| Basic Information | |
|---|---|
| Family ID | F063935 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 39 residues |
| Representative Sequence | SGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 24.03 % |
| % of genes near scaffold ends (potentially truncated) | 76.74 % |
| % of genes from short scaffolds (< 2000 bps) | 85.27 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.798 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.302 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.783 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.186 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF03330 | DPBB_1 | 4.65 |
| PF07345 | DUF1476 | 4.65 |
| PF03350 | UPF0114 | 2.33 |
| PF14850 | Pro_dh-DNA_bdg | 1.55 |
| PF12833 | HTH_18 | 0.78 |
| PF16864 | Dimerisation2 | 0.78 |
| PF13193 | AMP-binding_C | 0.78 |
| PF01548 | DEDD_Tnp_IS110 | 0.78 |
| PF00768 | Peptidase_S11 | 0.78 |
| PF03772 | Competence | 0.78 |
| PF08002 | DUF1697 | 0.78 |
| PF07589 | PEP-CTERM | 0.78 |
| PF01757 | Acyl_transf_3 | 0.78 |
| PF11159 | DUF2939 | 0.78 |
| PF13593 | SBF_like | 0.78 |
| PF06035 | Peptidase_C93 | 0.78 |
| PF03237 | Terminase_6N | 0.78 |
| PF04134 | DCC1-like | 0.78 |
| PF05899 | Cupin_3 | 0.78 |
| PF07369 | DUF1488 | 0.78 |
| PF13458 | Peripla_BP_6 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG2862 | Uncharacterized membrane protein YqhA | Function unknown [S] | 2.33 |
| COG0658 | DNA uptake channel protein ComEC, N-terminal domain | Intracellular trafficking, secretion, and vesicular transport [U] | 0.78 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.78 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.80 % |
| Unclassified | root | N/A | 6.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10082352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 632 | Open in IMG/M |
| 3300001661|JGI12053J15887_10455336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 612 | Open in IMG/M |
| 3300001661|JGI12053J15887_10644930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 503 | Open in IMG/M |
| 3300001661|JGI12053J15887_10651043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 501 | Open in IMG/M |
| 3300001990|JGI24737J22298_10192901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 601 | Open in IMG/M |
| 3300001990|JGI24737J22298_10194201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
| 3300003369|JGI24140J50213_10241083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 557 | Open in IMG/M |
| 3300004152|Ga0062386_101245468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 618 | Open in IMG/M |
| 3300005366|Ga0070659_100521326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1015 | Open in IMG/M |
| 3300005457|Ga0070662_101647002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 554 | Open in IMG/M |
| 3300005564|Ga0070664_101247136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 702 | Open in IMG/M |
| 3300005564|Ga0070664_102125881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 533 | Open in IMG/M |
| 3300005617|Ga0068859_100917619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 960 | Open in IMG/M |
| 3300005617|Ga0068859_101328448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 792 | Open in IMG/M |
| 3300005841|Ga0068863_100036466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4684 | Open in IMG/M |
| 3300005843|Ga0068860_100007435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10954 | Open in IMG/M |
| 3300005843|Ga0068860_101237611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 767 | Open in IMG/M |
