| Basic Information | |
|---|---|
| Family ID | F063928 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 49 residues |
| Representative Sequence | ELGVPVINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSK |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.22 % |
| % of genes from short scaffolds (< 2000 bps) | 86.05 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.225 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.302 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.233 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.884 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.74% β-sheet: 0.00% Coil/Unstructured: 80.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 55.04 |
| PF03070 | TENA_THI-4 | 1.55 |
| PF01548 | DEDD_Tnp_IS110 | 0.78 |
| PF13964 | Kelch_6 | 0.78 |
| PF00528 | BPD_transp_1 | 0.78 |
| PF01344 | Kelch_1 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.22 % |
| Unclassified | root | N/A | 0.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000574|JGI1357J11328_10030785 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
| 3300003373|JGI25407J50210_10085938 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300003987|Ga0055471_10168833 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300003993|Ga0055468_10027802 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300003996|Ga0055467_10033848 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300003999|Ga0055469_10060778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300004156|Ga0062589_100763470 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300004463|Ga0063356_105309774 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300004778|Ga0062383_10024228 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300004782|Ga0062382_10043649 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300005171|Ga0066677_10842839 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005204|Ga0068997_10056492 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005295|Ga0065707_11094085 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005295|Ga0065707_11121201 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005331|Ga0070670_102191512 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005332|Ga0066388_106013417 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005355|Ga0070671_101731727 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005356|Ga0070674_100012248 | All Organisms → cellular organisms → Bacteria | 5263 | Open in IMG/M |
| 3300005437|Ga0070710_11033110 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005446|Ga0066686_10947339 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005471|Ga0070698_100108342 | All Organisms → cellular organisms → Bacteria | 2745 | Open in IMG/M |
| 3300005546|Ga0070696_100273706 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300005546|Ga0070696_101035100 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005555|Ga0066692_10461778 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005559|Ga0066700_10129025 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
| 3300005586|Ga0066691_10943678 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005718|Ga0068866_10991407 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006049|Ga0075417_10555269 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006175|Ga0070712_100348690 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300006358|Ga0068871_101629453 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300006800|Ga0066660_10071324 | All Organisms → cellular organisms → Bacteria | 2357 | Open in IMG/M |
| 3300006845|Ga0075421_100108396 | All Organisms → cellular organisms → Bacteria | 3491 | Open in IMG/M |
| 3300006852|Ga0075433_10178447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1890 | Open in IMG/M |
