| Basic Information | |
|---|---|
| Family ID | F063940 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VTDVTEDRDQAGAELSAADEQLLRELTERARTGGLKLTGEG |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.15 % |
| % of genes near scaffold ends (potentially truncated) | 85.27 % |
| % of genes from short scaffolds (< 2000 bps) | 82.95 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.318 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.829 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.481 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 0.00% Coil/Unstructured: 76.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF03466 | LysR_substrate | 3.88 |
| PF02371 | Transposase_20 | 3.88 |
| PF00872 | Transposase_mut | 3.10 |
| PF00106 | adh_short | 2.33 |
| PF00440 | TetR_N | 2.33 |
| PF13006 | Nterm_IS4 | 1.55 |
| PF11239 | DUF3040 | 1.55 |
| PF01527 | HTH_Tnp_1 | 1.55 |
| PF13683 | rve_3 | 0.78 |
| PF00589 | Phage_integrase | 0.78 |
| PF01610 | DDE_Tnp_ISL3 | 0.78 |
| PF03704 | BTAD | 0.78 |
| PF13700 | DUF4158 | 0.78 |
| PF01526 | DDE_Tnp_Tn3 | 0.78 |
| PF04672 | Methyltransf_19 | 0.78 |
| PF13613 | HTH_Tnp_4 | 0.78 |
| PF13185 | GAF_2 | 0.78 |
| PF07505 | DUF5131 | 0.78 |
| PF13398 | Peptidase_M50B | 0.78 |
| PF00561 | Abhydrolase_1 | 0.78 |
| PF02518 | HATPase_c | 0.78 |
| PF08044 | DUF1707 | 0.78 |
| PF10935 | DUF2637 | 0.78 |
| PF01548 | DEDD_Tnp_IS110 | 0.78 |
| PF07690 | MFS_1 | 0.78 |
| PF02589 | LUD_dom | 0.78 |
| PF13193 | AMP-binding_C | 0.78 |
| PF07366 | SnoaL | 0.78 |
| PF00126 | HTH_1 | 0.78 |
| PF12833 | HTH_18 | 0.78 |
| PF14864 | Alkyl_sulf_C | 0.78 |
| PF03050 | DDE_Tnp_IS66 | 0.78 |
| PF00072 | Response_reg | 0.78 |
| PF01804 | Penicil_amidase | 0.78 |
| PF14690 | zf-ISL3 | 0.78 |
| PF01734 | Patatin | 0.78 |
| PF00583 | Acetyltransf_1 | 0.78 |
| PF00078 | RVT_1 | 0.78 |
| PF08281 | Sigma70_r4_2 | 0.78 |
| PF00108 | Thiolase_N | 0.78 |
| PF06742 | DUF1214 | 0.78 |
| PF00903 | Glyoxalase | 0.78 |
| PF00578 | AhpC-TSA | 0.78 |
| PF00005 | ABC_tran | 0.78 |
| PF01243 | Putative_PNPOx | 0.78 |
| PF02771 | Acyl-CoA_dh_N | 0.78 |
| PF00486 | Trans_reg_C | 0.78 |
| PF03729 | DUF308 | 0.78 |
| PF00041 | fn3 | 0.78 |
| PF03279 | Lip_A_acyltrans | 0.78 |
| PF03473 | MOSC | 0.78 |
| PF13466 | STAS_2 | 0.78 |
| PF03448 | MgtE_N | 0.78 |
| PF13401 | AAA_22 | 0.78 |
| PF12146 | Hydrolase_4 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 4.65 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 3.10 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.78 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.78 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.78 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.78 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.78 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.78 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.78 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.78 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.78 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.78 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.78 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.78 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.78 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.78 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.32 % |
| Unclassified | root | N/A | 28.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig02811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Pseudarthrobacter → Pseudarthrobacter phenanthrenivorans | 824 | Open in IMG/M |
