| Basic Information | |
|---|---|
| Family ID | F063937 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MRARTARWVAGCAAAGSVALIGGELALAYVDRHLVPASLTGWTVS |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.48 % |
| % of genes near scaffold ends (potentially truncated) | 93.80 % |
| % of genes from short scaffolds (< 2000 bps) | 83.72 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.039 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.233 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.256 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.062 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF01791 | DeoC | 6.20 |
| PF03006 | HlyIII | 3.10 |
| PF08349 | DUF1722 | 2.33 |
| PF01594 | AI-2E_transport | 2.33 |
| PF12697 | Abhydrolase_6 | 2.33 |
| PF02687 | FtsX | 1.55 |
| PF01370 | Epimerase | 1.55 |
| PF07883 | Cupin_2 | 1.55 |
| PF13683 | rve_3 | 1.55 |
| PF00378 | ECH_1 | 1.55 |
| PF00486 | Trans_reg_C | 1.55 |
| PF01546 | Peptidase_M20 | 1.55 |
| PF06736 | TMEM175 | 1.55 |
| PF07876 | Dabb | 0.78 |
| PF13411 | MerR_1 | 0.78 |
| PF13304 | AAA_21 | 0.78 |
| PF00406 | ADK | 0.78 |
| PF13358 | DDE_3 | 0.78 |
| PF00484 | Pro_CA | 0.78 |
| PF11716 | MDMPI_N | 0.78 |
| PF01872 | RibD_C | 0.78 |
| PF00753 | Lactamase_B | 0.78 |
| PF02518 | HATPase_c | 0.78 |
| PF08241 | Methyltransf_11 | 0.78 |
| PF07730 | HisKA_3 | 0.78 |
| PF01812 | 5-FTHF_cyc-lig | 0.78 |
| PF07366 | SnoaL | 0.78 |
| PF01425 | Amidase | 0.78 |
| PF13460 | NAD_binding_10 | 0.78 |
| PF04978 | DUF664 | 0.78 |
| PF00589 | Phage_integrase | 0.78 |
| PF12146 | Hydrolase_4 | 0.78 |
| PF00665 | rve | 0.78 |
| PF13556 | HTH_30 | 0.78 |
| PF00581 | Rhodanese | 0.78 |
| PF05016 | ParE_toxin | 0.78 |
| PF01329 | Pterin_4a | 0.78 |
| PF02909 | TetR_C_1 | 0.78 |
| PF00196 | GerE | 0.78 |
| PF10590 | PNP_phzG_C | 0.78 |
| PF05532 | CsbD | 0.78 |
| PF13088 | BNR_2 | 0.78 |
| PF00106 | adh_short | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 3.10 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 2.33 |
| COG3272 | Uncharacterized conserved protein YbgA, DUF1722 family | Function unknown [S] | 2.33 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 1.55 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.78 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.78 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.78 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.78 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.78 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.78 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.78 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.78 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.78 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.78 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.78 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.78 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.78 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.78 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.04 % |
| Unclassified | root | N/A | 44.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF01AQB7R | Not Available | 522 | Open in IMG/M |
| 3300000956|JGI10216J12902_114948462 | Not Available | 606 | Open in IMG/M |
| 3300003219|JGI26341J46601_10104642 | Not Available | 822 | Open in IMG/M |
