Metagenome / Metatranscriptome Family F063935

Basic Information
Family ID	F063935
Family Type	Metagenome / Metatranscriptome
Number of Sequences	129
Average Sequence Length	39 residues
Representative Sequence	SGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA
Number of Associated Samples	113
Number of Associated Scaffolds	129

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	24.03 %
% of genes near scaffold ends (potentially truncated)	76.74 %
% of genes from short scaffolds (< 2000 bps)	85.27 %
Associated GOLD sequencing projects	105
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Most Common Taxonomy
Group	Bacteria (93.798 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.302 % of family members)
Environment Ontology (ENVO)	Unclassified (31.783 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (44.186 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 129 Family Scaffolds
PF03330	DPBB_1	4.65
PF07345	DUF1476	4.65
PF03350	UPF0114	2.33
PF14850	Pro_dh-DNA_bdg	1.55
PF12833	HTH_18	0.78
PF16864	Dimerisation2	0.78
PF13193	AMP-binding_C	0.78
PF01548	DEDD_Tnp_IS110	0.78
PF00768	Peptidase_S11	0.78
PF03772	Competence	0.78
PF08002	DUF1697	0.78
PF07589	PEP-CTERM	0.78
PF01757	Acyl_transf_3	0.78
PF11159	DUF2939	0.78
PF13593	SBF_like	0.78
PF06035	Peptidase_C93	0.78
PF03237	Terminase_6N	0.78
PF04134	DCC1-like	0.78
PF05899	Cupin_3	0.78
PF07369	DUF1488	0.78
PF13458	Peripla_BP_6	0.78

COG ID	Name	Functional Category	% Frequency in 129 Family Scaffolds
COG2862	Uncharacterized membrane protein YqhA	Function unknown [S]	2.33
COG0658	DNA uptake channel protein ComEC, N-terminal domain	Intracellular trafficking, secretion, and vesicular transport [U]	0.78
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.78
COG3011	Predicted thiol-disulfide oxidoreductase YuxK, DCC family	General function prediction only [R]	0.78
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.78
COG3672	Predicted transglutaminase-like protein	Posttranslational modification, protein turnover, chaperones [O]	0.78
COG3797	Uncharacterized conserved protein, DUF1697 family	Function unknown [S]	0.78

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.80 %
Unclassified	root	N/A	6.20 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.80 %
Unclassified	root	N/A	6.20 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.80 %
Unclassified	root	N/A	6.20 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	92.25 %
Unclassified	root	N/A	6.20 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	91.47 %
Unclassified	root	N/A	6.20 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.78 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	86.82 %
Unclassified	root	N/A	6.20 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.78 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	83.72 %
Unclassified	root	N/A	6.20 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.78 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	79.07 %
Unclassified	root	N/A	6.20 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.78 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.78 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	7.75 %
Unclassified	root	N/A	6.20 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	4.65 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	2.33 %
Bradyrhizobium japonicum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum	2.33 %
unclassified Afipia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia	0.78 %
Bradyrhizobium vignae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium vignae	0.78 %
Bradyrhizobium pachyrhizi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium pachyrhizi	0.78 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.78 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	7.75 %
Unclassified	root	N/A	6.20 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	2.33 %
Bradyrhizobium japonicum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum	2.33 %
Bradyrhizobium sp. AUGA SZCCT0431	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0431	0.78 %
Bradyrhizobium sp. OK095	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	0.78 %
Afipia sp. GAS231	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231	0.78 %
Bradyrhizobium sp. Rc2d	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	0.78 %
Bradyrhizobium sp. sBnM-33	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sBnM-33	0.78 %
Bradyrhizobium sp. WSM471	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM471	0.78 %