| 2170459024|GZRSKLJ01CI9H8 | Not Available | 504 | Open in IMG/M |
| 2189573001|GZR05M101C8IRT | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Pseudarthrobacter → Pseudarthrobacter phenanthrenivorans | 501 | Open in IMG/M |
| 2189573001|GZR05M102HZYKP | Not Available | 523 | Open in IMG/M |
| 3300001408|JGI20206J14855_1040879 | Not Available | 684 | Open in IMG/M |
| 3300003990|Ga0055455_10053290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1113 | Open in IMG/M |
| 3300005435|Ga0070714_100420673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1266 | Open in IMG/M |
| 3300005467|Ga0070706_101614196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300005535|Ga0070684_102209065 | Not Available | 519 | Open in IMG/M |
| 3300005541|Ga0070733_10522314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300005552|Ga0066701_10267967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1057 | Open in IMG/M |
| 3300005577|Ga0068857_100121321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2354 | Open in IMG/M |
| 3300005591|Ga0070761_10577780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300005591|Ga0070761_10750129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300005952|Ga0080026_10111948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 767 | Open in IMG/M |
| 3300006059|Ga0075017_101209145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 592 | Open in IMG/M |
| 3300006174|Ga0075014_100941399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300006797|Ga0066659_11747430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300006804|Ga0079221_10021163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2648 | Open in IMG/M |
| 3300006893|Ga0073928_10565555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 807 | Open in IMG/M |
| 3300006914|Ga0075436_100436658 | Not Available | 952 | Open in IMG/M |
| 3300009038|Ga0099829_11165748 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009038|Ga0099829_11479623 | Not Available | 561 | Open in IMG/M |
| 3300009090|Ga0099827_10080232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2545 | Open in IMG/M |
| 3300009520|Ga0116214_1332657 | Not Available | 586 | Open in IMG/M |
| 3300009522|Ga0116218_1163252 | Not Available | 1010 | Open in IMG/M |
| 3300009522|Ga0116218_1281541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300009524|Ga0116225_1554148 | Not Available | 509 | Open in IMG/M |
| 3300009525|Ga0116220_10205752 | Not Available | 853 | Open in IMG/M |
| 3300009700|Ga0116217_10096503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2029 | Open in IMG/M |
| 3300010043|Ga0126380_10288860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
| 3300010047|Ga0126382_11537613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300010339|Ga0074046_10712354 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010358|Ga0126370_10149459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1700 | Open in IMG/M |
| 3300010360|Ga0126372_11940475 | Not Available | 634 | Open in IMG/M |
| 3300010361|Ga0126378_10010221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7627 | Open in IMG/M |
| 3300010362|Ga0126377_11904985 | Not Available | 670 | Open in IMG/M |
| 3300010376|Ga0126381_100331620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2096 | Open in IMG/M |
| 3300010398|Ga0126383_12608051 | Not Available | 589 | Open in IMG/M |
| 3300011120|Ga0150983_10454603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
| 3300011270|Ga0137391_10600648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 922 | Open in IMG/M |