| 3300006852|Ga0075433_10396243 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300006880|Ga0075429_100437666 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300007004|Ga0079218_10839804 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300009100|Ga0075418_10418997 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300009174|Ga0105241_11291684 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300009801|Ga0105056_1000730 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
| 3300010361|Ga0126378_10502926 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300010401|Ga0134121_10199431 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300010403|Ga0134123_10050397 | All Organisms → cellular organisms → Bacteria | 3132 | Open in IMG/M |
| 3300011441|Ga0137452_1333243 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300011443|Ga0137457_1220864 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012038|Ga0137431_1196312 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012159|Ga0137344_1028941 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300012160|Ga0137349_1028686 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300012172|Ga0137320_1024119 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300012209|Ga0137379_10409631 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300012226|Ga0137447_1043316 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012362|Ga0137361_10065634 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
| 3300012499|Ga0157350_1058069 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012519|Ga0157352_1033195 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300012582|Ga0137358_11068337 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012899|Ga0157299_10112707 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012911|Ga0157301_10462249 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012944|Ga0137410_10346278 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300012948|Ga0126375_10065000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2017 | Open in IMG/M |
| 3300012961|Ga0164302_10350734 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300012971|Ga0126369_12803983 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012986|Ga0164304_10006017 | All Organisms → cellular organisms → Bacteria | 4971 | Open in IMG/M |
| 3300013297|Ga0157378_10339218 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300013306|Ga0163162_11882150 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300013308|Ga0157375_11411564 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300014154|Ga0134075_10216960 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300014304|Ga0075340_1031855 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300014487|Ga0182000_10391699 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300014885|Ga0180063_1220320 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300014968|Ga0157379_10537223 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300015264|Ga0137403_11572495 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300016270|Ga0182036_11662989 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300016371|Ga0182034_10305031 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300017944|Ga0187786_10097420 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300018052|Ga0184638_1320456 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300018075|Ga0184632_10460940 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018076|Ga0184609_10040925 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300018076|Ga0184609_10053559 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300018077|Ga0184633_10046266 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300018078|Ga0184612_10009222 | All Organisms → cellular organisms → Bacteria | 4980 | Open in IMG/M |