Bradyrhizobium sp. Tv2a-2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	0.78 %
Bradyrhizobium vignae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium vignae	0.78 %
Bradyrhizobium pachyrhizi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium pachyrhizi	0.78 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.78 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001545\|JGI12630J15595_10082352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	632	Open in IMG/M
3300001661\|JGI12053J15887_10455336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	612	Open in IMG/M
3300001661\|JGI12053J15887_10644930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	503	Open in IMG/M
3300001661\|JGI12053J15887_10651043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	501	Open in IMG/M
3300001990\|JGI24737J22298_10192901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	601	Open in IMG/M
3300001990\|JGI24737J22298_10194201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	599	Open in IMG/M
3300003369\|JGI24140J50213_10241083	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	557	Open in IMG/M
3300004152\|Ga0062386_101245468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	618	Open in IMG/M
3300005366\|Ga0070659_100521326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1015	Open in IMG/M
3300005457\|Ga0070662_101647002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	554	Open in IMG/M
3300005564\|Ga0070664_101247136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	702	Open in IMG/M
3300005564\|Ga0070664_102125881	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	533	Open in IMG/M
3300005617\|Ga0068859_100917619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum	960	Open in IMG/M
3300005617\|Ga0068859_101328448	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	792	Open in IMG/M
3300005841\|Ga0068863_100036466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4684	Open in IMG/M
3300005843\|Ga0068860_100007435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	10954	Open in IMG/M
3300005843\|Ga0068860_101237611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum	767	Open in IMG/M
3300005843\|Ga0068860_102778745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	508	Open in IMG/M
3300005844\|Ga0068862_101491085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	681	Open in IMG/M
3300005950\|Ga0066787_10075832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	685	Open in IMG/M
3300006038\|Ga0075365_10822603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum	655	Open in IMG/M
3300006047\|Ga0075024_100150041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1061	Open in IMG/M
3300006051\|Ga0075364_10481907	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	848	Open in IMG/M
3300006162\|Ga0075030_100210592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1564	Open in IMG/M
3300006175\|Ga0070712_100158952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1743	Open in IMG/M
3300006175\|Ga0070712_101442133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	601	Open in IMG/M
3300006175\|Ga0070712_102034475	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	503	Open in IMG/M
3300006177\|Ga0075362_10558451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	589	Open in IMG/M
3300006237\|Ga0097621_100961642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	798	Open in IMG/M
3300006854\|Ga0075425_101879262	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	671	Open in IMG/M
3300006854\|Ga0075425_102127993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	626	Open in IMG/M
3300006893\|Ga0073928_11027704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	560	Open in IMG/M
3300006904\|Ga0075424_101577535	Not Available	696	Open in IMG/M
3300006914\|Ga0075436_101428389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	525	Open in IMG/M
3300007788\|Ga0099795_10101852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1128	Open in IMG/M
3300009088\|Ga0099830_10059397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2730	Open in IMG/M
3300009092\|Ga0105250_10143001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	992	Open in IMG/M
3300009098\|Ga0105245_13283579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	501	Open in IMG/M
3300009137\|Ga0066709_100341826	All Organisms → cellular organisms → Bacteria	2052	Open in IMG/M
3300009137\|Ga0066709_100608636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1557	Open in IMG/M