| 3300005843|Ga0068860_102778745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 508 | Open in IMG/M |
| 3300005844|Ga0068862_101491085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300005950|Ga0066787_10075832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 685 | Open in IMG/M |
| 3300006038|Ga0075365_10822603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 655 | Open in IMG/M |
| 3300006047|Ga0075024_100150041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1061 | Open in IMG/M |
| 3300006051|Ga0075364_10481907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 848 | Open in IMG/M |
| 3300006162|Ga0075030_100210592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1564 | Open in IMG/M |
| 3300006175|Ga0070712_100158952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1743 | Open in IMG/M |
| 3300006175|Ga0070712_101442133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 601 | Open in IMG/M |
| 3300006175|Ga0070712_102034475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 503 | Open in IMG/M |
| 3300006177|Ga0075362_10558451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 589 | Open in IMG/M |
| 3300006237|Ga0097621_100961642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 798 | Open in IMG/M |
| 3300006854|Ga0075425_101879262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 671 | Open in IMG/M |
| 3300006854|Ga0075425_102127993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 626 | Open in IMG/M |
| 3300006893|Ga0073928_11027704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 560 | Open in IMG/M |
| 3300006904|Ga0075424_101577535 | Not Available | 696 | Open in IMG/M |
| 3300006914|Ga0075436_101428389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300007788|Ga0099795_10101852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1128 | Open in IMG/M |
| 3300009088|Ga0099830_10059397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2730 | Open in IMG/M |
| 3300009092|Ga0105250_10143001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 992 | Open in IMG/M |
| 3300009098|Ga0105245_13283579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 501 | Open in IMG/M |
| 3300009137|Ga0066709_100341826 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300009137|Ga0066709_100608636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1557 | Open in IMG/M |
| 3300009143|Ga0099792_11143144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 526 | Open in IMG/M |
| 3300009545|Ga0105237_10214347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1925 | Open in IMG/M |
| 3300009551|Ga0105238_12323793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 571 | Open in IMG/M |
| 3300010041|Ga0126312_11299815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 538 | Open in IMG/M |
| 3300010375|Ga0105239_12667686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 583 | Open in IMG/M |
| 3300010398|Ga0126383_10058557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3251 | Open in IMG/M |
| 3300010400|Ga0134122_11796523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium vignae | 645 | Open in IMG/M |
| 3300010877|Ga0126356_10386688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 598 | Open in IMG/M |
| 3300012203|Ga0137399_10482421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1039 | Open in IMG/M |
| 3300012363|Ga0137390_10912772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 833 | Open in IMG/M |
| 3300012469|Ga0150984_100906659 | Not Available | 683 | Open in IMG/M |
