRWELELTQAPLP |
| Ga0335077_101604391 | 3300033158 | Soil | VLRGQRACLFQHIFNNRFYGFDCHLDSPDHWVLEEVEAPLP |
| Ga0335077_105775111 | 3300033158 | Soil | PVTGNPVMRGQRACLFQHIFNGRLYGYDCHLDTADNKWMLEEVEARLP |
| Ga0310810_101884961 | 3300033412 | Soil | VMSGQRACLFQHIFNGHFYGYDCHLASPDHWILEEVEAPLP |
| Ga0326726_104435492 | 3300033433 | Peat Soil | DSPDGDLQPVAGNPVMNGQRACLFQHIFNGRFYGYDCHLDTASDKWMLEEVEAPLP |
| ⦗Top⦘ |