3300009143\|Ga0099792_11143144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231	526	Open in IMG/M
3300009545\|Ga0105237_10214347	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1925	Open in IMG/M
3300009551\|Ga0105238_12323793	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	571	Open in IMG/M
3300010041\|Ga0126312_11299815	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	538	Open in IMG/M
3300010375\|Ga0105239_12667686	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	583	Open in IMG/M
3300010398\|Ga0126383_10058557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3251	Open in IMG/M
3300010400\|Ga0134122_11796523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium vignae	645	Open in IMG/M
3300010877\|Ga0126356_10386688	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	598	Open in IMG/M
3300012203\|Ga0137399_10482421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1039	Open in IMG/M
3300012363\|Ga0137390_10912772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	833	Open in IMG/M
3300012469\|Ga0150984_100906659	Not Available	683	Open in IMG/M
3300012469\|Ga0150984_106069211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095	517	Open in IMG/M
3300012683\|Ga0137398_10273076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1131	Open in IMG/M
3300012896\|Ga0157303_10251216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	540	Open in IMG/M
3300012923\|Ga0137359_10198649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1791	Open in IMG/M
3300012944\|Ga0137410_10238849	All Organisms → cellular organisms → Bacteria	1420	Open in IMG/M
3300012960\|Ga0164301_11030511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	649	Open in IMG/M
3300014501\|Ga0182024_12728078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	528	Open in IMG/M
3300014969\|Ga0157376_12836692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	524	Open in IMG/M
3300015206\|Ga0167644_1052575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1446	Open in IMG/M
3300015245\|Ga0137409_10023026	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6108	Open in IMG/M
3300015245\|Ga0137409_10684860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	859	Open in IMG/M
3300015371\|Ga0132258_11664840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1610	Open in IMG/M
3300015374\|Ga0132255_100777504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1426	Open in IMG/M
3300016270\|Ga0182036_10014707	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4293	Open in IMG/M
3300018074\|Ga0184640_10075197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1436	Open in IMG/M
3300018466\|Ga0190268_11048701	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	656	Open in IMG/M
3300018476\|Ga0190274_10831854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0431	984	Open in IMG/M
3300018482\|Ga0066669_11805137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	565	Open in IMG/M
3300019259\|Ga0184646_1049981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	607	Open in IMG/M
3300019882\|Ga0193713_1009064	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3040	Open in IMG/M
3300019889\|Ga0193743_1015671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4073	Open in IMG/M
3300021404\|Ga0210389_10150782	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1803	Open in IMG/M
3300021405\|Ga0210387_10693892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	902	Open in IMG/M
3300021407\|Ga0210383_11241140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	625	Open in IMG/M
3300021479\|Ga0210410_11166357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	661	Open in IMG/M
3300022195\|Ga0222625_1755511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	504	Open in IMG/M
3300022557\|Ga0212123_10037525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4765	Open in IMG/M
3300025464\|Ga0208076_1012875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1419	Open in IMG/M
3300025862\|Ga0209483_1042933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2169	Open in IMG/M
3300025891\|Ga0209585_10419838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	548	Open in IMG/M
3300025900\|Ga0207710_10084212	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1479	Open in IMG/M
3300025910\|Ga0207684_10097272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2513	Open in IMG/M
3300025914\|Ga0207671_10011295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	7281	Open in IMG/M
3300025915\|Ga0207693_10444286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1014	Open in IMG/M