| 3300011270|Ga0137391_11379387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia nigra | 551 | Open in IMG/M |
| 3300012189|Ga0137388_11942395 | Not Available | 518 | Open in IMG/M |
| 3300012198|Ga0137364_10932497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus elymi | 657 | Open in IMG/M |
| 3300012199|Ga0137383_11223990 | Not Available | 539 | Open in IMG/M |
| 3300012200|Ga0137382_11096715 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012201|Ga0137365_10216090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1431 | Open in IMG/M |
| 3300012202|Ga0137363_10086529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2348 | Open in IMG/M |
| 3300012209|Ga0137379_10033773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 4930 | Open in IMG/M |
| 3300012210|Ga0137378_10081908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2945 | Open in IMG/M |
| 3300012349|Ga0137387_10729523 | Not Available | 717 | Open in IMG/M |
| 3300012353|Ga0137367_10409515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. E2497 | 961 | Open in IMG/M |
| 3300012354|Ga0137366_10563046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 820 | Open in IMG/M |
| 3300012356|Ga0137371_10565675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 875 | Open in IMG/M |
| 3300012356|Ga0137371_10941253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300012357|Ga0137384_10966784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus elymi | 685 | Open in IMG/M |
| 3300012360|Ga0137375_10006245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14140 | Open in IMG/M |
| 3300012363|Ga0137390_11951283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. AZ43 | 514 | Open in IMG/M |
| 3300012930|Ga0137407_10177041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1901 | Open in IMG/M |
| 3300016294|Ga0182041_10428347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1132 | Open in IMG/M |
| 3300016357|Ga0182032_11962831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300016445|Ga0182038_10946110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300017931|Ga0187877_1174843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 852 | Open in IMG/M |
| 3300017937|Ga0187809_10071667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1135 | Open in IMG/M |
| 3300017955|Ga0187817_10239138 | Not Available | 1157 | Open in IMG/M |
| 3300017959|Ga0187779_10438197 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300017970|Ga0187783_10451453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 933 | Open in IMG/M |
| 3300018001|Ga0187815_10102990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1204 | Open in IMG/M |
| 3300018001|Ga0187815_10170519 | Not Available | 921 | Open in IMG/M |
| 3300018001|Ga0187815_10346799 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300018025|Ga0187885_10426290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 593 | Open in IMG/M |
| 3300018046|Ga0187851_10050844 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
| 3300018085|Ga0187772_11071592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
| 3300018088|Ga0187771_10397780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1161 | Open in IMG/M |
| 3300018482|Ga0066669_12424748 | Not Available | 503 | Open in IMG/M |
| 3300020583|Ga0210401_10134529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2315 | Open in IMG/M |
| 3300021168|Ga0210406_10385253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1126 | Open in IMG/M |