| 3300018084|Ga0184629_10189111 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300018433|Ga0066667_10175666 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300018469|Ga0190270_10303552 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300018482|Ga0066669_10605273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 961 | Open in IMG/M |
| 3300019356|Ga0173481_10012107 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
| 3300019883|Ga0193725_1106523 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300021073|Ga0210378_10135841 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300022309|Ga0224510_10516833 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300022563|Ga0212128_10401772 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300025165|Ga0209108_10396889 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300025167|Ga0209642_10677668 | Not Available | 553 | Open in IMG/M |
| 3300025537|Ga0210061_1019637 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300025567|Ga0210076_1124556 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300025936|Ga0207670_10627835 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300025972|Ga0207668_11081876 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300026014|Ga0208776_1004057 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300026075|Ga0207708_11442060 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300026090|Ga0208912_1008141 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300026095|Ga0207676_11537923 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300026118|Ga0207675_100036740 | All Organisms → cellular organisms → Bacteria | 4569 | Open in IMG/M |
| 3300026118|Ga0207675_100594493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1109 | Open in IMG/M |
| 3300027379|Ga0209842_1001065 | All Organisms → cellular organisms → Bacteria | 5445 | Open in IMG/M |
| 3300027526|Ga0209968_1031171 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300027665|Ga0209983_1059097 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300027715|Ga0208665_10066934 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300027831|Ga0209797_10077855 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300027831|Ga0209797_10142731 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300027843|Ga0209798_10048556 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300027873|Ga0209814_10295496 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300027907|Ga0207428_10827797 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300027909|Ga0209382_12259675 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027909|Ga0209382_12302325 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300028578|Ga0272482_10231487 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300028814|Ga0307302_10386208 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300028884|Ga0307308_10556737 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028885|Ga0307304_10420404 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300030606|Ga0299906_10773634 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031547|Ga0310887_10640245 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031740|Ga0307468_100244543 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300031903|Ga0307407_11205079 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300031965|Ga0326597_10656900 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300032000|Ga0310903_10473174 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300032005|Ga0307411_10882675 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300032075|Ga0310890_11063760 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032075|Ga0310890_11483595 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032180|Ga0307471_101408514 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300032211|Ga0310896_10302483 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300032770|Ga0335085_12474913 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300033551|Ga0247830_10023160 | All Organisms → cellular organisms → Bacteria | 3720 | Open in IMG/M |
| 3300034354|Ga0364943_0401265 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.20% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 3.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.55% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.78% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.78% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.78% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.78% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.78% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026090 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1357J11328_100307851 | 3300000574 | Groundwater | GVSHAELMVRSKISHSAKAYPCPEGLNAELVSQRSK* |
| JGI25407J50210_100859382 | 3300003373 | Tabebuia Heterophylla Rhizosphere | YVVTPEELEPHLGVPIINTKAVGVAYAELMVRSRISHSIKAYPCPTGLSPEVVSRRSK* |
| Ga0055471_101688332 | 3300003987 | Natural And Restored Wetlands | TLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCVTELSPEAVSRRLK* |
| Ga0055468_100278021 | 3300003993 | Natural And Restored Wetlands | PEELEPHLGVPVINTKAVGVSYAELMARSKISHSIKAYPCPGGLSPENVSQRAKL* |
| Ga0055467_100338481 | 3300003996 | Natural And Restored Wetlands | ELEPQLAVPVINTKAVGVSYAELMARSKISHSIKAYPCPTGLSPEAVSQRSR* |
| Ga0055469_100607782 | 3300003999 | Natural And Restored Wetlands | TPEELEPQLAVPVINTKAVGVSYAELMARSKISHSIKAYPCPTGLSPEAVSQRSR* |
| Ga0062589_1007634702 | 3300004156 | Soil | KAVGVSYAELMARNRIQHSIRAYPCQTGLDPETVSQRSK* |
| Ga0063356_1053097742 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTPQELEPRLGVPVINTKAVGVSQAELMVRSKITHSEKAYPWPSDLNPEHVSQRS* |
| Ga0062383_100242284 | 3300004778 | Wetland Sediment | PVINTKAVGVSYAELMARNNIKHSIKAYPCPTGLNPDAVSKRSK* |
| Ga0062382_100436491 | 3300004782 | Wetland Sediment | HLGVPVINTKAVGVSYAELMARNNIKHSIKAYPCPTGLNPDAVSKRSK* |
| Ga0066677_108428392 | 3300005171 | Soil | IGVPVVNTKAVGVSHAELMVRSKISHSQKAYPWSAGLSPEAVSQRSK* |
| Ga0068997_100564922 | 3300005204 | Natural And Restored Wetlands | QELEPHLGVPVVNTKAVGVSYAELMVRSKISHSAKAYPCPVGLNAELVSQRSK* |
| Ga0065707_110940852 | 3300005295 | Switchgrass Rhizosphere | KIYPYVVTPEELEPHLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK* |
| Ga0065707_111212012 | 3300005295 | Switchgrass Rhizosphere | LGVPVINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPDAVSKRSK* |
| Ga0070670_1021915122 | 3300005331 | Switchgrass Rhizosphere | INTKAVGVSYAELMARNKIQHSLRAYPCPTGLNPEAVSQRSK* |
| Ga0066388_1060134172 | 3300005332 | Tropical Forest Soil | GKIYPYVVTPEELEPVLGVPVINTKAVGVSYAELMVRNKISHSIKAYPWSSGLTPDSVSQRSK* |
| Ga0070671_1017317272 | 3300005355 | Switchgrass Rhizosphere | VPVINTKAVGVSYAELMVRNHIKHSIKAYPCPTGLDPEAVSQRSN* |
| Ga0070674_1000122488 | 3300005356 | Miscanthus Rhizosphere | KAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSKDTR* |
| Ga0070710_110331101 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | KIYPYVVTPEELEPHLGVPVINTKAVGVSYAELMARNRIKHSIKAYPCPTGLNPEAVSHRSK* |
| Ga0066686_109473392 | 3300005446 | Soil | KAVGVSHAELMVRSKISHSQKAYPWSAGLSPEAVSQRSK* |
| Ga0070698_1001083425 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LEPHLGVPVINTKAVGVSYAELMARNRIRHSIKAYPCPTGLNPEAVSHRSK* |
| Ga0070696_1002737062 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ELGVPVINTKAVGVSYAELMARNKIKHSLRAYPCPTGLSPEAVSQRSK* |
| Ga0070696_1010351001 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TPEELEPHLGVPVINTKAVGVSYAELMARNRIRHSIKAYPCPTGLNPEAVSHRSK* |
| Ga0066692_104617782 | 3300005555 | Soil | VGVSYAELMARNQIKHSIKAYPCPTGLDPEAVSQRSK* |
| Ga0066700_101290253 | 3300005559 | Soil | EPQIGVPIVNTKAVGVSYAELMVRSKISHSQKAYPWSAGLNPDSVSQRST* |
| Ga0066691_109436781 | 3300005586 | Soil | VPIVNTKAVGVSYAGLMVRSKISHSQKAYPWSAGLNPDSVSQRST* |
| Ga0068866_109914071 | 3300005718 | Miscanthus Rhizosphere | PYVVTPEELEPHLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSN* |
| Ga0075417_105552692 | 3300006049 | Populus Rhizosphere | YVVTPEELEPQLGVPVINTKAVGVSYAELMARNKIKHSLKAYPCPTGLKPEAVSQRAT* |
| Ga0070712_1003486901 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PVINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSK* |
| Ga0068871_1016294532 | 3300006358 | Miscanthus Rhizosphere | EELEPHFGVPVINTKAVAVKYAELMVRSKITHSIKAYPCPTGLSPEAVSRRAS* |
| Ga0066660_100713244 | 3300006800 | Soil | GVPVVNTKAVGVGHAELMVRSKISHSQKAYPWSAGLSPEAVSQRSK* |
| Ga0075421_1001083966 | 3300006845 | Populus Rhizosphere | VPIINTKAVGVSYAELMVRCRITHSQRAYPWSAGLNPEKVSMRQQ* |
| Ga0075433_101784471 | 3300006852 | Populus Rhizosphere | LGVPIINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSKDTR* |
| Ga0075433_103962431 | 3300006852 | Populus Rhizosphere | PYVVTPEELEPEIGVPVVNTKAVGVSYAELMVRSKISHSVKAYPWSAGLNPDAVSKRSR* |
| Ga0075429_1004376661 | 3300006880 | Populus Rhizosphere | YVVTPEELEPQLGVPVINTKAVGVSYAELMARNNLKHSIKAYPCLTGMDPESVSKRM* |
| Ga0079218_108398041 | 3300007004 | Agricultural Soil | PKLGVPIINTKAVGVSYAELMVRCRITHSQRAYPWSAGLNPEKVSMRQQ* |
| Ga0075418_104189972 | 3300009100 | Populus Rhizosphere | YVVTPEELEPHLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCPTGLTPEAVSRRSK* |
| Ga0105241_112916842 | 3300009174 | Corn Rhizosphere | PEELEPHFGVPVINTKAVAVKYAELMVRSKITHSIKAYPCPTGLSPEAVSRRAS* |
| Ga0105056_10007301 | 3300009801 | Groundwater Sand | KAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK* |
| Ga0126378_105029261 | 3300010361 | Tropical Forest Soil | SYAELMVRSKISHSVKAYPWSSGLDPNAVSQRSK* |
| Ga0134121_101994313 | 3300010401 | Terrestrial Soil | ELEPHFGVPVINTKAVAVKYAELMVRSKITHSIKAYPCPTGLSPEAVSRRAS* |
| Ga0134123_100503977 | 3300010403 | Terrestrial Soil | INTKAVGVSYAELMVRNHIKHSIKAYPCPTGLDPEAVSQRSN* |
| Ga0137452_13332432 | 3300011441 | Soil | NTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPDAVSKRSK* |
| Ga0137457_12208641 | 3300011443 | Soil | ELEPHLGVPVINTKAVGVSYAELMARNNIRHSIKAYPCPTGLSPDAVSKRSK* |
| Ga0137431_11963121 | 3300012038 | Soil | NTKAVGVSYAELMARSRISHSIKAYPCPTGLSPDAVSRRAK* |
| Ga0137344_10289412 | 3300012159 | Soil | VVTPDELEPHLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK* |
| Ga0137349_10286862 | 3300012160 | Soil | NLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK* |
| Ga0137320_10241191 | 3300012172 | Soil | PEELEPHLGVPVINTKAVGVSYAELMARNKFTHSIKAYPCPTGMDPEAVSKRM* |
| Ga0137379_104096311 | 3300012209 | Vadose Zone Soil | VGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK* |
| Ga0137447_10433161 | 3300012226 | Soil | PYVVTPEELEPHLGVPVINTKAVGVSHAELMARNKICHSIKAYPCPTGLSPEAVSQRGK* |
| Ga0137361_100656345 | 3300012362 | Vadose Zone Soil | YPYVVTPEELEPQIGVPVVNTKAVGVSYAELMVRSKISHSQKAYPWSAGLNPDSVSQRST |
| Ga0157350_10580692 | 3300012499 | Unplanted Soil | GVPVINTKAVGVSYAELMARNRIKHSLKAYPCPMGLNPEAVSQRAK* |
| Ga0157352_10331952 | 3300012519 | Unplanted Soil | ELMARNNIKHSIKAYPCPTGLDPEAVSQRSKHAH* |
| Ga0137358_110683371 | 3300012582 | Vadose Zone Soil | LGVPVINTKAVGVSYAELMARNRIKHSLKAYPCPTGLNPEAVSQRAK* |
| Ga0157299_101127071 | 3300012899 | Soil | TKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSKDTR* |
| Ga0157301_104622491 | 3300012911 | Soil | PEELEPELGVPIINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSKDTR* |
| Ga0137410_103462782 | 3300012944 | Vadose Zone Soil | TPEELEPHLGVPFINTKAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK* |
| Ga0126375_100650001 | 3300012948 | Tropical Forest Soil | IFPEELEPQIGAPVINTKAVGIRFAELMVLSHVTHSQKAYPWAPGLNPDAVVQRS* |
| Ga0164302_103507341 | 3300012961 | Soil | KAVGVSYAELMARNRIKHSLKAYPCPTGLNPEAVSQRAK* |