3300025920\|Ga0207649_10269485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1233	Open in IMG/M
3300025939\|Ga0207665_10314510	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM471	1174	Open in IMG/M
3300025949\|Ga0207667_10520953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1204	Open in IMG/M
3300026023\|Ga0207677_11912832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	551	Open in IMG/M
3300026088\|Ga0207641_10363396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1382	Open in IMG/M
3300026351\|Ga0257170_1048549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	588	Open in IMG/M
3300026490\|Ga0257153_1113547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d	533	Open in IMG/M
3300027381\|Ga0208983_1065241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	694	Open in IMG/M
3300027388\|Ga0208995_1033848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	897	Open in IMG/M
3300027388\|Ga0208995_1037615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sBnM-33	851	Open in IMG/M
3300027565\|Ga0209219_1091564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	751	Open in IMG/M
3300027587\|Ga0209220_1045192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1177	Open in IMG/M
3300027660\|Ga0209736_1010602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2953	Open in IMG/M
3300027908\|Ga0209006_11524139	Not Available	505	Open in IMG/M
3300028380\|Ga0268265_11331768	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	719	Open in IMG/M
3300028381\|Ga0268264_10000043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	371761	Open in IMG/M
3300028771\|Ga0307320_10153336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	892	Open in IMG/M
3300028819\|Ga0307296_10108706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1488	Open in IMG/M
3300030917\|Ga0075382_10010130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	505	Open in IMG/M
3300031058\|Ga0308189_10417264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	559	Open in IMG/M
3300031097\|Ga0308188_1031245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium pachyrhizi	551	Open in IMG/M
3300031152\|Ga0307501_10026309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1153	Open in IMG/M
3300031231\|Ga0170824_100100124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2507	Open in IMG/M
3300031232\|Ga0302323_100156667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2266	Open in IMG/M
3300031474\|Ga0170818_110802102	Not Available	585	Open in IMG/M
3300031474\|Ga0170818_112730015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1226	Open in IMG/M
3300031507\|Ga0307509_10037894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	5265	Open in IMG/M
3300031668\|Ga0318542_10664310	Not Available	544	Open in IMG/M
3300031720\|Ga0307469_10365180	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1218	Open in IMG/M
3300031726\|Ga0302321_101687855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	732	Open in IMG/M
3300031731\|Ga0307405_11574340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	579	Open in IMG/M
3300031754\|Ga0307475_11280798	Not Available	568	Open in IMG/M
3300031821\|Ga0318567_10716393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	567	Open in IMG/M
3300031833\|Ga0310917_10817855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	629	Open in IMG/M
3300031845\|Ga0318511_10392089	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	636	Open in IMG/M
3300031890\|Ga0306925_11710991	Not Available	607	Open in IMG/M
3300031947\|Ga0310909_11496969	Not Available	538	Open in IMG/M
3300031954\|Ga0306926_10269955	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2107	Open in IMG/M
3300032074\|Ga0308173_10423621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1176	Open in IMG/M
3300032076\|Ga0306924_12501643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	518	Open in IMG/M
3300032180\|Ga0307471_103019351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	597	Open in IMG/M
3300032515\|Ga0348332_12266260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	547	Open in IMG/M
3300032515\|Ga0348332_13034674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	502	Open in IMG/M
3300032829\|Ga0335070_10829867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	859	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	68.22%
Host-Associated	Host-Associated	31.78%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	62.02%
Plants	Host-Associated → Plants	31.78%