| 3300021374|Ga0213881_10004182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6020 | Open in IMG/M |
| 3300021402|Ga0210385_10548160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 879 | Open in IMG/M |
| 3300021403|Ga0210397_10354903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1088 | Open in IMG/M |
| 3300021479|Ga0210410_11289948 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300021560|Ga0126371_10071678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3372 | Open in IMG/M |
| 3300021560|Ga0126371_13692124 | Not Available | 516 | Open in IMG/M |
| 3300025910|Ga0207684_10399966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1181 | Open in IMG/M |
| 3300025922|Ga0207646_10183953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1887 | Open in IMG/M |
| 3300025922|Ga0207646_10291613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1474 | Open in IMG/M |
| 3300025928|Ga0207700_10491863 | Not Available | 1085 | Open in IMG/M |
| 3300026310|Ga0209239_1053202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1819 | Open in IMG/M |
| 3300026557|Ga0179587_10975037 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300027604|Ga0208324_1217439 | Not Available | 502 | Open in IMG/M |
| 3300027775|Ga0209177_10015185 | Not Available | 1809 | Open in IMG/M |
| 3300027775|Ga0209177_10056476 | Not Available | 1130 | Open in IMG/M |
| 3300027898|Ga0209067_10842543 | Not Available | 537 | Open in IMG/M |
| 3300028047|Ga0209526_10023128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4349 | Open in IMG/M |
| 3300028563|Ga0265319_1006287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5523 | Open in IMG/M |
| 3300028731|Ga0302301_1015338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2328 | Open in IMG/M |
| 3300029944|Ga0311352_10402815 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300029951|Ga0311371_10324760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2150 | Open in IMG/M |
| 3300030042|Ga0302300_1080360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1001 | Open in IMG/M |
| 3300030054|Ga0302182_10010816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 4145 | Open in IMG/M |
| 3300030056|Ga0302181_10061177 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300030503|Ga0311370_10125439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3580 | Open in IMG/M |
| 3300031549|Ga0318571_10024321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1621 | Open in IMG/M |
| 3300031561|Ga0318528_10078662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1707 | Open in IMG/M |
| 3300031708|Ga0310686_103168834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300031708|Ga0310686_112087660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2571 | 625 | Open in IMG/M |
| 3300031713|Ga0318496_10391887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
| 3300031736|Ga0318501_10275008 | Not Available | 895 | Open in IMG/M |
| 3300031795|Ga0318557_10083766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1393 | Open in IMG/M |
| 3300031799|Ga0318565_10189583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 1000 | Open in IMG/M |
| 3300031823|Ga0307478_10378944 | Not Available | 1169 | Open in IMG/M |
| 3300031835|Ga0318517_10217776 | Not Available | 861 | Open in IMG/M |
| 3300031879|Ga0306919_10251897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1329 | Open in IMG/M |
| 3300031890|Ga0306925_11436319 | Not Available | 679 | Open in IMG/M |
| 3300031894|Ga0318522_10168060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