| 3300004016|Ga0058689_10060167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300005332|Ga0066388_108414491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300005332|Ga0066388_108550539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas putida group → Pseudomonas putida | 509 | Open in IMG/M |
| 3300005344|Ga0070661_100787716 | Not Available | 779 | Open in IMG/M |
| 3300005436|Ga0070713_100118145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2321 | Open in IMG/M |
| 3300005437|Ga0070710_10034220 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
| 3300005439|Ga0070711_101340430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300005457|Ga0070662_100064317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2686 | Open in IMG/M |
| 3300005471|Ga0070698_100201357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1927 | Open in IMG/M |
| 3300005534|Ga0070735_10469834 | Not Available | 750 | Open in IMG/M |
| 3300005534|Ga0070735_10728028 | Not Available | 586 | Open in IMG/M |
| 3300005536|Ga0070697_101862767 | Not Available | 538 | Open in IMG/M |
| 3300005537|Ga0070730_10004243 | All Organisms → cellular organisms → Bacteria | 12658 | Open in IMG/M |
| 3300005610|Ga0070763_10353014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. JS623 | 819 | Open in IMG/M |
| 3300005764|Ga0066903_108448312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
| 3300005842|Ga0068858_102179077 | Not Available | 548 | Open in IMG/M |
| 3300006028|Ga0070717_10530877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Tersicoccus | 1065 | Open in IMG/M |
| 3300006028|Ga0070717_11007537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7 | 759 | Open in IMG/M |
| 3300006028|Ga0070717_11465439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300006052|Ga0075029_101166435 | Not Available | 537 | Open in IMG/M |
| 3300006175|Ga0070712_100073086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2458 | Open in IMG/M |
| 3300006175|Ga0070712_101687069 | Not Available | 554 | Open in IMG/M |
| 3300006604|Ga0074060_11274020 | Not Available | 512 | Open in IMG/M |
| 3300006806|Ga0079220_11724209 | Not Available | 549 | Open in IMG/M |
| 3300006854|Ga0075425_100134589 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
| 3300006854|Ga0075425_102012337 | Not Available | 646 | Open in IMG/M |
| 3300006871|Ga0075434_100127046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2566 | Open in IMG/M |
| 3300009089|Ga0099828_11424062 | Not Available | 612 | Open in IMG/M |
| 3300009162|Ga0075423_10143509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2507 | Open in IMG/M |
| 3300009162|Ga0075423_12514079 | Not Available | 562 | Open in IMG/M |
| 3300010043|Ga0126380_10138621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1536 | Open in IMG/M |
| 3300010043|Ga0126380_10344450 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300010048|Ga0126373_12046235 | Not Available | 635 | Open in IMG/M |
| 3300010360|Ga0126372_12712628 | Not Available | 547 | Open in IMG/M |
| 3300010375|Ga0105239_10329460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1722 | Open in IMG/M |
| 3300010375|Ga0105239_11607173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 752 | Open in IMG/M |
| 3300010375|Ga0105239_11820828 | Not Available | 705 | Open in IMG/M |
| 3300010397|Ga0134124_11914309 | Not Available | 629 | Open in IMG/M |
| 3300010398|Ga0126383_13086323 | Not Available | 544 | Open in IMG/M |
| 3300011119|Ga0105246_11184976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300012201|Ga0137365_10034937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3851 | Open in IMG/M |