Aquatic	Environmental → Aquatic	6.20%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	58.91%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.50%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.40%
Roots	Host-Associated → Plants → Roots	3.88%
Freshwater	Environmental → Aquatic → Freshwater	2.33%
Sediment	Environmental → Aquatic → Sediment	2.33%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.55%
Peat	Environmental → Terrestrial → Peat	1.55%
Plant Litter	Environmental → Terrestrial → Plant Litter	1.55%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.41%
Loam	Environmental → Terrestrial → Soil → Loam	13.18%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.08%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.43%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.33%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.33%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	2.33%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.55%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.55%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.55%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	1.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.55%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.78%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.78%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.16%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	17.05%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.08%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	8.53%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.43%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.65%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	3.10%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.33%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.33%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	2.33%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.55%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.55%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.55%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.55%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	1.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.55%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.78%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.78%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.78%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.78%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.78%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	9.30%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.53%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	8.53%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.75%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.65%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	3.10%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.10%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.10%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.10%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.88%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.33%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.33%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.33%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.33%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	2.33%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.55%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.55%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.55%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.55%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	1.55%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.55%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.55%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.55%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.78%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.78%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.78%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.78%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.78%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.78%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.78%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.78%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.78%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001545	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Host-Associated	Open in IMG/M
3300003369	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005950	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006051	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Host-Associated	Open in IMG/M
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006177	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010877	Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015206	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019259	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019882	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2	Environmental	Open in IMG/M
3300019889	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental	Open in IMG/M
3300022195	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300025464	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes)	Environmental	Open in IMG/M
3300025862	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)	Environmental	Open in IMG/M
3300025891	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026351	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B	Environmental	Open in IMG/M
3300026490	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A	Environmental	Open in IMG/M
3300027381	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)	Environmental	Open in IMG/M
3300027388	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)	Environmental	Open in IMG/M
3300027565	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)	Environmental	Open in IMG/M
3300027587	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027660	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)	Environmental	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028771	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300030917	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031097	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental	Open in IMG/M
3300031821	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F063935

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12630J15595_100823521	3300001545	Forest Soil	ESGRCTMRNHDFVSDGFLALIVAGLLLLCSGLLVIAFS*
JGI12053J15887_104553361	3300001661	Forest Soil	CTMRNHDLVSDGFLAVTAASLVLLCSGLLAIAFG*
JGI12053J15887_106449301	3300001661	Forest Soil	AVSSTPSGRCPMRNHDFVSDGFLAVTAASLVLLCSGLLAIAFS*
JGI12053J15887_106510431	3300001661	Forest Soil	SSTPSGRCPMRNHDFVSDGFLAVTAASLVLLCSGLLAIAFS*
JGI24737J22298_101929013	3300001990	Corn Rhizosphere	IRPSIEHESGRCPNRCPMRSNHDLVSDGFLALTAGGLVLLCSSLMALAFA*
JGI24737J22298_101942011	3300001990	Corn Rhizosphere	SGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA*
JGI24140J50213_102410831	3300003369	Arctic Peat Soil	METEGFPMRNRDIVSDGFLALTAAGLVLLCSSLLAYSFI*
Ga0062386_1012454682	3300004152	Bog Forest Soil	VEIGGCIMRNYDLVSDGFLALTAGGFALLCSSLLAFEFT*
Ga0070659_1005213261	3300005366	Corn Rhizosphere	ADESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFG*
Ga0070662_1016470021	3300005457	Corn Rhizosphere	ESGRCPNRCPMRSNHDLVSDGFLALTAGGLVLLCSSLVALAFG*
Ga0070664_1012471363	3300005564	Corn Rhizosphere	FRPSIEHESGRCPMRNHDLVSDGFLALTAGGLFLLCSSLVALAFG*
Ga0070664_1021258813	3300005564	Corn Rhizosphere	RPSIEHESGRCPMRNHDFVSDGFLALTAGGLFLLCSSLVALAFA*
Ga0068859_1009176193	3300005617	Switchgrass Rhizosphere	PSIKHESGRCPMRNHDFVSDGFLALTAGGLFLLCSSLVALAFA*
Ga0068859_1013284481	3300005617	Switchgrass Rhizosphere	METERLPMRNRDLVSDGFLALTLAGLVLLCSSLFAYS
Ga0068863_1000364662	3300005841	Switchgrass Rhizosphere	METERLPMRNRDLVSDGFLALTAAGLVLLCSSLFAYAFI*
Ga0068860_1000074354	3300005843	Switchgrass Rhizosphere	METERLPMRNRDLVSDGFLALTAAGFVLLCSSLFAYAFI*
Ga0068860_1012376111	3300005843	Switchgrass Rhizosphere	SIEHESGRCPMRNHDFVSDGFLALTAGGLFLLCSSLVALAFA*
Ga0068860_1027787451	3300005843	Switchgrass Rhizosphere	FIMHNHDLVSDGFLTLTAASLVLLGSSLLAFAFS*
Ga0068862_1014910852	3300005844	Switchgrass Rhizosphere	METERLPMRNRDIISDGFLALTAAGFVLLCSSLFAYAFI*
Ga0066787_100758321	3300005950	Soil	GRCTMRNHDFVSDGFLAVTSASLVLLCSGLLAMAFS*
Ga0075365_108226031	3300006038	Populus Endosphere	CPMRNHDFVSDGFLALTAGGLVLLCSSLVALAFG*
Ga0075024_1001500413	3300006047	Watersheds	METERLPMRNRDLVSDGFLALTAAGLVLLCSSLLAYSFI*
Ga0075364_104819073	3300006051	Populus Endosphere	ADESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA*
Ga0075030_1002105921	3300006162	Watersheds	RCTMRNKDFVSDGFLAVTVAGLLLLSSSLLTLAFI*
Ga0070712_1001589522	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MRDHDFVSDGFLALIVTALVLLCSSWVVLAFRLA*
Ga0070712_1014421332	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	DRRCTMRNHDFVSDGFLALIVAALVLLCSSWLVLAFS*
Ga0070712_1020344752	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	RRCTMRNHDFVSDGFLALIVAGLLLLCSSLLVIALS*