| Ga0126369_128039832 | 3300012971 | Tropical Forest Soil | VTPEELEPHLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK* |
| Ga0164304_100060171 | 3300012986 | Soil | LEPELGVPVINTKAVGVSYAELMARNHIKHSIKAYPCPTGLDPEAVSQRSK* |
| Ga0157378_103392181 | 3300013297 | Miscanthus Rhizosphere | PVINTKAVGVSYAELMVRNHIKHSIKAYPCPTGLDPEAVSQRSN* |
| Ga0163162_118821502 | 3300013306 | Switchgrass Rhizosphere | YPYVVTPEELEPELGVPVINTKAVGVSYAELMARNHIKHSIKAYPCPTGLDPEAVSQRSK |
| Ga0157375_114115641 | 3300013308 | Miscanthus Rhizosphere | PIINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSKDTR* |
| Ga0134075_102169601 | 3300014154 | Grasslands Soil | TKAVGVSHAELMVRSKISHSQKAYPWSAGLSPEAVSQRSK* |
| Ga0075340_10318551 | 3300014304 | Natural And Restored Wetlands | KIYPYVVTPEELEPHLGVPVINTKAVGVAYAELMARNNIKHSIKAYPCPTGLDPDSVSKRSK* |
| Ga0182000_103916991 | 3300014487 | Soil | NTKAVGVSQAELMVRSKITHSEKAYPWPSGLNPEQVSQRS* |
| Ga0180063_12203202 | 3300014885 | Soil | SYAELMARSKISHSIKAYPCPTGLTPEAVSQRAS* |
| Ga0157379_105372231 | 3300014968 | Switchgrass Rhizosphere | VDTPEELEPKLGVPIINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSKDTR |
| Ga0137403_115724951 | 3300015264 | Vadose Zone Soil | NTKAVGVSHAELMVRSKISHSQKAYPWSAGLSPEAVSQRSK* |
| Ga0182036_116629891 | 3300016270 | Soil | TPEELEPELGVPVINTKAVGVSYAELMARNKIKHSIKAYPCPTGLDPEAVSQRSKDAH |
| Ga0182034_103050311 | 3300016371 | Soil | IGVPIVNTKAVGVSYAELMVRSKISHSQKAYPWSAGLNPDSVSQRSK |
| Ga0187786_100974201 | 3300017944 | Tropical Peatland | YVVTPAELEPHLGVPVINTKAVGVSYAELMARNKIRHSIKAYPCATGLDPEAVSQRSR |
| Ga0184638_13204562 | 3300018052 | Groundwater Sediment | YPYVVTPDELEPHLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK |
| Ga0184632_104609402 | 3300018075 | Groundwater Sediment | GVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK |
| Ga0184609_100409253 | 3300018076 | Groundwater Sediment | SVINTKAVGVSYAELMARNKIKHSIKAYPCPSGLDPEAVSQRSK |
| Ga0184609_100535591 | 3300018076 | Groundwater Sediment | VPVINTKAVGVSYAELMARNKIKHSIKAYPCPSGLDPEAVSQRSK |
| Ga0184633_100462661 | 3300018077 | Groundwater Sediment | KAVGVSYAELMVRSRISHSVKAYPCPTGLNAELVSQRSK |
| Ga0184612_100092221 | 3300018078 | Groundwater Sediment | EELEPHLGVPVINTKAVGVSYAELMARNNLTHSIKAYPCPTGLDPETVSKRM |
| Ga0184629_101891112 | 3300018084 | Groundwater Sediment | INTKAVGVSYAELMVRSKISHSAKAYPCAAGLNAELVSRRSK |
| Ga0066667_101756662 | 3300018433 | Grasslands Soil | IGVPVVNTKAVGVSHAELMVRSKISHSQKAYPWSAGLSPEAVSQRSK |
| Ga0190270_103035521 | 3300018469 | Soil | NTKAVGVSYAELMARNNITHSIKAYPCPTGLDADAVSQRST |
| Ga0066669_106052731 | 3300018482 | Grasslands Soil | IGVPIVNTKAVGVSYAELMVRSKISHSAKAYPCPTGLNPDAVSSRSR |
| Ga0173481_100121071 | 3300019356 | Soil | NTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSKDTR |
| Ga0193725_11065231 | 3300019883 | Soil | EELEPQLGVPVINTKAVGVSYAELMARNRIKHSLKAYPCPTGLNPEAVSQRAK |
| Ga0210378_101358412 | 3300021073 | Groundwater Sediment | VVTPEELEPHLGVPVINTKAVGVSYAELMARNKIKHSIKAYPCPSGLDPETVSQRSG |
| Ga0224510_105168331 | 3300022309 | Sediment | LEPHFGVPVINTKAVGVKYAELMVRSKITHSIKAYPCPTGLKPEDVSRRSK |
| Ga0212128_104017722 | 3300022563 | Thermal Springs | LEPQIGVPIVNTKAVGVSYAELMVRSKISHSEKAYPCPSGLNPEAVSGRSK |
| Ga0209108_103968891 | 3300025165 | Soil | LGVPVINTKAVGVSCAELMARNKISHSIKAYPCPTGLDPEAVSQRSK |
| Ga0209642_106776681 | 3300025167 | Soil | TPQELEPHLGVPVVNTKAVGVGYAELMVRSKISHSAKAYPCPAGLNAELVSQRSK |
| Ga0210061_10196371 | 3300025537 | Natural And Restored Wetlands | KIYPYVVTPDELAPQLGVPVINTKAVGVSYAELMARNKIRHSIKAYPCPSDLDPAAVSKRSRL |
| Ga0210076_11245561 | 3300025567 | Natural And Restored Wetlands | AVPVINTKAVGVSYAELMARSKISHSIKAYPCPTGLSPEAVSQRSR |
| Ga0207670_106278351 | 3300025936 | Switchgrass Rhizosphere | INTKAVAVKYAELMVRSKITHSIKAYPCPTGLSPEAVSRRAS |
| Ga0207668_110818762 | 3300025972 | Switchgrass Rhizosphere | KAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSKDTR |
| Ga0208776_10040571 | 3300026014 | Rice Paddy Soil | TPEELAPHLGVPVINTKAVGVNYAELMARNKIQHSIKAYPCPTGLDPETVSQRSQ |
| Ga0207708_114420602 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | KIYPYVVQPEELEPELGVPVINTKAVGVSYAELMARNKIQHSLRAYPCPTGLNPEAVSQRSK |
| Ga0208912_10081411 | 3300026090 | Natural And Restored Wetlands | PEELEPTLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCVTELSPEAVSRRSK |
| Ga0207676_115379231 | 3300026095 | Switchgrass Rhizosphere | PVINTKAVGVSYAELMARNKIQHSLRAYPCPTGLNPEAVSQRSK |
| Ga0207675_1000367401 | 3300026118 | Switchgrass Rhizosphere | TKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSKDTR |
| Ga0207675_1005944932 | 3300026118 | Switchgrass Rhizosphere | NTKAVGVSYAELMARNKIKHSLRAYPCPTGLSPEAVSQRSK |
| Ga0209842_10010658 | 3300027379 | Groundwater Sand | IYPYVVTPDELEPHLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRS |
| Ga0209968_10311712 | 3300027526 | Arabidopsis Thaliana Rhizosphere | VINTKAVGVSYAELMARNKIQHSIKAYPCPTGLDPETVSQRSR |
| Ga0209983_10590972 | 3300027665 | Arabidopsis Thaliana Rhizosphere | HLGVPVINTKAVGVSYAELMARNKIQHSIKAYPCPTGLDPETVSQRSR |
| Ga0208665_100669342 | 3300027715 | Deep Subsurface | GVPVINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPDAVSKRSK |
| Ga0209797_100778552 | 3300027831 | Wetland Sediment | NTKAVGVSYAELMARNNIKHSIKAYPCPTGLKADAVSKRS |
| Ga0209797_101427313 | 3300027831 | Wetland Sediment | KAVGVSYAELMVRSKISHSAKAYPCPAGLNAELVSQRSK |
| Ga0209798_100485564 | 3300027843 | Wetland Sediment | TPEELEPHLGVPVINTKAVGVSYAELMARNNIKHSIKAYPCPTGLNPDAVSKRSK |
| Ga0209814_102954962 | 3300027873 | Populus Rhizosphere | PQLGVPVINTKAVGVSYAELMARNQIKHSIKAYPCPTGLNPEAVSQRSK |
| Ga0207428_108277972 | 3300027907 | Populus Rhizosphere | HLGVPVINTKAVGVAYAELMVRSKISHSIKAYPCPTGLSPEAVSRRSK |
| Ga0209382_122596752 | 3300027909 | Populus Rhizosphere | VTPQELEPELGVPVINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPETVSQRSKHAH |
| Ga0209382_123023252 | 3300027909 | Populus Rhizosphere | KIYPYVVTPEELEPHLGVPVINTKAVGVSYAELMARNNLKHSLKAYPCLTGMDPESVSQR |
| Ga0272482_102314872 | 3300028578 | Soil | NLGVPIINTKAVGVSYAELMVRCRITHSQRAYPWSAGLNPEKVSMRQQ |
| Ga0307302_103862082 | 3300028814 | Soil | LNTKAVGVSYAELMARNKIKHSIKAYPCPSGLDPETVSQRSG |
| Ga0307308_105567372 | 3300028884 | Soil | EPHLGVPVINTKAVGVSYAELMARNRIRHSIKAYPCPTGLNPEAVSHRSK |
| Ga0307304_104204042 | 3300028885 | Soil | PHLGVPVINTKAVGVSYAELMARNRIRHSIKAYPCPTGLNPEAVSHRSK |
| Ga0299906_107736341 | 3300030606 | Soil | VGVSYAELMARNKISHSSKAYPCPTGLDPEAVSQRSK |
| Ga0310887_106402451 | 3300031547 | Soil | PVINTKAVGVSYAELMARNHIKHSIKAYPCPTGLDPDAVSKRSK |
| Ga0307468_1002445433 | 3300031740 | Hardwood Forest Soil | VPVINTKAVGVSYAELMVRSKISHSIKAYPWSSGLNPDAVSQRSK |
| Ga0307407_112050791 | 3300031903 | Rhizosphere | NTKAVGVSYAELMVRCRITHSQRAYPWSAGLNPEKVSMRQQ |
| Ga0326597_106569001 | 3300031965 | Soil | INTKAVGVSYAELMARSKISHSIKAYPCPTGLTPEAVSQRAR |
| Ga0310903_104731741 | 3300032000 | Soil | KIYPYVVTPEELEPHLGVPVINTKAVGVSYAELMARNHIKHSIKAYPCPTGLDPDAVSKRSK |
| Ga0307411_108826752 | 3300032005 | Rhizosphere | PQLGVPVINTKAVGVSYAELMARNHIKHSIKAYPCPTGLDPDAVSKRSK |
| Ga0310890_110637601 | 3300032075 | Soil | ELGVPVINTKAVGVSYAELMARNNIKHSIKAYPCPTGLDPEAVSQRSK |
| Ga0310890_114835952 | 3300032075 | Soil | AVGVSYAELMVRCRITHSQLAYPWSAGLNPEKVSMRQQ |
| Ga0307471_1014085142 | 3300032180 | Hardwood Forest Soil | TPEELEPHLGVPVINTKAVGVSYAELMARNKLKHSIKAYPCPTGLDPEAVSKRM |
| Ga0310896_103024831 | 3300032211 | Soil | VGVSYAELMARNKIKHSLKAYPCPTGLKPEAVSQRAT |
| Ga0335085_124749131 | 3300032770 | Soil | PAIGVPIVNTKAVGVAYAELMVRSKISHSIKAYPYTAGLNPDDVSQRSK |
| Ga0247830_100231606 | 3300033551 | Soil | PIINTKAVGVSYAELMVRCRITHSQRAYPWSAGLNPEKVSMRQQ |
| Ga0364943_0401265_2_139 | 3300034354 | Sediment | VPVINTKAVGVSYAELLARSKISHSIKAYPCPTGLTPEAVSQRAK |
| ⦗Top⦘ |