| 3300012469|Ga0150984_106069211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095 | 517 | Open in IMG/M |
| 3300012683|Ga0137398_10273076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1131 | Open in IMG/M |
| 3300012896|Ga0157303_10251216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 540 | Open in IMG/M |
| 3300012923|Ga0137359_10198649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1791 | Open in IMG/M |
| 3300012944|Ga0137410_10238849 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300012960|Ga0164301_11030511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 649 | Open in IMG/M |
| 3300014501|Ga0182024_12728078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 528 | Open in IMG/M |
| 3300014969|Ga0157376_12836692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 524 | Open in IMG/M |
| 3300015206|Ga0167644_1052575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1446 | Open in IMG/M |
| 3300015245|Ga0137409_10023026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6108 | Open in IMG/M |
| 3300015245|Ga0137409_10684860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 859 | Open in IMG/M |
| 3300015371|Ga0132258_11664840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1610 | Open in IMG/M |
| 3300015374|Ga0132255_100777504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1426 | Open in IMG/M |
| 3300016270|Ga0182036_10014707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4293 | Open in IMG/M |
| 3300018074|Ga0184640_10075197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1436 | Open in IMG/M |
| 3300018466|Ga0190268_11048701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 656 | Open in IMG/M |
| 3300018476|Ga0190274_10831854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0431 | 984 | Open in IMG/M |
| 3300018482|Ga0066669_11805137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 565 | Open in IMG/M |
| 3300019259|Ga0184646_1049981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 607 | Open in IMG/M |
| 3300019882|Ga0193713_1009064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3040 | Open in IMG/M |
| 3300019889|Ga0193743_1015671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4073 | Open in IMG/M |
| 3300021404|Ga0210389_10150782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1803 | Open in IMG/M |
| 3300021405|Ga0210387_10693892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 902 | Open in IMG/M |
| 3300021407|Ga0210383_11241140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 625 | Open in IMG/M |
| 3300021479|Ga0210410_11166357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 661 | Open in IMG/M |
| 3300022195|Ga0222625_1755511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 504 | Open in IMG/M |
| 3300022557|Ga0212123_10037525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4765 | Open in IMG/M |
| 3300025464|Ga0208076_1012875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1419 | Open in IMG/M |
| 3300025862|Ga0209483_1042933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2169 | Open in IMG/M |
| 3300025891|Ga0209585_10419838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 548 | Open in IMG/M |
| 3300025900|Ga0207710_10084212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1479 | Open in IMG/M |
| 3300025910|Ga0207684_10097272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2513 | Open in IMG/M |
| 3300025914|Ga0207671_10011295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7281 | Open in IMG/M |
| 3300025915|Ga0207693_10444286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1014 | Open in IMG/M |
| 3300025920|Ga0207649_10269485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1233 | Open in IMG/M |
| 3300025939|Ga0207665_10314510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM471 | 1174 | Open in IMG/M |
| 3300025949|Ga0207667_10520953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1204 | Open in IMG/M |
| 3300026023|Ga0207677_11912832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 551 | Open in IMG/M |
| 3300026088|Ga0207641_10363396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1382 | Open in IMG/M |
| 3300026351|Ga0257170_1048549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 588 | Open in IMG/M |
| 3300026490|Ga0257153_1113547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d | 533 | Open in IMG/M |
| 3300027381|Ga0208983_1065241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 694 | Open in IMG/M |
| 3300027388|Ga0208995_1033848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 897 | Open in IMG/M |
| 3300027388|Ga0208995_1037615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sBnM-33 | 851 | Open in IMG/M |
| 3300027565|Ga0209219_1091564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 751 | Open in IMG/M |
| 3300027587|Ga0209220_1045192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1177 | Open in IMG/M |
| 3300027660|Ga0209736_1010602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2953 | Open in IMG/M |
| 3300027908|Ga0209006_11524139 | Not Available | 505 | Open in IMG/M |
| 3300028380|Ga0268265_11331768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 719 | Open in IMG/M |
| 3300028381|Ga0268264_10000043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 371761 | Open in IMG/M |
| 3300028771|Ga0307320_10153336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 892 | Open in IMG/M |
| 3300028819|Ga0307296_10108706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1488 | Open in IMG/M |
| 3300030917|Ga0075382_10010130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
| 3300031058|Ga0308189_10417264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 559 | Open in IMG/M |
| 3300031097|Ga0308188_1031245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium pachyrhizi | 551 | Open in IMG/M |
| 3300031152|Ga0307501_10026309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1153 | Open in IMG/M |
| 3300031231|Ga0170824_100100124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2507 | Open in IMG/M |
| 3300031232|Ga0302323_100156667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2266 | Open in IMG/M |
| 3300031474|Ga0170818_110802102 | Not Available | 585 | Open in IMG/M |
| 3300031474|Ga0170818_112730015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1226 | Open in IMG/M |
| 3300031507|Ga0307509_10037894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 5265 | Open in IMG/M |
| 3300031668|Ga0318542_10664310 | Not Available | 544 | Open in IMG/M |
| 3300031720|Ga0307469_10365180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1218 | Open in IMG/M |
| 3300031726|Ga0302321_101687855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300031731|Ga0307405_11574340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 579 | Open in IMG/M |
| 3300031754|Ga0307475_11280798 | Not Available | 568 | Open in IMG/M |
| 3300031821|Ga0318567_10716393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 567 | Open in IMG/M |
| 3300031833|Ga0310917_10817855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 629 | Open in IMG/M |
| 3300031845|Ga0318511_10392089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300031890|Ga0306925_11710991 | Not Available | 607 | Open in IMG/M |
| 3300031947|Ga0310909_11496969 | Not Available | 538 | Open in IMG/M |
| 3300031954|Ga0306926_10269955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2107 | Open in IMG/M |
| 3300032074|Ga0308173_10423621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1176 | Open in IMG/M |
| 3300032076|Ga0306924_12501643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300032180|Ga0307471_103019351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 597 | Open in IMG/M |
| 3300032515|Ga0348332_12266260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 547 | Open in IMG/M |
| 3300032515|Ga0348332_13034674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
| 3300032829|Ga0335070_10829867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 859 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.33% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.33% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.55% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.55% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.55% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.78% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031097 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100823521 | 3300001545 | Forest Soil | ESGRCTMRNHDFVSDGFLALIVAGLLLLCSGLLVIAFS* |
| JGI12053J15887_104553361 | 3300001661 | Forest Soil | CTMRNHDLVSDGFLAVTAASLVLLCSGLLAIAFG* |
| JGI12053J15887_106449301 | 3300001661 | Forest Soil | AVSSTPSGRCPMRNHDFVSDGFLAVTAASLVLLCSGLLAIAFS* |
| JGI12053J15887_106510431 | 3300001661 | Forest Soil | SSTPSGRCPMRNHDFVSDGFLAVTAASLVLLCSGLLAIAFS* |
| JGI24737J22298_101929013 | 3300001990 | Corn Rhizosphere | IRPSIEHESGRCPNRCPMRSNHDLVSDGFLALTAGGLVLLCSSLMALAFA* |
| JGI24737J22298_101942011 | 3300001990 | Corn Rhizosphere | SGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA* |
| JGI24140J50213_102410831 | 3300003369 | Arctic Peat Soil | METEGFPMRNRDIVSDGFLALTAAGLVLLCSSLLAYSFI* |
| Ga0062386_1012454682 | 3300004152 | Bog Forest Soil | VEIGGCIMRNYDLVSDGFLALTAGGFALLCSSLLAFEFT* |
| Ga0070659_1005213261 | 3300005366 | Corn Rhizosphere | ADESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFG* |
| Ga0070662_1016470021 | 3300005457 | Corn Rhizosphere | ESGRCPNRCPMRSNHDLVSDGFLALTAGGLVLLCSSLVALAFG* |
| Ga0070664_1012471363 | 3300005564 | Corn Rhizosphere | FRPSIEHESGRCPMRNHDLVSDGFLALTAGGLFLLCSSLVALAFG* |
| Ga0070664_1021258813 | 3300005564 | Corn Rhizosphere | RPSIEHESGRCPMRNHDFVSDGFLALTAGGLFLLCSSLVALAFA* |
| Ga0068859_1009176193 | 3300005617 | Switchgrass Rhizosphere | PSIKHESGRCPMRNHDFVSDGFLALTAGGLFLLCSSLVALAFA* |
| Ga0068859_1013284481 | 3300005617 | Switchgrass Rhizosphere | METERLPMRNRDLVSDGFLALTLAGLVLLCSSLFAYS |
| Ga0068863_1000364662 | 3300005841 | Switchgrass Rhizosphere | METERLPMRNRDLVSDGFLALTAAGLVLLCSSLFAYAFI* |
| Ga0068860_1000074354 | 3300005843 | Switchgrass Rhizosphere | METERLPMRNRDLVSDGFLALTAAGFVLLCSSLFAYAFI* |
| Ga0068860_1012376111 | 3300005843 | Switchgrass Rhizosphere | SIEHESGRCPMRNHDFVSDGFLALTAGGLFLLCSSLVALAFA* |
| Ga0068860_1027787451 | 3300005843 | Switchgrass Rhizosphere | FIMHNHDLVSDGFLTLTAASLVLLGSSLLAFAFS* |
| Ga0068862_1014910852 | 3300005844 | Switchgrass Rhizosphere | METERLPMRNRDIISDGFLALTAAGFVLLCSSLFAYAFI* |
| Ga0066787_100758321 | 3300005950 | Soil | GRCTMRNHDFVSDGFLAVTSASLVLLCSGLLAMAFS* |
| Ga0075365_108226031 | 3300006038 | Populus Endosphere | CPMRNHDFVSDGFLALTAGGLVLLCSSLVALAFG* |
| Ga0075024_1001500413 | 3300006047 | Watersheds | METERLPMRNRDLVSDGFLALTAAGLVLLCSSLLAYSFI* |
| Ga0075364_104819073 | 3300006051 | Populus Endosphere | ADESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA* |
| Ga0075030_1002105921 | 3300006162 | Watersheds | RCTMRNKDFVSDGFLAVTVAGLLLLSSSLLTLAFI* |
| Ga0070712_1001589522 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDHDFVSDGFLALIVTALVLLCSSWVVLAFRLA* |
| Ga0070712_1014421332 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DRRCTMRNHDFVSDGFLALIVAALVLLCSSWLVLAFS* |
| Ga0070712_1020344752 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RRCTMRNHDFVSDGFLALIVAGLLLLCSSLLVIALS* |
| Ga0075362_105584512 | 3300006177 | Populus Endosphere | EDESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA* |
| Ga0097621_1009616422 | 3300006237 | Miscanthus Rhizosphere | METERLPMRNRDLVSDGFLALTLAGLVLLCSSLFAYAFI* |
| Ga0075425_1018792621 | 3300006854 | Populus Rhizosphere | TGGSTMRNHDFVSAGFLALIATCLVLLCSSLLVIVFS* |
| Ga0075425_1021279933 | 3300006854 | Populus Rhizosphere | GFIMRNHDLVSSGFLTLIAASLVLLGSSLLAFAFV* |
| Ga0073928_110277041 | 3300006893 | Iron-Sulfur Acid Spring | RSIEGGRCTMRNHDFVSDGFLALIVTGLVLLCSSLVIIAFG* |
| Ga0075424_1015775351 | 3300006904 | Populus Rhizosphere | GRFIMHNHDLVSDGFLTLTVASLVLLGSSLLAFAFS* |
| Ga0075436_1014283892 | 3300006914 | Populus Rhizosphere | RCIMRNHDLVSDGFLMLIAASLVLLGSSLLAFGIV* |
| Ga0099795_101018523 | 3300007788 | Vadose Zone Soil | CTMRNHDFVSDGFLAVTAASLVLLCSGLLAIAFS* |
| Ga0099830_100593974 | 3300009088 | Vadose Zone Soil | MRNHYFMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS* |
| Ga0105250_101430012 | 3300009092 | Switchgrass Rhizosphere | METERLPMRNRDLVSDGFLALTLAGLVLLCSSLFAYSFI* |
| Ga0105245_132835791 | 3300009098 | Miscanthus Rhizosphere | ERLPMRNRDLVSDGFLALTAAGFVLLCSSLFAYAFI* |
| Ga0066709_1003418262 | 3300009137 | Grasslands Soil | ESGRWTMRNHDFVSDGFLALIAAGLLLLCSSLLVVAFA* |
| Ga0066709_1006086361 | 3300009137 | Grasslands Soil | EDESRRCPMRNHDLVSDSFLALTAGGFVLLCSSLVALAFG* |
| Ga0099792_111431442 | 3300009143 | Vadose Zone Soil | PSGRCTMRNHDFVSDGFLAVAAASLVLLCSGLLAIALS* |
| Ga0105237_102143471 | 3300009545 | Corn Rhizosphere | MDTERHPMRNRDLVSDGFLALTAAGLVLLCSSLFAYSFI* |
| Ga0105238_123237931 | 3300009551 | Corn Rhizosphere | NESGRCPMRNHDLVSDGFLALTAGGLFLLCSSLVALAFG* |
| Ga0126312_112998152 | 3300010041 | Serpentine Soil | SLPRDRRCTMRNHDFVSDGFLALIATGLVLLCSTLLVIAFS* |
| Ga0105239_126676861 | 3300010375 | Corn Rhizosphere | DESSRCPMRKHDLVSDGFLALTAGGLVLLCSSLVALAFG* |
| Ga0126383_100585573 | 3300010398 | Tropical Forest Soil | MSDHDHDLVSSGFLALAAAGLVLLGSSLLAIAFA* |
| Ga0134122_117965232 | 3300010400 | Terrestrial Soil | MRNHDFVSGGFRALTAGGLFVLCSRLGGLSLAWAPPP |
| Ga0126356_103866882 | 3300010877 | Boreal Forest Soil | TRAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS* |
| Ga0137399_104824214 | 3300012203 | Vadose Zone Soil | FDSAVRHIVLFERRRTTAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS* |
| Ga0137390_109127721 | 3300012363 | Vadose Zone Soil | SDRRCTMRDHDFVSDGFLALIVAALVLLCSSWVVLAFRLA* |
| Ga0150984_1009066592 | 3300012469 | Avena Fatua Rhizosphere | MGTERVPMRNRDIVSDGFLALTAAGFVLLCSSLFAYAFI* |
| Ga0150984_1060692111 | 3300012469 | Avena Fatua Rhizosphere | SGRCPMRNHDLVSDSFLALTAGGLVLLCSSLVALAFG* |
| Ga0137398_102730763 | 3300012683 | Vadose Zone Soil | CTMRNDDLVSDGFLAVTAASLVLLCSGLLAIAFS* |
| Ga0157303_102512161 | 3300012896 | Soil | ESGRCPMRNHDFVSDGFLALTAGGLFLLCSSLVALAFA* |
| Ga0137359_101986491 | 3300012923 | Vadose Zone Soil | GRFIMHNHDLVSDGFLTLTAASLVLLGSSLLAFAFS* |
| Ga0137410_102388491 | 3300012944 | Vadose Zone Soil | IVLFERRRTTAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS* |
| Ga0164301_110305113 | 3300012960 | Soil | CIMRNHDLVSDGFLTLIAASLVLLGSSLLAFSIV* |
| Ga0182024_127280781 | 3300014501 | Permafrost | TSILTGRCTMRNHDFVSDGFLALIAAGLLLLFSSLIAIALI* |
| Ga0157376_128366921 | 3300014969 | Miscanthus Rhizosphere | NRCPMRSNHDLVSDGFLALTAGGLVLLCSSLVALAFG* |
| Ga0167644_10525753 | 3300015206 | Glacier Forefield Soil | PDYRSVTMRNHDFVSGGLLAVTAVSLVLLCSGLLAIAFA* |
| Ga0137409_100230268 | 3300015245 | Vadose Zone Soil | MAIGRCTMRNDDFVSDGFLALVAAGLVVLCSSLLAIAFM* |
| Ga0137409_106848602 | 3300015245 | Vadose Zone Soil | MRNHDFVSDGFLALIAGCLVLLCSGLLVIAFSQPA |
| Ga0132258_116648402 | 3300015371 | Arabidopsis Rhizosphere | MREHDFVSAGFLALIASCLVLLCSSLLVIALKLAYL* |
| Ga0132255_1007775041 | 3300015374 | Arabidopsis Rhizosphere | GRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFG* |
| Ga0182036_100147071 | 3300016270 | Soil | KVGGCVMRNQDLVSDGFLALTAAGFALLCSSLLAFAFV |
| Ga0184640_100751972 | 3300018074 | Groundwater Sediment | RGSMRNHDFVSDGSLALILTALVLLCSSWLVLAFS |
| Ga0190268_110487011 | 3300018466 | Soil | VGGRRCTMRNHDFVSDGFLALIVTALVLLCSSWLVLALS |
| Ga0190274_108318542 | 3300018476 | Soil | MRNHDFVSDGFLALIATCLAVLCSSLLVIAFSQPA |
| Ga0066669_118051371 | 3300018482 | Grasslands Soil | RCSMRNRDFVSDGFLALIVTALALLCSSWLVLAFS |
| Ga0184646_10499811 | 3300019259 | Groundwater Sediment | QEPRGIPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS |
| Ga0193713_10090645 | 3300019882 | Soil | MAIGRCTMRNDDFVSDGFLALVAAGLVVLCSSLLAIAFM |
| Ga0193743_10156716 | 3300019889 | Soil | MTGCIMRNHDLVSDGFLALIAASLVLLGSSLLAFAIV |
| Ga0210389_101507823 | 3300021404 | Soil | WSGRCFMRNHDFVSDGFLALIATGLLLLFSILLAIAPI |
| Ga0210387_106938921 | 3300021405 | Soil | ENFDKFGRVGRCAMRNHDFVSDGFLAVTAAGLVLLCSSLLALVFA |
| Ga0210383_112411402 | 3300021407 | Soil | IRTSVWSGRCFMRNHDFVSDGFLALIATGLLLLFSILLAIAPI |
| Ga0210410_111663571 | 3300021479 | Soil | SGRCFMRNHDFVSDGFLALIATGLLLLFSILLAIAPI |
| Ga0222625_17555112 | 3300022195 | Groundwater Sediment | RCTMRNHDLVSDGFLAVVAASLVLLCSGLLAIAFG |
| Ga0212123_100375251 | 3300022557 | Iron-Sulfur Acid Spring | VSDRRCTMRDRDFVSDAFLALIVAALALLCSSWLVLAFS |
| Ga0208076_10128752 | 3300025464 | Arctic Peat Soil | METEGFPMRNRDIVSDGFLALTAAGLVLLCSSLLAYSFI |
| Ga0209483_10429331 | 3300025862 | Arctic Peat Soil | SATMRNHDFVSEGFLAVTVASLMLLCSGLLAIAFA |
| Ga0209585_104198382 | 3300025891 | Arctic Peat Soil | RHGRCAMRNRDLVSDGFLALTWASLVLLCSSLLVVVFS |
| Ga0207710_100842121 | 3300025900 | Switchgrass Rhizosphere | METERLPMRNRDLVSDGFLALTLAGLVLLCSSLFAYSFI |
| Ga0207684_100972723 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNHRNHDLVSGGFLALTAAGLVLLGSSLLAFVFA |
| Ga0207671_100112952 | 3300025914 | Corn Rhizosphere | MDTERHPMRNRDLVSDGFLALTAAGLVLLCSSLFAYSFI |
| Ga0207693_104442861 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDGRCTMRDNDFVSDGFLALIVAALVLLCSSWLVLAFS |
| Ga0207649_102694854 | 3300025920 | Corn Rhizosphere | SGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA |
| Ga0207665_103145103 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | IRSSIADESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA |
| Ga0207667_105209534 | 3300025949 | Corn Rhizosphere | IRPSIADESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFG |
| Ga0207677_119128321 | 3300026023 | Miscanthus Rhizosphere | RCTMHNHDLVSDGFLALIVTALVLLCSSWLVLAFS |
| Ga0207641_103633961 | 3300026088 | Switchgrass Rhizosphere | METERLPMRNRDLVSDGFLALTAAGLVLLCSSLFAYAFI |
| Ga0257170_10485492 | 3300026351 | Soil | IVLFERRRTTAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS |
| Ga0257153_11135471 | 3300026490 | Soil | TPRCTMRDHDLVSDGLLAVTAASLVLLCSGLLAIAFG |
| Ga0208983_10652413 | 3300027381 | Forest Soil | LFERRRTTAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS |
| Ga0208995_10338483 | 3300027388 | Forest Soil | MAIGRCTMRNDDFVSDGFLALVAAGLVVLCSSLLA |
| Ga0208995_10376152 | 3300027388 | Forest Soil | SLRSGRRCTMRNHDFVSDGFLALIAAGLLVLCSSLIVMAFS |
| Ga0209219_10915642 | 3300027565 | Forest Soil | IESGRCTMRNHDFVSDGFLALIVAGLLLLCSSLLVIAFS |
| Ga0209220_10451921 | 3300027587 | Forest Soil | SIESGRCTMRNHDFVSDGFLALIVAGLLLLCSGLLVIAFS |
| Ga0209736_10106027 | 3300027660 | Forest Soil | MAIGRCTMRNRDLVSDAFLVLIATGLVLLCSSLLVIAFS |
| Ga0209006_115241391 | 3300027908 | Forest Soil | RCPMRNRDFMSDGFLALVATGLVLLFSSLVAIALI |
| Ga0268265_113317681 | 3300028380 | Switchgrass Rhizosphere | SGRRCSMRNHDFVSDGFLALIVTALVLLCSSWHVLAFS |
| Ga0268264_10000043343 | 3300028381 | Switchgrass Rhizosphere | METERLPMRNRDLVSDGFLALTAAGFVLLCSSLFAYAFI |
| Ga0307320_101533361 | 3300028771 | Soil | SGRRCSMRNHDFVSDGFLALIVTALVLLCSSWLVLAFS |
| Ga0307296_101087065 | 3300028819 | Soil | RRCTMRNHDFMSGGFLALTVAGLVLLCSGLLAIAFS |
| Ga0075382_100101302 | 3300030917 | Soil | METERLPMRNRDLVSDGFLALTLAGLVLLCSSLLAYSFI |
| Ga0308189_104172642 | 3300031058 | Soil | TTAAGVPMRNHDFVSDGFLAIVAASLVLLCSGLLAIAFS |
| Ga0308188_10312451 | 3300031097 | Soil | PRGVPMRNHDFVSDGFLAIIAASLVLLCTGLLAIAFS |
| Ga0307501_100263091 | 3300031152 | Soil | SERAQDKRPAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS |
| Ga0170824_1001001241 | 3300031231 | Forest Soil | MRTHDFVSDGFPALIASSLVLLCSSSLVIAFSQPLAFSGYSK |
| Ga0302323_1001566671 | 3300031232 | Fen | METERFPMRDRDLVSNGFLAVTAAGLVLLCSSLLAYSFI |
| Ga0170818_1108021022 | 3300031474 | Forest Soil | METERLPMRDSDLVSNGFLALTAAGLVLLCSSLLAYSFI |
| Ga0170818_1127300151 | 3300031474 | Forest Soil | PSIKDESSRCPMRNHDLVSDGFLALTAGGLFLLCSSLVALAFG |
| Ga0307509_100378945 | 3300031507 | Ectomycorrhiza | METERLPMRNRDLISDGFLALTAAGLVLLCSSLFAYSFI |
| Ga0318542_106643101 | 3300031668 | Soil | GPECIMQDHDLVSDGFLALTAAAVALLCSGMLAFAFV |
| Ga0307469_103651803 | 3300031720 | Hardwood Forest Soil | RSGRCIMPNRDFVSDGFLALTAASLVLLCSGLLAIALS |
| Ga0302321_1016878551 | 3300031726 | Fen | TERLPMRDRDLVSNGFLAVTAAGLVLLCSSLLAYSFI |
| Ga0307405_115743402 | 3300031731 | Rhizosphere | TGRCTMRDHDFVSDGFLALIVTSLVLLCSGWLVLAFSWS |
| Ga0307475_112807982 | 3300031754 | Hardwood Forest Soil | FGGCIVRNHDLVSDSFLALTAAGLALLCSSLLAFALT |
| Ga0318567_107163931 | 3300031821 | Soil | DRRCIMQDHDLVSDGFLALTAAGVALLCSSLLAFAFV |
| Ga0310917_108178552 | 3300031833 | Soil | MKVEGCVMRNQDLVSDGFLALTAARFALLCSSLLAFAYCAD |
| Ga0318511_103920891 | 3300031845 | Soil | GECIMHDHDLVSDGFLALTAAGVALLCSSLLAFAFV |
| Ga0306925_117109911 | 3300031890 | Soil | GGCVMRNQDLVSNSYLALTVAGLALLGSCLLAFAFL |
| Ga0310909_114969692 | 3300031947 | Soil | RCVMRNQDLVSDSYLALTVAGLALLGSCLLAFAFL |
| Ga0306926_102699555 | 3300031954 | Soil | SIRSSIEDESDRCAMSNHDLVCDGFLALTAGGLILLCSSLVALAFA |
| Ga0308173_104236211 | 3300032074 | Soil | DESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA |
| Ga0306924_125016431 | 3300032076 | Soil | RTFENGGCVMRNQDLVSDGYLALTAAGIVLLCSSLLALAFA |
| Ga0307471_1030193512 | 3300032180 | Hardwood Forest Soil | TGRCIMRNHDLVSDGFLTLIAASLLLLGSSLLAFAIV |
| Ga0348332_122662601 | 3300032515 | Plant Litter | TLFRFGRCTMRKHDFVADGFLAVTGVSLVVLCSGLLAIAFG |
| Ga0348332_130346741 | 3300032515 | Plant Litter | AGARTMRNHDFVSDGFLAVTAASLVLLCSGLLAIAFA |
| Ga0335070_108298671 | 3300032829 | Soil | DNESGRCHMRSHDLVSNGFLVLTAGGLVLLCSSLVALAFA |
| ⦗Top⦘ |