Ga0075362_105584512	3300006177	Populus Endosphere	EDESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA*
Ga0097621_1009616422	3300006237	Miscanthus Rhizosphere	METERLPMRNRDLVSDGFLALTLAGLVLLCSSLFAYAFI*
Ga0075425_1018792621	3300006854	Populus Rhizosphere	TGGSTMRNHDFVSAGFLALIATCLVLLCSSLLVIVFS*
Ga0075425_1021279933	3300006854	Populus Rhizosphere	GFIMRNHDLVSSGFLTLIAASLVLLGSSLLAFAFV*
Ga0073928_110277041	3300006893	Iron-Sulfur Acid Spring	RSIEGGRCTMRNHDFVSDGFLALIVTGLVLLCSSLVIIAFG*
Ga0075424_1015775351	3300006904	Populus Rhizosphere	GRFIMHNHDLVSDGFLTLTVASLVLLGSSLLAFAFS*
Ga0075436_1014283892	3300006914	Populus Rhizosphere	RCIMRNHDLVSDGFLMLIAASLVLLGSSLLAFGIV*
Ga0099795_101018523	3300007788	Vadose Zone Soil	CTMRNHDFVSDGFLAVTAASLVLLCSGLLAIAFS*
Ga0099830_100593974	3300009088	Vadose Zone Soil	MRNHYFMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS*
Ga0105250_101430012	3300009092	Switchgrass Rhizosphere	METERLPMRNRDLVSDGFLALTLAGLVLLCSSLFAYSFI*
Ga0105245_132835791	3300009098	Miscanthus Rhizosphere	ERLPMRNRDLVSDGFLALTAAGFVLLCSSLFAYAFI*
Ga0066709_1003418262	3300009137	Grasslands Soil	ESGRWTMRNHDFVSDGFLALIAAGLLLLCSSLLVVAFA*
Ga0066709_1006086361	3300009137	Grasslands Soil	EDESRRCPMRNHDLVSDSFLALTAGGFVLLCSSLVALAFG*
Ga0099792_111431442	3300009143	Vadose Zone Soil	PSGRCTMRNHDFVSDGFLAVAAASLVLLCSGLLAIALS*
Ga0105237_102143471	3300009545	Corn Rhizosphere	MDTERHPMRNRDLVSDGFLALTAAGLVLLCSSLFAYSFI*
Ga0105238_123237931	3300009551	Corn Rhizosphere	NESGRCPMRNHDLVSDGFLALTAGGLFLLCSSLVALAFG*
Ga0126312_112998152	3300010041	Serpentine Soil	SLPRDRRCTMRNHDFVSDGFLALIATGLVLLCSTLLVIAFS*
Ga0105239_126676861	3300010375	Corn Rhizosphere	DESSRCPMRKHDLVSDGFLALTAGGLVLLCSSLVALAFG*
Ga0126383_100585573	3300010398	Tropical Forest Soil	MSDHDHDLVSSGFLALAAAGLVLLGSSLLAIAFA*
Ga0134122_117965232	3300010400	Terrestrial Soil	MRNHDFVSGGFRALTAGGLFVLCSRLGGLSLAWAPPP
Ga0126356_103866882	3300010877	Boreal Forest Soil	TRAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS*
Ga0137399_104824214	3300012203	Vadose Zone Soil	FDSAVRHIVLFERRRTTAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS*
Ga0137390_109127721	3300012363	Vadose Zone Soil	SDRRCTMRDHDFVSDGFLALIVAALVLLCSSWVVLAFRLA*
Ga0150984_1009066592	3300012469	Avena Fatua Rhizosphere	MGTERVPMRNRDIVSDGFLALTAAGFVLLCSSLFAYAFI*
Ga0150984_1060692111	3300012469	Avena Fatua Rhizosphere	SGRCPMRNHDLVSDSFLALTAGGLVLLCSSLVALAFG*
Ga0137398_102730763	3300012683	Vadose Zone Soil	CTMRNDDLVSDGFLAVTAASLVLLCSGLLAIAFS*
Ga0157303_102512161	3300012896	Soil	ESGRCPMRNHDFVSDGFLALTAGGLFLLCSSLVALAFA*
Ga0137359_101986491	3300012923	Vadose Zone Soil	GRFIMHNHDLVSDGFLTLTAASLVLLGSSLLAFAFS*
Ga0137410_102388491	3300012944	Vadose Zone Soil	IVLFERRRTTAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS*
Ga0164301_110305113	3300012960	Soil	CIMRNHDLVSDGFLTLIAASLVLLGSSLLAFSIV*
Ga0182024_127280781	3300014501	Permafrost	TSILTGRCTMRNHDFVSDGFLALIAAGLLLLFSSLIAIALI*
Ga0157376_128366921	3300014969	Miscanthus Rhizosphere	NRCPMRSNHDLVSDGFLALTAGGLVLLCSSLVALAFG*
Ga0167644_10525753	3300015206	Glacier Forefield Soil	PDYRSVTMRNHDFVSGGLLAVTAVSLVLLCSGLLAIAFA*
Ga0137409_100230268	3300015245	Vadose Zone Soil	MAIGRCTMRNDDFVSDGFLALVAAGLVVLCSSLLAIAFM*
Ga0137409_106848602	3300015245	Vadose Zone Soil	MRNHDFVSDGFLALIAGCLVLLCSGLLVIAFSQPA
Ga0132258_116648402	3300015371	Arabidopsis Rhizosphere	MREHDFVSAGFLALIASCLVLLCSSLLVIALKLAYL*
Ga0132255_1007775041	3300015374	Arabidopsis Rhizosphere	GRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFG*
Ga0182036_100147071	3300016270	Soil	KVGGCVMRNQDLVSDGFLALTAAGFALLCSSLLAFAFV
Ga0184640_100751972	3300018074	Groundwater Sediment	RGSMRNHDFVSDGSLALILTALVLLCSSWLVLAFS
Ga0190268_110487011	3300018466	Soil	VGGRRCTMRNHDFVSDGFLALIVTALVLLCSSWLVLALS
Ga0190274_108318542	3300018476	Soil	MRNHDFVSDGFLALIATCLAVLCSSLLVIAFSQPA
Ga0066669_118051371	3300018482	Grasslands Soil	RCSMRNRDFVSDGFLALIVTALALLCSSWLVLAFS
Ga0184646_10499811	3300019259	Groundwater Sediment	QEPRGIPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS
Ga0193713_10090645	3300019882	Soil	MAIGRCTMRNDDFVSDGFLALVAAGLVVLCSSLLAIAFM
Ga0193743_10156716	3300019889	Soil	MTGCIMRNHDLVSDGFLALIAASLVLLGSSLLAFAIV
Ga0210389_101507823	3300021404	Soil	WSGRCFMRNHDFVSDGFLALIATGLLLLFSILLAIAPI
Ga0210387_106938921	3300021405	Soil	ENFDKFGRVGRCAMRNHDFVSDGFLAVTAAGLVLLCSSLLALVFA
Ga0210383_112411402	3300021407	Soil	IRTSVWSGRCFMRNHDFVSDGFLALIATGLLLLFSILLAIAPI
Ga0210410_111663571	3300021479	Soil	SGRCFMRNHDFVSDGFLALIATGLLLLFSILLAIAPI
Ga0222625_17555112	3300022195	Groundwater Sediment	RCTMRNHDLVSDGFLAVVAASLVLLCSGLLAIAFG