| 3300031897|Ga0318520_10541229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300032043|Ga0318556_10738430 | Not Available | 512 | Open in IMG/M |
| 3300032044|Ga0318558_10536706 | Not Available | 584 | Open in IMG/M |
| 3300032065|Ga0318513_10082916 | Not Available | 1482 | Open in IMG/M |
| 3300032066|Ga0318514_10573199 | Not Available | 601 | Open in IMG/M |
| 3300032089|Ga0318525_10681006 | Not Available | 523 | Open in IMG/M |
| 3300032160|Ga0311301_11716552 | Not Available | 754 | Open in IMG/M |
| 3300032770|Ga0335085_10010715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13681 | Open in IMG/M |
| 3300032783|Ga0335079_11946976 | Not Available | 568 | Open in IMG/M |
| 3300032805|Ga0335078_10414868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1761 | Open in IMG/M |
| 3300032892|Ga0335081_10207384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2703 | Open in IMG/M |
| 3300033158|Ga0335077_11201339 | Not Available | 742 | Open in IMG/M |
| 3300033433|Ga0326726_11982394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus elymi | 567 | Open in IMG/M |
| 3300033805|Ga0314864_0034849 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.75% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.20% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.43% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.33% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 2.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.78% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.78% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.78% | |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001408 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 | Environmental | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_01889630 | 2124908016 | MTNVTTGQDQDAAELSAADEQVLRELTERARAGGMKLTGEGGCWAS | |
| FD1_08459680 | 2170459024 | Grass Soil | MTDVTEDRGQAGAELSAADEQVLRELTERARAGGREADR |
| FD2_07448660 | 2189573001 | Grass Soil | HLMTDVTKDRGQAGVELSAADEQLVRELTERARAEGLKLTGPAGCWAR |
| FD2_01097590 | 2189573001 | Grass Soil | MTDVTENRGQAEAELSAADEQVLRELTERARTGGLR |
| JGI20206J14855_10408791 | 3300001408 | Arctic Peat Soil | VTDVTTSQAHDGGELPAADEQLLRELTERARAGGLKL |
| Ga0055455_100532901 | 3300003990 | Natural And Restored Wetlands | MADVTADEAQESAALSAADEQLLRELTERALVGELALGGV |
| Ga0070714_1004206732 | 3300005435 | Agricultural Soil | MTDVTENRGQAEAELSAADEQLLRELTERARTGGLRPPGRP* |
| Ga0070706_1016141962 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDVTNMQEQVGAELPAADEQLLRELTERARTGGLQLTGEGGL |
| Ga0070684_1022090651 | 3300005535 | Corn Rhizosphere | VTDVMNGQVPDGAKLSAADEQVLRELTERARSGGLKLTGEGGLL |
| Ga0070733_105223141 | 3300005541 | Surface Soil | MTDVTQDRGQDGPELSAADEQLLRELTERARAGGLK |
| Ga0066701_102679672 | 3300005552 | Soil | MTDVTVDRDQAGPELSAADEQVLRELTERARAGRLRLTGEGGLLGRL |
| Ga0068857_1001213216 | 3300005577 | Corn Rhizosphere | VTDVTTGEAGELGLSAAEEQLLRELTGRARASGLKLTGEGACWASSPRW* |
| Ga0070761_105777802 | 3300005591 | Soil | MTDVTEDRDQAGAELSAADEQVLRELTERARAGGLKLSGP |
| Ga0070761_107501292 | 3300005591 | Soil | VTDVVNGQGEDIAELSAADQQVLREMAGRARAGGLKLTGEGGLL |
| Ga0080026_101119483 | 3300005952 | Permafrost Soil | VTDVTTSQGHDGAELPAADEQLLRELTGRARAGGLKLTGE |
| Ga0075017_1012091451 | 3300006059 | Watersheds | MTDVTEDRGQDGVVLSAADEQLLRELTERARTGGLKLTGEG |
| Ga0075014_1009413992 | 3300006174 | Watersheds | VTDVTEDRDQAGAELSAADEQLLRELTERARTGGLKLTGEG |
| Ga0066659_117474302 | 3300006797 | Soil | VTDVTTGQDQEPAELSAADEQVLRELTERARTGGLELTG |
| Ga0079221_100211631 | 3300006804 | Agricultural Soil | VTDVTTSQEQGREPVELAAADEQVLRELTERARAGGLKLT |
| Ga0073928_105655551 | 3300006893 | Iron-Sulfur Acid Spring | VTEVTTGPGREPAELPAADEQLLRELTERARTGGLKLTG |
| Ga0075436_1004366582 | 3300006914 | Populus Rhizosphere | MTDMTNRTNRDVAGMSAADEQLLRELTERARAEGLK |
| Ga0099829_111657482 | 3300009038 | Vadose Zone Soil | MEETPVTDVTTDNDQAPVELSAGDEQVLRELTERART |
| Ga0099829_114796233 | 3300009038 | Vadose Zone Soil | MEETPVTDVTTDNDQAPVELSAGDEQVLRELTERARTG |
| Ga0099827_100802322 | 3300009090 | Vadose Zone Soil | VTDVTIGKGQDPVELSAADEQLLHELAERARTGGLR* |
| Ga0116214_13326572 | 3300009520 | Peatlands Soil | VTQDRDQDSADLSAADEQLLRELTKPARAGGVKLTSEAAC* |
| Ga0116218_11632521 | 3300009522 | Peatlands Soil | MTDVTEDRDQAGAELSAADEQVLRELTERARTGGREHSGPRVTRA* |
| Ga0116218_12815413 | 3300009522 | Peatlands Soil | MTDVTEDRDQAGAELAAADEQVLRELTERARTGGLKLTGEDG |
| Ga0116225_15541481 | 3300009524 | Peatlands Soil | MEETPVTDVTTDNGQAPVELSAADEQVLRELTDRARAGG |
| Ga0116220_102057521 | 3300009525 | Peatlands Soil | VTQDRDQDSADLSAADEQLLRELTKPARAGGVKLTGEAAC* |
| Ga0116217_100965034 | 3300009700 | Peatlands Soil | MEETPVTDVTTDNGQAPVELSAADEQVLRELTDRARAGGLRLTG |
| Ga0126380_102888601 | 3300010043 | Tropical Forest Soil | VTDVTNGHDQSVELTAADEQLLLELTGRARSGGLKLTGEGRLLGKLTKMVEGAL |
| Ga0126382_115376132 | 3300010047 | Tropical Forest Soil | VTDVTTSQDREQPGLSAADEQVLRELTERARAGGL |
| Ga0074046_107123541 | 3300010339 | Bog Forest Soil | VTDVTRNQDQAEAELSAADEQVLHELTERARTGGLKLT |
| Ga0126370_101494593 | 3300010358 | Tropical Forest Soil | MGETPVTDVTTGWDQEQPELSAADEQLLRELTERAR |
| Ga0126372_119404752 | 3300010360 | Tropical Forest Soil | MEETLVTDVTRSQDQDRPELSAADEQLLRELTERARAGGLKLTGE |
| Ga0126378_1001022110 | 3300010361 | Tropical Forest Soil | VTDVTIISGQDGEELSAADRQLLAELAERARAGGLKLTG |
| Ga0126377_119049852 | 3300010362 | Tropical Forest Soil | MTDVTKDKVGSELSAADEQVLRELTGRARRGGLKLTGEGGLL |
| Ga0126381_1003316205 | 3300010376 | Tropical Forest Soil | MTDVTQDRGQAGVELSAADEQLVRELTERARAEGLKLTGPG |
| Ga0126383_126080512 | 3300010398 | Tropical Forest Soil | MTDVAVGGAGQPALSAADEQLLRELTERARAGGLKLTGEGGL |
| Ga0150983_104546031 | 3300011120 | Forest Soil | MTDVTENRGRAEAELSAADEQLLRELTERARTGGLRPPGRP* |
| Ga0137391_106006482 | 3300011270 | Vadose Zone Soil | VTDVTTGQGQKPAGPSAADEQLLRELTERARVGGLKLTGEGGLPL |
| Ga0137391_113793873 | 3300011270 | Vadose Zone Soil | MTDVTEDRGQADEQVLRELTERARTGGLRLAGEGGL |
| Ga0137388_119423951 | 3300012189 | Vadose Zone Soil | MQDRDRVELSAADEQLLRELTDRARTGGLQLTGEGGLL |
| Ga0137364_109324971 | 3300012198 | Vadose Zone Soil | VTDVTNSESPDRAELSAADEQLLRELTGRARTGGLQLTGEGGL |
| Ga0137383_112239901 | 3300012199 | Vadose Zone Soil | VTDVTEDRDQAIAELSAADERVLRELTERARAGGLKLTGE |
| Ga0137382_110967151 | 3300012200 | Vadose Zone Soil | VAENRDQAEAELPAADEQVLRELTGRPRAGGLKLTGPGGLPGKLTKMVV |
| Ga0137365_102160902 | 3300012201 | Vadose Zone Soil | VTDVTNSENQSAVELPAADEQLSRELTERAARAG* |
| Ga0137363_100865293 | 3300012202 | Vadose Zone Soil | MTDVTENRGQAETELSAADEQLLRELTERARTSGPGRAGCG* |
| Ga0137379_100337731 | 3300012209 | Vadose Zone Soil | MEETPVTDVTTSHDEDGAELSAADEQLLRELTERARAGGL |
| Ga0137378_100819081 | 3300012210 | Vadose Zone Soil | MMSVTDSADVTASQQDAAPPVLTAADEQLLRELTERAREGG |
| Ga0137387_107295231 | 3300012349 | Vadose Zone Soil | VTDVTQERDQAGAELSAADEQVLRELTERARTGGLKLT |
| Ga0137367_104095151 | 3300012353 | Vadose Zone Soil | MEETPVTDVTTGQGQGPVELSAADEQVLRELTERARAGG |
| Ga0137366_105630462 | 3300012354 | Vadose Zone Soil | VTDVTTGQDQEPAELSPADEQVLRELTERARTGGLKLTGEG |
| Ga0137371_105656751 | 3300012356 | Vadose Zone Soil | VTDVTAGESRSQAELPAADEQVLRELTERARAGGLR |
| Ga0137371_109412532 | 3300012356 | Vadose Zone Soil | VTDVTQERDQAGAELSAADEQVLRELTERARTGGLKLTG |
| Ga0137384_109667841 | 3300012357 | Vadose Zone Soil | VTDVTTRQDRAAVELPAADEQLLHELTERAREGGLRLTGEG |
| Ga0137375_1000624515 | 3300012360 | Vadose Zone Soil | MEETPVTDVTTGQGQGPVELSAADEQVLRELTERARA |
| Ga0137390_119512831 | 3300012363 | Vadose Zone Soil | VTDVTIDPGQDGAELSAADEQLLRELTERARTGGLQLT |
| Ga0137407_101770411 | 3300012930 | Vadose Zone Soil | VTDVTTSQDQDTAELSAADELVLREVTERARAGGLRLTGEG |
| Ga0182041_104283471 | 3300016294 | Soil | VTDVTQDRDQAGAELPAADEQVLRELTERARAGGLK |
| Ga0182032_119628311 | 3300016357 | Soil | VTDMTIRQDQDGVELSAADEQLLHELTERARTGGLKLTGEGGLL |
| Ga0182038_109461102 | 3300016445 | Soil | MTDVKTDQDQAELELSAADEQLVRELTERARAGGLKL |
| Ga0187877_11748431 | 3300017931 | Peatland | VTDVTENRDRAEAELSAADEQVLRELTERARTGGLKLTGE |
| Ga0187809_100716671 | 3300017937 | Freshwater Sediment | MTDATEDRDQAGAELSAADEQLLRELTDRARTGGLKLTGE |
| Ga0187817_102391381 | 3300017955 | Freshwater Sediment | VTDVTIGQGQDGEELSAAEEQVLRELTERARAGGLKLTGE |
| Ga0187779_104381972 | 3300017959 | Tropical Peatland | MTDVTTGPGQDEVGLSAADEQLLRELTERAAPAGCS |
| Ga0187783_104514531 | 3300017970 | Tropical Peatland | VTDVTTGQNQDEPQLSAADEQVLRELAERARVGGLKLTGEGGL |
| Ga0187815_101029901 | 3300018001 | Freshwater Sediment | MTDVTTNGPQEPAGLSAADEQLLRELTERARAGGLK |
| Ga0187815_101705191 | 3300018001 | Freshwater Sediment | MTDMTTDLGQDEVELSAADEQLLLELTERARAGGLKLSGK |
| Ga0187815_103467992 | 3300018001 | Freshwater Sediment | MTDVTTDQVRDEVELSAADEQLVRELTERARTGGLKLT |
| Ga0187885_104262901 | 3300018025 | Peatland | MTDVTEDRSQAEAELSAADEQVLRELTERARTGGLK |
| Ga0187851_100508441 | 3300018046 | Peatland | MTDVTEDRSQAEAELSAADEQVLRELTERARTGGLKLTGQGGLLGRL |
| Ga0187772_110715921 | 3300018085 | Tropical Peatland | MTDVAEDRNQAAAELSAADEQVLRELTERARTGGLKLTGEGGL |
| Ga0187771_103977802 | 3300018088 | Tropical Peatland | MTDVTKDRDQAELELSAADEQLVRELTERARAGGLKLTGE |
| Ga0066669_124247481 | 3300018482 | Grasslands Soil | VTDVTAGQGQDGAELSAADEQLLRELTERARAGGLK |
| Ga0210401_101345291 | 3300020583 | Soil | MTEVTEDRDQAGAGLSAADEQVLRELTERARAGGLKLSGPG |
| Ga0210406_103852532 | 3300021168 | Soil | MTDVTENRGQAAAELSAADEQLLRELTERARTGGLRPPGRP |
| Ga0213881_100041821 | 3300021374 | Exposed Rock | MTDVTQDRDQAGAELSAGDEQVLRELTERARASGLKLTGEG |
| Ga0210385_105481602 | 3300021402 | Soil | VTDVAEDRDQDGAGLSAADEQVLRELTERARAGGL |
| Ga0210397_103549032 | 3300021403 | Soil | MTDVTENRGQAEAELSAADEQLLRELTERARTRGLRPPGRP |
| Ga0210410_112899482 | 3300021479 | Soil | VTDVAEDRDQDGAGLSAADEQVLRELTERARAGGLKLSGPGGLLGK |
| Ga0126371_100716781 | 3300021560 | Tropical Forest Soil | VTDVRTSRAREAVELSPADEQLLRELTERARTGGLKLTGEG |
| Ga0126371_136921241 | 3300021560 | Tropical Forest Soil | VTDVTQERDQAGAELSAADEQVLRELTERARTGGLKLTGEGGLLG |
| Ga0207684_103999663 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DVTTDQDQGGAGLPAADEQLLRELTERARGRAAADW |
| Ga0207646_101839535 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDVTQERDQAGAELSAADEQVLRELTERARTGGLKL |
| Ga0207646_102916132 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDVTENRGQAEALSAADEQLLRELTERARTGGLRLTGEGCSAG |
| Ga0207700_104918631 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MADVTSSQEQDREPVELSAADEQLLRELTERARTGGLKLTG |
| Ga0209239_10532021 | 3300026310 | Grasslands Soil | VTDVTASKDQEQPELSAADEQLLRELTEWARTGGLQLT |
| Ga0179587_109750372 | 3300026557 | Vadose Zone Soil | VTDVTIDPGQDGAGFSAADEQLLRELTERARTGGL |
| Ga0208324_12174391 | 3300027604 | Peatlands Soil | MTDVTEDRGQAGAELSAADEQLLRELTERARTGGLKLTGE |
| Ga0209177_100151851 | 3300027775 | Agricultural Soil | VTDVTSSQKPEREPVLSAADERLLQELTERARTGGVKLTG |
| Ga0209177_100564762 | 3300027775 | Agricultural Soil | VTDVTQNQDRAETELSAADEQVLRELTERARTGGLKLTGEG |
| Ga0209067_108425431 | 3300027898 | Watersheds | MTDVTEDRDQDGAEMSAADEQLLRELTERARVGGLKLTGEGGLLGK |
| Ga0209526_100231281 | 3300028047 | Forest Soil | VTDVTTSPGQDGAELSAADEQLLRELTERARTGGLQLT |
| Ga0265319_10062875 | 3300028563 | Rhizosphere | MTDVTTDAGQEPGGLSAADEQLLRELTERARAGGLKLT |
| Ga0302301_10153385 | 3300028731 | Palsa | MTDVTQDRDQAGPELSAADEQVLRELTERARTGGLSAAG |
| Ga0311352_104028152 | 3300029944 | Palsa | MTDVTEDRDQAGAELSAADEQVLRELTERAREGGLKLTGEGGLL |
| Ga0311371_103247601 | 3300029951 | Palsa | VTDVTEDRDQAGAELSAADEQVLRELTERTRAGGLKLSGPGGLLGKLT |
| Ga0302300_10803601 | 3300030042 | Palsa | MTDVTQDRDQAGAELSVADEQVLRELTDPARARHET |
| Ga0302182_100108163 | 3300030054 | Palsa | MTDVTQDRDQAGAGLSAADEQVLRELTERARTGGLSAAG |
| Ga0302181_100611771 | 3300030056 | Palsa | MTDVTQDRDQAGPELSAADEQVLRELTERARTGGL |
| Ga0311370_101254391 | 3300030503 | Palsa | VTDVTEDRDQAGVELSAADEQVLRELTERARAGGLKLSGPG |
| Ga0318571_100243211 | 3300031549 | Soil | MTDVTQNRDQDGAELSAADEQLLRELTERARADGLKLTGEDGL |
| Ga0318528_100786621 | 3300031561 | Soil | VTDVTKSQDLEQPELCAADEQLLRELTERARTGGLKMT |
| Ga0310686_1031688341 | 3300031708 | Soil | VTDVTTTGQDQVPVQLSAADEQVLRELTERARTGGLKLTGEGG |
| Ga0310686_1120876602 | 3300031708 | Soil | VTDVTQDRDRAGAELSAADEQVLRELTERARTGGLKLTGQAGCWAG |
| Ga0318496_103918872 | 3300031713 | Soil | MTDVTEDRPQDEPQLSAADEQVLRELTERARTGGLTLTGE |
| Ga0318501_102750082 | 3300031736 | Soil | VTDVTKSQDREQPELSAADEQLLRELTERARAGGLKLTGEGAL |
| Ga0318557_100837663 | 3300031795 | Soil | VTDNQGQASAELTAADEQLLRELTERARSGGLKLTRE |
| Ga0318565_101895832 | 3300031799 | Soil | MTDVTEDRDQDGVELSAADEQLLRELTDRARTGGLKLTGEGGLLG |
| Ga0307478_103789442 | 3300031823 | Hardwood Forest Soil | EIYIPVTYVTTGQDVAELSAADAQLLRELTERAGSS |
| Ga0318517_102177761 | 3300031835 | Soil | VTDVTTGQDQEQPELSAADERLLRELTERARTGGLK |
| Ga0306919_102518971 | 3300031879 | Soil | MTDVTEDRDPAGAELSAADEQVLRELTERARTGGLKLTG |
| Ga0306925_114363191 | 3300031890 | Soil | VTDVTDNQGQASAELTAADEQLLSELTERARSGGLKLTGEGCLLG |
| Ga0318522_101680602 | 3300031894 | Soil | VTDVTKSQGQEQPELSAADERLLRELTERARTGGLKLTG |
| Ga0318520_105412291 | 3300031897 | Soil | VTDVTKSQDLEQPELCAADEQLLRELTERARTGGLKMTGEGRLLGKLTKM |
| Ga0318556_107384301 | 3300032043 | Soil | MTDVTQDRGQDGAELSAADVQLLRELTERARAGGLKLTGEGGLLG |
| Ga0318558_105367061 | 3300032044 | Soil | VTDVTKSQDREQPELSAADEQLLRELTERARAGGLKLTGEGALL |
| Ga0318513_100829162 | 3300032065 | Soil | VTDVTKSQDREQPELSAADEQLLRELTERARAGGL |
| Ga0318514_105731991 | 3300032066 | Soil | VTDATDNQGQASAELTAADEQLLSELTERARSGGLKL |
| Ga0318525_106810061 | 3300032089 | Soil | MTDVTTDEGQEPALSAADEQLLRELTERARAGGLK |
| Ga0311301_117165522 | 3300032160 | Peatlands Soil | VTQDRDQDSADLSAADEQLLRELTKPARAGGVKLTSEAAC |
| Ga0335085_100107155 | 3300032770 | Soil | VTDVTENRDQAEAELSAADEQVLRELTERASRRAGRAG |
| Ga0335079_119469762 | 3300032783 | Soil | VTDVTNGQGPAPAGLSAADEQVLRELTERARTGGLKLTGEG |
| Ga0335078_104148681 | 3300032805 | Soil | VTDVTTGRDEGGAELSAADEQLLRELTERARTGGLKLTGEG |
| Ga0335081_102073844 | 3300032892 | Soil | VTDVTNDQGPAPAELSAADEQVLRELTERARTGGLTLTGRAGYWGN |
| Ga0335077_112013392 | 3300033158 | Soil | MTHVTTDEGRDEVELSAADEQLLLELTERARTGGLKLTGEGGLLG |
| Ga0326726_119823941 | 3300033433 | Peat Soil | VTDVTTGRDQEPAELSAADEQVLRELTERARTGGLKLTGEGGLL |
| Ga0314864_0034849_1003_1107 | 3300033805 | Peatland | MTDVTTDQDQAELELSAADEQLVRELTERARAGGL |
| ⦗Top⦘ |