| 3300012201|Ga0137365_11365619 | Not Available | 500 | Open in IMG/M |
| 3300012208|Ga0137376_10281753 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300012944|Ga0137410_11759279 | Not Available | 546 | Open in IMG/M |
| 3300012955|Ga0164298_10391570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 895 | Open in IMG/M |
| 3300012985|Ga0164308_10737776 | Not Available | 853 | Open in IMG/M |
| 3300013100|Ga0157373_10632041 | Not Available | 781 | Open in IMG/M |
| 3300016294|Ga0182041_10450658 | Not Available | 1106 | Open in IMG/M |
| 3300016422|Ga0182039_10062366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2594 | Open in IMG/M |
| 3300017942|Ga0187808_10162816 | Not Available | 986 | Open in IMG/M |
| 3300017959|Ga0187779_10962339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
| 3300017966|Ga0187776_10161487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium subroseum | 1385 | Open in IMG/M |
| 3300017972|Ga0187781_10209003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1377 | Open in IMG/M |
| 3300017974|Ga0187777_10868440 | Not Available | 647 | Open in IMG/M |
| 3300017999|Ga0187767_10227222 | Not Available | 603 | Open in IMG/M |
| 3300018001|Ga0187815_10399189 | Not Available | 585 | Open in IMG/M |
| 3300018058|Ga0187766_10294533 | Not Available | 1049 | Open in IMG/M |
| 3300018064|Ga0187773_10592877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 676 | Open in IMG/M |
| 3300018089|Ga0187774_10075413 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300018433|Ga0066667_10036756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2822 | Open in IMG/M |
| 3300018433|Ga0066667_10059637 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300020581|Ga0210399_10768596 | Not Available | 788 | Open in IMG/M |
| 3300020582|Ga0210395_10503164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia pini | 912 | Open in IMG/M |
| 3300021171|Ga0210405_10281432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. Ae356_Ps1 | 1315 | Open in IMG/M |
| 3300021171|Ga0210405_10536032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 915 | Open in IMG/M |
| 3300021377|Ga0213874_10232050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300021401|Ga0210393_10519863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 972 | Open in IMG/M |
| 3300021404|Ga0210389_10236216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1429 | Open in IMG/M |
| 3300021404|Ga0210389_11292032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 559 | Open in IMG/M |
| 3300021405|Ga0210387_11305792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Tersicoccus | 627 | Open in IMG/M |
| 3300021406|Ga0210386_11337761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300021407|Ga0210383_11287150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 612 | Open in IMG/M |
| 3300021407|Ga0210383_11775014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300021420|Ga0210394_10297364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1416 | Open in IMG/M |
| 3300021432|Ga0210384_10792899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 845 | Open in IMG/M |
| 3300021478|Ga0210402_10277773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1549 | Open in IMG/M |
| 3300021560|Ga0126371_11732211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 748 | Open in IMG/M |
| 3300022724|Ga0242665_10282053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300025898|Ga0207692_11113094 | Not Available | 523 | Open in IMG/M |
| 3300025906|Ga0207699_10092404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1902 | Open in IMG/M |
| 3300025916|Ga0207663_10012667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4566 | Open in IMG/M |
| 3300025916|Ga0207663_10315637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1173 | Open in IMG/M |
| 3300025929|Ga0207664_10038773 | All Organisms → cellular organisms → Bacteria | 3696 | Open in IMG/M |
| 3300027029|Ga0208731_1004015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1370 | Open in IMG/M |
| 3300027080|Ga0208237_1023327 | Not Available | 932 | Open in IMG/M |
| 3300027521|Ga0209524_1035376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1047 | Open in IMG/M |
| 3300028807|Ga0307305_10533929 | Not Available | 524 | Open in IMG/M |
| 3300028828|Ga0307312_10360289 | Not Available | 952 | Open in IMG/M |
| 3300028906|Ga0308309_10493148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
| 3300030013|Ga0302178_10299851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 739 | Open in IMG/M |
| 3300030490|Ga0302184_10175401 | Not Available | 914 | Open in IMG/M |
| 3300030706|Ga0310039_10343252 | Not Available | 558 | Open in IMG/M |
| 3300031640|Ga0318555_10657077 | Not Available | 567 | Open in IMG/M |
| 3300031668|Ga0318542_10659318 | Not Available | 547 | Open in IMG/M |
| 3300031679|Ga0318561_10009623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4161 | Open in IMG/M |
| 3300031680|Ga0318574_10532390 | Not Available | 689 | Open in IMG/M |
| 3300031719|Ga0306917_11573934 | Not Available | 505 | Open in IMG/M |
| 3300031744|Ga0306918_10141393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1768 | Open in IMG/M |
| 3300031747|Ga0318502_10532990 | Not Available | 705 | Open in IMG/M |
| 3300031748|Ga0318492_10081895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1562 | Open in IMG/M |
| 3300031748|Ga0318492_10294572 | Not Available | 844 | Open in IMG/M |
| 3300031751|Ga0318494_10395575 | Not Available | 801 | Open in IMG/M |
| 3300031754|Ga0307475_10191672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1633 | Open in IMG/M |
| 3300031778|Ga0318498_10321418 | Not Available | 693 | Open in IMG/M |
| 3300031779|Ga0318566_10278392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 828 | Open in IMG/M |
| 3300031793|Ga0318548_10072652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1611 | Open in IMG/M |
| 3300031799|Ga0318565_10317068 | Not Available | 757 | Open in IMG/M |
| 3300031805|Ga0318497_10528704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300031833|Ga0310917_10565188 | Not Available | 773 | Open in IMG/M |
| 3300031835|Ga0318517_10053803 | Not Available | 1692 | Open in IMG/M |
| 3300031835|Ga0318517_10583581 | Not Available | 502 | Open in IMG/M |
| 3300031879|Ga0306919_10073251 | Not Available | 2340 | Open in IMG/M |
| 3300031897|Ga0318520_10807931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300031947|Ga0310909_10808136 | Not Available | 774 | Open in IMG/M |
| 3300031954|Ga0306926_10963913 | Not Available | 1017 | Open in IMG/M |
| 3300031981|Ga0318531_10590920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 503 | Open in IMG/M |
| 3300032054|Ga0318570_10042351 | Not Available | 1860 | Open in IMG/M |
| 3300032060|Ga0318505_10031866 | Not Available | 2156 | Open in IMG/M |
| 3300032063|Ga0318504_10621203 | Not Available | 519 | Open in IMG/M |
| 3300032064|Ga0318510_10222173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → unclassified Streptomycetaceae → Streptomycetaceae bacterium | 769 | Open in IMG/M |
| 3300032065|Ga0318513_10025551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2512 | Open in IMG/M |
| 3300032180|Ga0307471_103278289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300033158|Ga0335077_11141588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_00233080 | 2189573002 | Grass Soil | MRVRTARWVAGGVAVVSVALIVAALALAYVDRHLPAGRTAW |
| JGI10216J12902_1149484621 | 3300000956 | Soil | MRVLTARWVAGCIAAGSIALVAGALVLEYVDRDLLPASMTGW |
| JGI26341J46601_101046423 | 3300003219 | Bog Forest Soil | MRARTARWVAGCAAAGSLALMVGGLILAYVDRHLVPAHVTN |
| Ga0058689_100601672 | 3300004016 | Agave | MRVRTARRVAGCAAAVSAALMIGALALAYVDRHRVPAGLTGWN |
| Ga0066388_1084144912 | 3300005332 | Tropical Forest Soil | MRARTARWVAGCAAVVSVALIGGGLVLACVDRALVPVSLTGWTFSNVSG |
| Ga0066388_1085505391 | 3300005332 | Tropical Forest Soil | MPVRARPARWVPGCAAAGSVALIGGELALAYLDRHLLPASLTGWTFSGIFTQVVNVA |
| Ga0070661_1007877161 | 3300005344 | Corn Rhizosphere | MRVLTARSVAGCVAAASVMLGFGGLALAYVDRHLLPAGLTNWDF |
| Ga0070713_1001181451 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLTARSVAGCAAAASVTLGFGGLALAYVDRHLLPARLTNWDFSYVIWEVVSLA |
| Ga0070710_100342204 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRARTARLVAGCAAAASVMLGLGALSLAYVDCHLVPARLTQWFL* |
| Ga0070711_1013404301 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVQTSRWVAGCAAAVSVALIAGALVLAYADRRLLPADLTGWNFSDVFDGVANLA |
| Ga0070662_1000643171 | 3300005457 | Corn Rhizosphere | MRSRTVRWAAGCAAVGSVALGAAALALGYVDRHRVPAGLTAWDFS |
| Ga0070698_1002013575 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRARTARWVTGCAAAVSVALIGGGLVLAYMDRHLVPASLTDWTVSNISGQVVNVAVPVAGFV |
| Ga0070735_104698341 | 3300005534 | Surface Soil | MRARTAGLVAGCVAAGSLALMAGGLFLAYVDRHLVPASLTYWDFSDVF |
| Ga0070735_107280281 | 3300005534 | Surface Soil | VRARMARLVAGCAAAGSLALMAGGLILTYVDRHLVPAGMAGWDVSD |
| Ga0070697_1018627673 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVQTSRWVAGCAAAVSVALIAGALVLAYADRRLLPADLTGWNFS |
| Ga0070730_1000424312 | 3300005537 | Surface Soil | MRVRTARWVAGCSAAGSVALIGGGLALAYVDRKLVPASLVG* |
| Ga0070763_103530141 | 3300005610 | Soil | MRARTARWVAGCAAAGSVALLGAGLVLAYVDRHLVPASLANWTVSNISGQVV |
| Ga0066903_1084483121 | 3300005764 | Tropical Forest Soil | MRARTAGWVAGGIAVGSLALMAAGMALAYVDRHALPA |
| Ga0068858_1021790771 | 3300005842 | Switchgrass Rhizosphere | MRVLTARWVAGCAAAASVALEFGGLALAYVDRHLLPARLTTWDFSDVFG |
| Ga0070717_105308772 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAQTAQWVAGCTAAGSVALIGGGVALAYLNRQLVPASLTGWTVSNISEQVVN |
| Ga0070717_110075371 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLTARWVAGCAAAASVTLELGGLALAYVDRHLLPARLTTWDFSDVFG |
| Ga0070717_114654393 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVQTSRWVAGCAAAVSVALIAGAPVLAYADRRLLPADLTGWNFSDVFDGV |
| Ga0075029_1011664351 | 3300006052 | Watersheds | MAVTGGRDIQVRARTARWVAGCVAAVSVALIGSGLVLAYAHRHLAPASMTGWTVSNISAQVV |
| Ga0070712_1000730866 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLTARWVAGCAAGMSVAVIAGGLAWAYVDRHLVPADMMRWNISDAFGEVVNLAI |
| Ga0070712_1016870691 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGMAMRVLTVRWVAGCAAVGSVVLGAGALALAYVDRHRVPAGLTAWDF |
| Ga0074060_112740201 | 3300006604 | Soil | MRVLTARWVAGCIAAGSIALMAGALVLEYVDRDLLPASMTGW |
| Ga0079220_117242092 | 3300006806 | Agricultural Soil | MRVRTARWVAGWAAAASVTLIVGGVVLACLDRHLVPASLTGWTVSNVCD |
| Ga0079220_118983761 | 3300006806 | Agricultural Soil | MSARTAPRVAGCVAAGSLALMAGGLILAYADRHLVPANVTSWDVSDVFGDVVNM |
| Ga0075425_1001345893 | 3300006854 | Populus Rhizosphere | MRVLTARWVAGCAAAASVALESGGLALAYVDRHLLPARLTTWDFSDVS |
| Ga0075425_1020123371 | 3300006854 | Populus Rhizosphere | MRVLTARWVAGCAAGMAVALIVGGLAWAYVHQHLVPADMMRWNVS |
| Ga0075434_1001270464 | 3300006871 | Populus Rhizosphere | MRVLTARWVAGCAAAASVTLELGGLALAYVDRHLLPARLTTWDFSDVS |
| Ga0099828_114240622 | 3300009089 | Vadose Zone Soil | MRPRTARWVAGCAAAGAVALIGGGLAMAYVSRHLVPASLTGWTFSDATNGGPAVQ |
| Ga0075423_101435093 | 3300009162 | Populus Rhizosphere | MAMRVLTARWVAGCAAAASVTLELGGLALAYVDRHLLPARLTTWDFSDVS |
| Ga0075423_125140791 | 3300009162 | Populus Rhizosphere | MVGMAMKVVTVRWVAGCAAVGSVALMAGALVLTYVDRHLVPADMAGWNFSGVFEG |
| Ga0126374_115200491 | 3300009792 | Tropical Forest Soil | MRVLTARRVAGGAAAASVALIAGALALAYLDRHHV |
| Ga0126380_101386211 | 3300010043 | Tropical Forest Soil | MRGLTARLVAGCAAAASAALMAGTLALVYADRHLLPAR |
| Ga0126380_103444501 | 3300010043 | Tropical Forest Soil | MGGRTARWVAGSVAAASLALMISGLALTYADRHLVSAS |
| Ga0126373_120462351 | 3300010048 | Tropical Forest Soil | MAMRVLTARWVAGCIAAGSIALMVGALLLEYVDRDLLPASM |
| Ga0126372_127126281 | 3300010360 | Tropical Forest Soil | MAMRVLTVRWVAGCAAVGSAALGAGALSLAYVDRHRVPAGLTAWDFSN |
| Ga0105239_103294601 | 3300010375 | Corn Rhizosphere | MRVQTTRWVAGCAAAVSVALIASAVLLAYADRHRLPADLTGWNFSDVFDGV |
| Ga0105239_116071731 | 3300010375 | Corn Rhizosphere | VAGCAAAASVALEFGGLALAYVDRRLLPARLTTWDFSDVS |
| Ga0105239_118208281 | 3300010375 | Corn Rhizosphere | MTMRVLAARWVAGCIAAGSIALMAGALALEYVDRDLLPASMRGWT |
| Ga0134124_119143092 | 3300010397 | Terrestrial Soil | MTMRVLTARSVAGCAAAASVTLGFGGLALAYVDRHLLPARLTNWDFSYVIWE |
| Ga0126383_130863231 | 3300010398 | Tropical Forest Soil | MRVQTARWVAGCAAVVSAALIAGALLLAYADRDLLRGDLTGWNFSDVFDGVANLAVP |
| Ga0105246_111849761 | 3300011119 | Miscanthus Rhizosphere | MRVQTSRWVAGCAAAVSVALIAGAPVLAYADRRLLPADLTGWNFSDVFDGVANLAVPMVG |
| Ga0137365_100349371 | 3300012201 | Vadose Zone Soil | MGMSVLTARWVAGCAAAVSVALIAGALALTYVDRHLVPAGMTGWD |
| Ga0137365_113656191 | 3300012201 | Vadose Zone Soil | MRVLTARWVAGCAAAVSVALIAGALALTYVDRHLVPAGMTGWD |
| Ga0137376_102817532 | 3300012208 | Vadose Zone Soil | MAMRVLTARWVAGCAAAVSVALMAGGLAWAYVDRHLVPADLASWNLSDVFGEVV |
| Ga0137410_117592791 | 3300012944 | Vadose Zone Soil | MAMRVLTARWVAGCAAAASVALEFGGLALAYVDRRLLPARLTAWDFSDVFADVVNLAIPV |
| Ga0164298_103915701 | 3300012955 | Soil | MRVQTSRWVAGCAAAVSVALIAGALVLAYADRRLLPADLTGWNFSDV |
| Ga0164308_107377762 | 3300012985 | Soil | MAMRVLTARWVAGCAAGVSVALITGGLAWAYVDRHLVPADMMKWNISEAF |
| Ga0157373_106320412 | 3300013100 | Corn Rhizosphere | VAGSAAAASVTLGLGGLALAYADRDLLPARLTTWDFSYVIWEVV |
| Ga0182041_104506582 | 3300016294 | Soil | MKARTARWVAGCAAAASVALLGAGMVLAYVDRQLVPASLTGWTVSNV |
| Ga0182039_100623664 | 3300016422 | Soil | MKARTARWVAGCAAAASVALLGAGLVLAYVDRQLVPASLTGWTVSNVSGQVVNMAVPVSG |
| Ga0187808_101628162 | 3300017942 | Freshwater Sediment | MRARTARWVAGCAAAGSVALMGGGLALTYVDRHLVPATLTNWTVSGVSGQ |
| Ga0187779_109623391 | 3300017959 | Tropical Peatland | MRVGTARWVAGCATAASVALIIGGLALAYADRHLVPARLQVWDFSDVF |
| Ga0187776_101614871 | 3300017966 | Tropical Peatland | MRVLTVRWAAGCAAVGSAALGAGALSLAYVDRHRVPAGLTAWD |
| Ga0187781_102090031 | 3300017972 | Tropical Peatland | MRARTARWVAGCTAAVSVALIGCGLALAFVDRHLLPASMTDWTVSGVSGQVVNMAVPVTGFVL |
| Ga0187777_108684401 | 3300017974 | Tropical Peatland | MRGRTARWVAGCAAAGSVTLIGAGLALAYVDRQLVPASLTGWTVSNIS |
| Ga0187767_102272221 | 3300017999 | Tropical Peatland | VRAWAVRWVPGCAAAVSVALIGAGLMLAYVDRLLLPAS |
| Ga0187815_103991891 | 3300018001 | Freshwater Sediment | MRARTVRWVAGCAAAGSVALIGGGVALAYADRHLVPASLTGWTVSNISQQVVN |
| Ga0187766_102945332 | 3300018058 | Tropical Peatland | MRARTARWVVRCAAAGSVALISGGLALAYVNRQLVPASLAGWTVSNIS |
| Ga0187773_105928771 | 3300018064 | Tropical Peatland | MRVQTTRWVAGCATAVSVALIAGALLLAYADRHQVPADLTGWNFSNVFDGLANL |
| Ga0187774_100754131 | 3300018089 | Tropical Peatland | MRVLTARWVAGCIAAVSVALLAGALVLEYVDRDLLPASMTG |
| Ga0066667_100367563 | 3300018433 | Grasslands Soil | MRVLTARWVAGCAAGISVALIAGGLAWAYVDRHLVPTDRMGWNIPTPSEKW |
| Ga0066667_100596375 | 3300018433 | Grasslands Soil | MRAQTARWVAGCIAAGSVALIVAGLVLAYVDRHPLPAGVTSWDWPTSSRTW |
| Ga0210399_107685961 | 3300020581 | Soil | MRVRTARWVAGCTAAGSVVLIGGGVALAFADRHLVPASLTGWTVSN |
| Ga0210395_105031641 | 3300020582 | Soil | VRARTGRWVPRCTAAGSVALLGAGLVLAYVDRHLVPASLTGWTVSNVSGQVV |
| Ga0210405_102814321 | 3300021171 | Soil | MRAGTVRWVAGCAAAGSLALMAGGLILAYVDRHLVPASVTYWDFSD |
| Ga0210405_105360321 | 3300021171 | Soil | MSARTAPRVAGFVAAGSLALMAGGLILAYADRHLVPA |
| Ga0213874_102320501 | 3300021377 | Plant Roots | MRAGTVRRVAGCAAAGSVALIGAGMVLAYVDRHLASASVTGWTVSNI |
| Ga0210393_105198632 | 3300021401 | Soil | VTALTARWVPRCAAAGSVALLGAGLVLACVDRHLVPASLGNWTVSNISGQVVNMAVPVTGFVL |
| Ga0210389_102362165 | 3300021404 | Soil | MRARTARWVAGCAAAGSVALIGGELALAYVDRHLVPASLTGWTVS |
| Ga0210389_112920322 | 3300021404 | Soil | MGARTARWMAGCAAAGSVALIGGGLALAYVDRHLVPASLADWTVSNVSGQLVNMAVPVTG |
| Ga0210387_113057921 | 3300021405 | Soil | VRARTAQWVAGCTAAGSIALIGGGVALAYLNRHLVPASLTGWTVSNISAQ |
| Ga0210386_113377612 | 3300021406 | Soil | MSARTAPRVAGCVAAGSLALMAGGLILAYADRHLVPANVTSWD |
| Ga0210383_112871501 | 3300021407 | Soil | VTALTARWVPRCAAAGSVALLGAGLVLAYVDRHLVPASLGNWTVSNIS |
| Ga0210383_117750141 | 3300021407 | Soil | MRARTARWVAGCAAGGSVALIGGGLALAYMDRHLVPASLA |
| Ga0210394_102973642 | 3300021420 | Soil | MRARTARWVAGCAAAGSVALIGGELALAYVDRHLVP |
| Ga0210384_107928991 | 3300021432 | Soil | MRAGTVRWVAGCAAAGSLALMAGGLILAYVDRHLVPASVTY |
| Ga0210402_102777731 | 3300021478 | Soil | MKVLTVRWVAGCAALGSAALMAGALVLTYVDRHRVPAGQTG |
| Ga0126371_117322111 | 3300021560 | Tropical Forest Soil | MRVLTARWVSGCAAAGSVALMAGGLALVYADRHLLPARLTGWNFSDV |
| Ga0242665_102820532 | 3300022724 | Soil | MRARTARWVTGCAAAVSVALIGGGLVLAYVDRHLVPASLTDRT |
| Ga0207692_111130941 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVQTSRWVAGCAAAVSVALIAGAPVLAYADRRLLPADLTGWNFSDVFD |
| Ga0207699_100924044 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLTARWVAGCAAAASVALEFGGLALAYVDRHLL |
| Ga0207663_100126675 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVQTSRWVAGCAAAVSVALITGAPVLAYADRRLLPADLTGWNFSDVFDGVANLAVP |
| Ga0207663_103156372 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVLTTRWVAGCAAAASVALEFGGLALAYVDRRLLPARLTTWD |
| Ga0207664_100387732 | 3300025929 | Agricultural Soil | MRARTARLVAGCAAAASVMLGLGALSLAYVDCHLVPARLTQWFL |
| Ga0208731_10040151 | 3300027029 | Forest Soil | MRAGTVRWVAGCAAAGSLALMAGGLILAYVDRHLVPASV |
| Ga0208237_10233272 | 3300027080 | Forest Soil | MRARTAGWVAGCVAAGSLALMAGGLILAYVDRHLV |
| Ga0208099_10208321 | 3300027096 | Forest Soil | VRARMARLVAGCAAAGSLALMAGGLILTYVDRHLVPAGMADWDVSDVFGDVVNMAIP |
| Ga0209524_10353761 | 3300027521 | Forest Soil | MSPRTAPRVAGCVAAGSLALMAGGLILAYADRHLVPADVT |
| Ga0307305_105339292 | 3300028807 | Soil | MRSRTVRWAAGCAAVASVALGAGALALAYVDRHRVPAGLTAWDFSNVFG |
| Ga0307312_103602891 | 3300028828 | Soil | MRVLTARWVAGCAAAASVALEFGGLALAYVDRRLLPARLTTWDF |
| Ga0308309_104931481 | 3300028906 | Soil | MRARTARWVAGCAAAGSVALLGAGLVLAYVDRHLVPASLANWTVSNI |
| Ga0302178_102998513 | 3300030013 | Palsa | MRARSAWRVAGCAAASSVVLIGGGLALAYVDRHLVPASQTGWTAANISGQVFLLFP |
| Ga0302184_101754012 | 3300030490 | Palsa | MRAQTASRVAGCAAAGSVALIGGGLALAYVDRHLVPASQTGWTASNISGQVVRDGG |
| Ga0310039_103432521 | 3300030706 | Peatlands Soil | VAGCTAAGSVTLIGAGVALAYADRHLVPASLTGSTVS |
| Ga0318555_106570771 | 3300031640 | Soil | MRARTARWVAGGVAVGSLALMAGGMALAYVDRHALP |
| Ga0318542_106593181 | 3300031668 | Soil | MRVLTARRVAGGVAAASVALIAGGLALAYVDRHLPAGRTAWNFSA |
| Ga0318561_100096235 | 3300031679 | Soil | MKARTARWVAGCAAAASVALLGAGLVLAYVDRQLVPASLTGWTVSNVSSQ |
| Ga0318574_105323902 | 3300031680 | Soil | VRARTARPVAGCAAAGSLALMAGGSILAYVDRHLVPASMTAWDFS |
| Ga0306917_115739342 | 3300031719 | Soil | VRARTARWVAGCVAAGSLALMVGGVILAYADRHLVPASVT |
| Ga0306918_101413934 | 3300031744 | Soil | MRARTARWVAGGVAVGSLALMAGGMALAYVDRHALPAG |
| Ga0318502_105329901 | 3300031747 | Soil | VKARTARWVAGSIAAGSVALMAGGLALAYADRHLVPAGLTNWDF |
| Ga0318492_100818951 | 3300031748 | Soil | VRARTARWVAGCVAAGSLALMAGGVILAYADRHLVPASVTSWDVSDVFGD |
| Ga0318492_102945722 | 3300031748 | Soil | MRVLTARRVAGGVAATSVALIVGGLALAYVDRHLPAGRTAWNFSAVFGGVADLAVPVVGF |
| Ga0318494_103955751 | 3300031751 | Soil | MRVLTARRVAGGVAATSVALIVGGLALAYVDRHLPAGRT |
| Ga0307475_101916721 | 3300031754 | Hardwood Forest Soil | VRAHAARWVAGCTAAGSVTLIGAGVALAYADRDLVPASSTGWTVSNLSGQI |
| Ga0318498_103214181 | 3300031778 | Soil | MRARTARWVAGCAAAGSVALTGGGLALAYVDRQLVPASQTGWTVSNT |
| Ga0318566_102783922 | 3300031779 | Soil | MRVASARWVAGCTGAVSVALIAGGLALAYVDRHQPAGRTAWNFSAVFGGVADL |
| Ga0318548_100726521 | 3300031793 | Soil | MRVASARWVAGCTGAVSVALIAGGLALAYVDRHQPAGRTAWNFSAVFGGVADLAVPVVGF |
| Ga0318565_103170682 | 3300031799 | Soil | MRVLTARRVAGGVAATSVALIAGGLALAYVDRHLPAGRTAWNFSAVFGGVA |
| Ga0318497_105287042 | 3300031805 | Soil | VRARTARWVAGCVAAGSLALMVGGVILAYADRHLVPASVTSWGVSDVF |
| Ga0310917_105651882 | 3300031833 | Soil | VRARTARPVAGCAAAGSLALMAGGSILAYVDRHLVPASMTAWDFSDVFGD |
| Ga0318517_100538031 | 3300031835 | Soil | MKARTARWVAGCAAAASVALLGAGLVLAYVDRQLVPASLTGWTVSNVSSQLVNMAVPV |
| Ga0318517_105835811 | 3300031835 | Soil | MRVLTARRVAGGVAATSVALIAGGLALAYVDRHLPAGRTAWNFSAVFG |
| Ga0306919_100732513 | 3300031879 | Soil | MTARTARWVAGCAAAASVALLGAGLVLSYVDRQLVPASLTGWTVSNVSGQVVNMAVPVSGFVL |
| Ga0318520_108079312 | 3300031897 | Soil | MRVASARWVAGCTGAVSVALIAGGLALAYVDRHLPAGRTAWNFSTVFGGVADL |
| Ga0310909_108081361 | 3300031947 | Soil | MKARTARWVAGCAAAASVALLGAGLVLAYVDRQLVPASLTGWTVSNVSSQLVNMAVPVTGFVL |
| Ga0306926_109639132 | 3300031954 | Soil | MRVLTARRVAGGVAATSVALIAGGLALAYVDRHLPAGRTAWNFSAVFGGM |
| Ga0318531_105909201 | 3300031981 | Soil | MRARTAQLVAGFVAAGSLALMIGGLILAYVDRHLVPANVTYWD |
| Ga0318570_100423514 | 3300032054 | Soil | MKARTARWVAGCAAAASVALLGAGLVLAYVDRQLVPASLTGWTVSNVSSQLVN |
| Ga0318505_100318664 | 3300032060 | Soil | MKARTARWVAGCAAAASVALLGAGLVLAYVDRQLVPASLTGWTVSNVSSQLVNMA |
| Ga0318504_106212031 | 3300032063 | Soil | MRVLTARRVAGGVAATSVALIVGGLALAYVDRHLP |
| Ga0318510_102221731 | 3300032064 | Soil | MTARTARWVAGCAAAASVALLGAGLVLSYVDRQLVPASLTGWTVSNVSGQVVN |
| Ga0318513_100255514 | 3300032065 | Soil | VRARTARPVAGCAAAGSLALMAGGSILAYVDRHLVPASMTAWDFSDVFGDVVNMA |
| Ga0307471_1032782892 | 3300032180 | Hardwood Forest Soil | MRARTARWVAGGIAAGSVALMAAGLVQAYVDRPPLPAGETSLDW |
| Ga0335077_111415882 | 3300033158 | Soil | MRARTARWVPGCAAAVAVALIGGGLALAYLDRHLVPASLTGWTFS |
| ⦗Top⦘ |