Ga0212123_100375251	3300022557	Iron-Sulfur Acid Spring	VSDRRCTMRDRDFVSDAFLALIVAALALLCSSWLVLAFS
Ga0208076_10128752	3300025464	Arctic Peat Soil	METEGFPMRNRDIVSDGFLALTAAGLVLLCSSLLAYSFI
Ga0209483_10429331	3300025862	Arctic Peat Soil	SATMRNHDFVSEGFLAVTVASLMLLCSGLLAIAFA
Ga0209585_104198382	3300025891	Arctic Peat Soil	RHGRCAMRNRDLVSDGFLALTWASLVLLCSSLLVVVFS
Ga0207710_100842121	3300025900	Switchgrass Rhizosphere	METERLPMRNRDLVSDGFLALTLAGLVLLCSSLFAYSFI
Ga0207684_100972723	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MRNHRNHDLVSGGFLALTAAGLVLLGSSLLAFVFA
Ga0207671_100112952	3300025914	Corn Rhizosphere	MDTERHPMRNRDLVSDGFLALTAAGLVLLCSSLFAYSFI
Ga0207693_104442861	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	VSDGRCTMRDNDFVSDGFLALIVAALVLLCSSWLVLAFS
Ga0207649_102694854	3300025920	Corn Rhizosphere	SGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA
Ga0207665_103145103	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	IRSSIADESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA
Ga0207667_105209534	3300025949	Corn Rhizosphere	IRPSIADESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFG
Ga0207677_119128321	3300026023	Miscanthus Rhizosphere	RCTMHNHDLVSDGFLALIVTALVLLCSSWLVLAFS
Ga0207641_103633961	3300026088	Switchgrass Rhizosphere	METERLPMRNRDLVSDGFLALTAAGLVLLCSSLFAYAFI
Ga0257170_10485492	3300026351	Soil	IVLFERRRTTAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS
Ga0257153_11135471	3300026490	Soil	TPRCTMRDHDLVSDGLLAVTAASLVLLCSGLLAIAFG
Ga0208983_10652413	3300027381	Forest Soil	LFERRRTTAAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS
Ga0208995_10338483	3300027388	Forest Soil	MAIGRCTMRNDDFVSDGFLALVAAGLVVLCSSLLA
Ga0208995_10376152	3300027388	Forest Soil	SLRSGRRCTMRNHDFVSDGFLALIAAGLLVLCSSLIVMAFS
Ga0209219_10915642	3300027565	Forest Soil	IESGRCTMRNHDFVSDGFLALIVAGLLLLCSSLLVIAFS
Ga0209220_10451921	3300027587	Forest Soil	SIESGRCTMRNHDFVSDGFLALIVAGLLLLCSGLLVIAFS
Ga0209736_10106027	3300027660	Forest Soil	MAIGRCTMRNRDLVSDAFLVLIATGLVLLCSSLLVIAFS
Ga0209006_115241391	3300027908	Forest Soil	RCPMRNRDFMSDGFLALVATGLVLLFSSLVAIALI
Ga0268265_113317681	3300028380	Switchgrass Rhizosphere	SGRRCSMRNHDFVSDGFLALIVTALVLLCSSWHVLAFS
Ga0268264_10000043343	3300028381	Switchgrass Rhizosphere	METERLPMRNRDLVSDGFLALTAAGFVLLCSSLFAYAFI
Ga0307320_101533361	3300028771	Soil	SGRRCSMRNHDFVSDGFLALIVTALVLLCSSWLVLAFS
Ga0307296_101087065	3300028819	Soil	RRCTMRNHDFMSGGFLALTVAGLVLLCSGLLAIAFS
Ga0075382_100101302	3300030917	Soil	METERLPMRNRDLVSDGFLALTLAGLVLLCSSLLAYSFI
Ga0308189_104172642	3300031058	Soil	TTAAGVPMRNHDFVSDGFLAIVAASLVLLCSGLLAIAFS
Ga0308188_10312451	3300031097	Soil	PRGVPMRNHDFVSDGFLAIIAASLVLLCTGLLAIAFS
Ga0307501_100263091	3300031152	Soil	SERAQDKRPAGVPMRNHDFVSDGFLAIIAASLVLLCSGLLAIAFS
Ga0170824_1001001241	3300031231	Forest Soil	MRTHDFVSDGFPALIASSLVLLCSSSLVIAFSQPLAFSGYSK
Ga0302323_1001566671	3300031232	Fen	METERFPMRDRDLVSNGFLAVTAAGLVLLCSSLLAYSFI
Ga0170818_1108021022	3300031474	Forest Soil	METERLPMRDSDLVSNGFLALTAAGLVLLCSSLLAYSFI
Ga0170818_1127300151	3300031474	Forest Soil	PSIKDESSRCPMRNHDLVSDGFLALTAGGLFLLCSSLVALAFG
Ga0307509_100378945	3300031507	Ectomycorrhiza	METERLPMRNRDLISDGFLALTAAGLVLLCSSLFAYSFI
Ga0318542_106643101	3300031668	Soil	GPECIMQDHDLVSDGFLALTAAAVALLCSGMLAFAFV
Ga0307469_103651803	3300031720	Hardwood Forest Soil	RSGRCIMPNRDFVSDGFLALTAASLVLLCSGLLAIALS
Ga0302321_1016878551	3300031726	Fen	TERLPMRDRDLVSNGFLAVTAAGLVLLCSSLLAYSFI
Ga0307405_115743402	3300031731	Rhizosphere	TGRCTMRDHDFVSDGFLALIVTSLVLLCSGWLVLAFSWS
Ga0307475_112807982	3300031754	Hardwood Forest Soil	FGGCIVRNHDLVSDSFLALTAAGLALLCSSLLAFALT
Ga0318567_107163931	3300031821	Soil	DRRCIMQDHDLVSDGFLALTAAGVALLCSSLLAFAFV
Ga0310917_108178552	3300031833	Soil	MKVEGCVMRNQDLVSDGFLALTAARFALLCSSLLAFAYCAD
Ga0318511_103920891	3300031845	Soil	GECIMHDHDLVSDGFLALTAAGVALLCSSLLAFAFV
Ga0306925_117109911	3300031890	Soil	GGCVMRNQDLVSNSYLALTVAGLALLGSCLLAFAFL
Ga0310909_114969692	3300031947	Soil	RCVMRNQDLVSDSYLALTVAGLALLGSCLLAFAFL
Ga0306926_102699555	3300031954	Soil	SIRSSIEDESDRCAMSNHDLVCDGFLALTAGGLILLCSSLVALAFA
Ga0308173_104236211	3300032074	Soil	DESGRCPMRNHDLVSDGFLALTAGGLVLLCSSLVALAFA
Ga0306924_125016431	3300032076	Soil	RTFENGGCVMRNQDLVSDGYLALTAAGIVLLCSSLLALAFA
Ga0307471_1030193512	3300032180	Hardwood Forest Soil	TGRCIMRNHDLVSDGFLTLIAASLLLLGSSLLAFAIV
Ga0348332_122662601	3300032515	Plant Litter	TLFRFGRCTMRKHDFVADGFLAVTGVSLVVLCSGLLAIAFG
Ga0348332_130346741	3300032515	Plant Litter	AGARTMRNHDFVSDGFLAVTAASLVLLCSGLLAIAFA
Ga0335070_108298671	3300032829	Soil	DNESGRCHMRSHDLVSNGFLVLTAGGLVLLCSSLVALAFA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign