NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F063898

Metagenome Family F063898

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063898
Family Type Metagenome
Number of Sequences 129
Average Sequence Length 41 residues
Representative Sequence MTALTAMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSLVVGIL
Number of Associated Samples 91
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 60.16 %
% of genes near scaffold ends (potentially truncated) 95.35 %
% of genes from short scaffolds (< 2000 bps) 93.02 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.496 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(43.411 % of family members)
Environment Ontology (ENVO) Unclassified
(63.566 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.512 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.70%    β-sheet: 0.00%    Coil/Unstructured: 49.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF06411HdeA 3.88
PF04392ABC_sub_bind 3.10
PF03734YkuD 1.55
PF00216Bac_DNA_binding 0.78
PF04185Phosphoesterase 0.78
PF01977UbiD 0.78
PF13676TIR_2 0.78
PF13751DDE_Tnp_1_6 0.78
PF12951PATR 0.78
PF00239Resolvase 0.78
PF00313CSD 0.78
PF01590GAF 0.78
PF12895ANAPC3 0.78
PF13396PLDc_N 0.78
PF13545HTH_Crp_2 0.78
PF09834DUF2061 0.78
PF00293NUDIX 0.78
PF10908DUF2778 0.78
PF03401TctC 0.78
PF13481AAA_25 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 3.10
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 1.55
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 1.55
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.78
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.78
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.78
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.78
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.78
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.50 %
UnclassifiedrootN/A15.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000580|AF_2010_repII_A01DRAFT_1024659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium948Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10070850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium753Open in IMG/M
3300000955|JGI1027J12803_100994580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria689Open in IMG/M
3300005332|Ga0066388_107121173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300005713|Ga0066905_100517422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium995Open in IMG/M
3300005713|Ga0066905_100725061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium855Open in IMG/M
3300005713|Ga0066905_100839630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium799Open in IMG/M
3300005713|Ga0066905_101858535Not Available556Open in IMG/M
3300005764|Ga0066903_101264833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1375Open in IMG/M
3300005764|Ga0066903_101919659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1135Open in IMG/M
3300005764|Ga0066903_103296782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium872Open in IMG/M
3300005764|Ga0066903_104049376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium785Open in IMG/M
3300005764|Ga0066903_106140162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium628Open in IMG/M
3300005764|Ga0066903_106944357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300005764|Ga0066903_107822536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300006028|Ga0070717_10529304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1066Open in IMG/M
3300006175|Ga0070712_101646351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300006846|Ga0075430_101170977Not Available633Open in IMG/M
3300009553|Ga0105249_12966896Not Available545Open in IMG/M
3300010043|Ga0126380_10010486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4140Open in IMG/M
3300010358|Ga0126370_11041623Not Available750Open in IMG/M
3300010362|Ga0126377_10471442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1282Open in IMG/M
3300010366|Ga0126379_12653284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300010366|Ga0126379_13825645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300010376|Ga0126381_100606064Not Available1558Open in IMG/M
3300010376|Ga0126381_103144841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium653Open in IMG/M
3300010376|Ga0126381_103603907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium607Open in IMG/M
3300010376|Ga0126381_104410923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300010398|Ga0126383_10739939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1063Open in IMG/M
3300012199|Ga0137383_10270387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1245Open in IMG/M
3300012360|Ga0137375_10610874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria906Open in IMG/M
3300012362|Ga0137361_10510672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1104Open in IMG/M
3300012917|Ga0137395_10335107All Organisms → cellular organisms → Bacteria → Proteobacteria1076Open in IMG/M
3300012955|Ga0164298_10719575Not Available703Open in IMG/M
3300012986|Ga0164304_10488111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium897Open in IMG/M
3300014968|Ga0157379_11541456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium647Open in IMG/M
3300015201|Ga0173478_10436344Not Available638Open in IMG/M
3300016319|Ga0182033_10393547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1169Open in IMG/M
3300016319|Ga0182033_11232011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300016341|Ga0182035_10393537Not Available1163Open in IMG/M
3300016341|Ga0182035_11945861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300016371|Ga0182034_10115902All Organisms → cellular organisms → Bacteria1952Open in IMG/M
3300016387|Ga0182040_11054988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium679Open in IMG/M
3300016387|Ga0182040_11331889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium607Open in IMG/M
3300016404|Ga0182037_10792124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria817Open in IMG/M
3300016445|Ga0182038_10825931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium813Open in IMG/M
3300021560|Ga0126371_10369746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1572Open in IMG/M
3300025898|Ga0207692_10964406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300026118|Ga0207675_100525100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1180Open in IMG/M
3300026320|Ga0209131_1272708All Organisms → cellular organisms → Bacteria → Proteobacteria648Open in IMG/M
3300027326|Ga0209731_1047486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300027646|Ga0209466_1126444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300027874|Ga0209465_10296989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium809Open in IMG/M
3300027909|Ga0209382_10535742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1284Open in IMG/M
3300028379|Ga0268266_10258000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1615Open in IMG/M
3300028828|Ga0307312_10440205Not Available858Open in IMG/M
3300031544|Ga0318534_10421782Not Available765Open in IMG/M
3300031561|Ga0318528_10099095All Organisms → cellular organisms → Bacteria → Proteobacteria1528Open in IMG/M
3300031572|Ga0318515_10508940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300031573|Ga0310915_10066334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2367Open in IMG/M
3300031573|Ga0310915_10387220All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300031679|Ga0318561_10462523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300031723|Ga0318493_10706956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300031724|Ga0318500_10043714Not Available1870Open in IMG/M
3300031744|Ga0306918_10256995Not Available1335Open in IMG/M
3300031744|Ga0306918_10518472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium933Open in IMG/M
3300031751|Ga0318494_10438886Not Available759Open in IMG/M
3300031751|Ga0318494_10522426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium692Open in IMG/M
3300031763|Ga0318537_10082920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1182Open in IMG/M
3300031765|Ga0318554_10575040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300031765|Ga0318554_10687632Not Available574Open in IMG/M
3300031768|Ga0318509_10763466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300031771|Ga0318546_11042370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300031777|Ga0318543_10326718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300031778|Ga0318498_10495033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300031792|Ga0318529_10149484Not Available1074Open in IMG/M
3300031793|Ga0318548_10207400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium962Open in IMG/M
3300031793|Ga0318548_10349229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300031796|Ga0318576_10187922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium970Open in IMG/M
3300031798|Ga0318523_10118081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1309Open in IMG/M
3300031821|Ga0318567_10269043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium958Open in IMG/M
3300031821|Ga0318567_10551102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300031821|Ga0318567_10628113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300031833|Ga0310917_10018515All Organisms → cellular organisms → Bacteria3967Open in IMG/M
3300031879|Ga0306919_10237525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1367Open in IMG/M
3300031890|Ga0306925_10198979All Organisms → cellular organisms → Bacteria2160Open in IMG/M
3300031890|Ga0306925_10432763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1407Open in IMG/M
3300031890|Ga0306925_11547836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium647Open in IMG/M
3300031890|Ga0306925_11590253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300031897|Ga0318520_10274890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1010Open in IMG/M
3300031910|Ga0306923_10512773All Organisms → cellular organisms → Bacteria → Proteobacteria1355Open in IMG/M
3300031910|Ga0306923_12306312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300031912|Ga0306921_12356810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300031941|Ga0310912_11082660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium613Open in IMG/M
3300031942|Ga0310916_11666502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300031945|Ga0310913_10125719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1754Open in IMG/M
3300031946|Ga0310910_10119208Not Available1984Open in IMG/M
3300031946|Ga0310910_10877464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium704Open in IMG/M
3300031946|Ga0310910_11523703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300031954|Ga0306926_10178322All Organisms → cellular organisms → Bacteria2635Open in IMG/M
3300031981|Ga0318531_10016112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila2910Open in IMG/M
3300031981|Ga0318531_10157145All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1019Open in IMG/M
3300032001|Ga0306922_10147871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2510Open in IMG/M
3300032001|Ga0306922_10430544Not Available1411Open in IMG/M
3300032001|Ga0306922_11023810All Organisms → cellular organisms → Bacteria → Proteobacteria851Open in IMG/M
3300032008|Ga0318562_10544850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300032025|Ga0318507_10383251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300032035|Ga0310911_10431857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium762Open in IMG/M
3300032035|Ga0310911_10788059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300032035|Ga0310911_10848498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300032035|Ga0310911_10903484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300032039|Ga0318559_10379746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium658Open in IMG/M
3300032041|Ga0318549_10255111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium789Open in IMG/M
3300032044|Ga0318558_10583558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300032051|Ga0318532_10274591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300032055|Ga0318575_10388812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium708Open in IMG/M
3300032059|Ga0318533_10104349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1965Open in IMG/M
3300032060|Ga0318505_10163280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1035Open in IMG/M
3300032063|Ga0318504_10451507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300032063|Ga0318504_10618507Not Available521Open in IMG/M
3300032065|Ga0318513_10583491All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium547Open in IMG/M
3300032066|Ga0318514_10116588All Organisms → cellular organisms → Bacteria → Proteobacteria1366Open in IMG/M
3300032076|Ga0306924_12489186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300032091|Ga0318577_10638340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300032094|Ga0318540_10528078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300032261|Ga0306920_100039734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6792Open in IMG/M
3300033289|Ga0310914_11818417Not Available513Open in IMG/M
3300033289|Ga0310914_11838266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil43.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.16%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil10.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.10%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.33%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027326Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A01DRAFT_102465913300000580Forest SoilMTGLTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLA
AF_2010_repII_A001DRAFT_1007085033300000793Forest SoilMTALTTMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLA
JGI1027J12803_10099458033300000955SoilMDKLLFWLGLGAAQKAAGSKPIERWNWVVSLVVGALVAAVM
Ga0066388_10712117323300005332Tropical Forest SoilMTALTAMDKLLFWLGLGAAQKGARSKEVKPSRHWVVSLVAGILLAL
Ga0066905_10051742223300005713Tropical Forest SoilMTALTGMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSLVVGIH*
Ga0066905_10072506123300005713Tropical Forest SoilMDKLLFWLGLGAAQKGAGSKPTVDWHFAVSFVVGILIAVL*
Ga0066905_10083963023300005713Tropical Forest SoilMMALTGMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSFVVGI*
Ga0066905_10185853523300005713Tropical Forest SoilMDKLLFWLGIGAAQKGARSKELKLSRHPVTSFFVGVLIALLIA
Ga0066903_10126483333300005764Tropical Forest SoilMDKLLFWLGIGAAQKGAGSEEVERSRHPGISFVVGVLIAC*
Ga0066903_10191965913300005764Tropical Forest SoilMTALTAMDKLLFWLGIGAAQKGAGSEEVKRSRHPVISF
Ga0066903_10329678223300005764Tropical Forest SoilMDKLLFWLGLGAAQKGAGSKEIKPTRHPVIAFVVGIL
Ga0066903_10404937613300005764Tropical Forest SoilMGRLLFWLGLGAAQKGAGSKPTKDRHPVVSVLVGILIAVLI
Ga0066903_10614016223300005764Tropical Forest SoilMMALSAMDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGIL
Ga0066903_10694435723300005764Tropical Forest SoilMALSAMDKLLFWLGIGAAQKGARSNEVKPSLHPVVSFVVGILLA
Ga0066903_10782253613300005764Tropical Forest SoilMTALTGVDKLLFWLGIGVAQKGAGSKEVKPSRHWV
Ga0070717_1052930413300006028Corn, Switchgrass And Miscanthus RhizosphereMDKLLFWLGLGAAQKGAGSKPTVDRHWVVSLVVGILIAVL
Ga0070712_10164635113300006175Corn, Switchgrass And Miscanthus RhizosphereMTALTAMDKLLFWLGLGAAQKGARSKEVKPSRHWV
Ga0075430_10117097733300006846Populus RhizosphereMTALTTMDKLLCWLGLGAAQKGAGSKEVNPSRHWV
Ga0105249_1296689613300009553Switchgrass RhizosphereMGNLPFWLGIGAAQKSAGSKQLKPSRHPILAFIVG
Ga0126380_1001048613300010043Tropical Forest SoilPAPMMALTGMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSFVVGI*
Ga0126370_1104162313300010358Tropical Forest SoilMMALTAMDKLLFWLGIGAAQKGARSKEVKPSRHPVTSFVVGNPVDSCR
Ga0126377_1047144233300010362Tropical Forest SoilMALTGMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSFVVGI*
Ga0126379_1265328423300010366Tropical Forest SoilMTALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLALLI
Ga0126379_1382564523300010366Tropical Forest SoilMDKLLFWLGLGAAQKGAGSKPTVDRHPVISLVVGILIA
Ga0126381_10060606413300010376Tropical Forest SoilMMALSAMDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGI
Ga0126381_10314484113300010376Tropical Forest SoilMTALTAMNKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLALL
Ga0126381_10360390723300010376Tropical Forest SoilMMALTAMDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGILL
Ga0126381_10441092313300010376Tropical Forest SoilMTALTAMDKLLFWLGLGAAQKVAGSNKRTDSRHWVIS
Ga0126383_1073993923300010398Tropical Forest SoilMTALTTMDKLLFWLGIGAAQKGAGSNKRTDSRHWVI
Ga0137383_1027038713300012199Vadose Zone SoilMDKLLFWLGIGAAQKSAGSKPTDNRHPVTSFVVGILLAP
Ga0137375_1061087413300012360Vadose Zone SoilMDNLLFWLGIGAAQKGAGSKPIKRRHWVASLVVGILIAVLIAA
Ga0137361_1051067243300012362Vadose Zone SoilMGNLLFWLGIGAAQKGARSKEVKPSRHPVTSFVVGVLIA
Ga0137395_1033510713300012917Vadose Zone SoilMGNLLFWLGIGAAQKGARSKPTDSRHWIGSFIVGIL
Ga0164298_1071957513300012955SoilMGNLLFWLGIGAAQKGAGSTGLKPSRHPVISFVFGLVVAL
Ga0164304_1048811133300012986SoilMGNLLFWLGLGAAQKGARSKEVKARRHWVISLLAGILVALL
Ga0157379_1154145633300014968Switchgrass RhizosphereMTALTAMDKLLFWLGLGAAQKGARSNEVKPGRHWVVSLVAGILIALLI
Ga0173478_1043634413300015201SoilMGNLPFWLGIGAAQKSAGSKELKPSRHPIIAFVVGTLIALAI
Ga0182033_1039354743300016319SoilMTDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVA
Ga0182033_1123201113300016319SoilMTALTAMDKLLFWLGLGAAQKGARSKEVKPSRHWVVSL
Ga0182035_1039353713300016341SoilMTALTAMDKLLSWLGLGAAQKGAGSKPTKDRHPVVSVVVG
Ga0182035_1194586113300016341SoilMTALTAMDKLLFWLGLGAAQKGAGSKPTKDRHPVVSVVVGILIAL
Ga0182034_1011590243300016371SoilMMALTAMDKLLFWLGIGAAQKGAGSKAVKPSRHPVT
Ga0182040_1105498813300016387SoilMTDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGIL
Ga0182040_1133188913300016387SoilMDKLLFWLGIGAAQKGARSKESKPSRHPVVSFVVGI
Ga0182037_1079212433300016404SoilMDKLLFWLGLGAVQKGAGSNKRTDSRHWVISLVAG
Ga0182038_1082593123300016445SoilMTALTAMDKLLFWLGLGAAQKVAGSNKRTDSRHWVISLVAGILLALLIAA
Ga0126371_1036974613300021560Tropical Forest SoilMTALTAMNKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLA
Ga0207692_1096440623300025898Corn, Switchgrass And Miscanthus RhizosphereMTALTAMNKLLFWLGLGAAQKGARSKEVKPSRHWVIALV
Ga0207675_10052510013300026118Switchgrass RhizosphereMGKLLFWLGIGAAQKSAGSKPPVQRNWVVSLVVGALVAAVMI
Ga0209131_127270823300026320Grasslands SoilMGNLLFWLGIGAAQKGARSKPTDSRHWIGSFIVGILFPLLIAA
Ga0209731_104748613300027326Forest SoilMDKLLFWLGIGAAQKGAGSKEVKPSRHWVVSLVVGILIAVLIGV
Ga0209466_112644413300027646Tropical Forest SoilMTALTAMNKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLAL
Ga0209465_1029698913300027874Tropical Forest SoilMDKLLFWLGIGAAQKGAGSKEVKPSRHPVTSFVVGT
Ga0209382_1053574243300027909Populus RhizosphereVALTAMDKLLFWLGIGAAQEGAGSKPTDSRHPVISFLVGVLIAL
Ga0268266_1025800013300028379Switchgrass RhizosphereMGNLPFWLGIGAAQKSAGSKQLKPSRHPILAFIVGTLI
Ga0307312_1044020523300028828SoilMSNLPFWLGIGAAQKGAGSKGLKPSRHPLIAFVVGIL
Ga0318534_1042178223300031544SoilMDKLLFWLGIGAAQKGARSKEAKPSRHPVVSFVAGTL
Ga0318528_1009909513300031561SoilMTALTAMDKLLFWLGIGAAQKGAGSKPAVDRHPVISFVAGIL
Ga0318515_1050894023300031572SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGIL
Ga0310915_1006633463300031573SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLAL
Ga0310915_1038722013300031573SoilMMGNLLFWLGIGAAQKSARSKPTDNRHWVSSFVVGILFPL
Ga0318561_1046252313300031679SoilMTDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAG
Ga0318493_1070695623300031723SoilMDKLLFWLGIGAAQEGARSKEVKPNRHPVISLVIGILIAVLITFG
Ga0318500_1004371433300031724SoilMMGNLFFWLGIGAAQKGAGSKEVKPSRHPVISLVAGILLALLIA
Ga0306918_1025699533300031744SoilMTALTAMDKLLSWLGLGAAQKGAGSKPTKDRHPVVSVVVGVLIAVLIAA
Ga0306918_1051847213300031744SoilMTALSAMDKLLFWLGIGAAQKGARSKEVKPSRHWVISFVAGILLALV
Ga0318494_1043888633300031751SoilMDKLLFWLGLGAAQKGAASKEVKPSRHPVTSFVVGILLA
Ga0318494_1052242613300031751SoilMDKLLFWLGMGAAQKGAGPNKRTDSRHWVISLVAGILLALLIAAG
Ga0318537_1008292013300031763SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAEILLAL
Ga0318554_1057504023300031765SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWV
Ga0318554_1068763223300031765SoilMDKLLFWLGIGAAQKGARSKEAKPSRHPVVSFVAGTLLA
Ga0318509_1076346613300031768SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISL
Ga0318546_1104237013300031771SoilMTALTAMDKLLFWLGLGAAQKGAGSKEVKPSRHPVISFVVGILLALLI
Ga0318543_1032671833300031777SoilMTALVAMDKLLFWLGLGAAQKGAGSKEVNASRHWVVSLVVGILI
Ga0318498_1049503313300031778SoilMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISL
Ga0318529_1014948443300031792SoilMDKLLFWLGLGAAQKGAASKEVKPSRHPVTSFVVGILLALLI
Ga0318548_1020740013300031793SoilMDKLLFWLGMGAAQKGAGPNKRTDSRHWVISLVAGILLAL
Ga0318548_1034922933300031793SoilMTALTAMDKLLFWLGLGAAQKGAGSKEVKPSRHPVISF
Ga0318576_1018792213300031796SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGI
Ga0318523_1011808133300031798SoilMMALTAMDKLLFWLGLGAAQKGAGANKRTDSRHWVISLVAGILL
Ga0318567_1026904313300031821SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLA
Ga0318567_1055110223300031821SoilMDKLLFWLGIGAAQEGARSKEVKPNRHPVISLVLGILIAV
Ga0318567_1062811333300031821SoilMTALTAMDKLLFWVGLGAAQKGAGSKPSASRHPFISFVVGILIA
Ga0310917_1001851513300031833SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWL
Ga0306919_1023752533300031879SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVIS
Ga0306925_1019897913300031890SoilMTALTAMDKLLFWLGLGAAQKGAGSKPTKDRHPVVSVV
Ga0306925_1043276343300031890SoilMTALTAMDKLLFWLGLGAAQKGAGSKEVQPSRHWVVSVVAGI
Ga0306925_1154783623300031890SoilMTALTAMDKLLSWLGLGAAQKGAGSKPTKDRHPVVSV
Ga0306925_1159025313300031890SoilMTALTAMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSLVVGIL
Ga0318520_1027489033300031897SoilMTALTAMDKLLFWLGLGAAQKVAGSNKRTDSRHWVISLV
Ga0306923_1051277333300031910SoilMDKLLFWLGLGAAQKGAGSKPTVDRHWVISLVAGILLA
Ga0306923_1230631213300031910SoilMTAAHCMGNLLFWLGIGAAQKGARPKEVKPSRHWVVSFVVGTLLA
Ga0306921_1235681023300031912SoilMRALTAMDKLLFWLGIGAAQEGAKSNERTDSRHWVISLVA
Ga0310912_1108266023300031941SoilMDKLLFWLGIGAAQKGSGSKPSASRHPVLSFVVGILLAL
Ga0310916_1166650213300031942SoilMTALTAMDKLLSWLGLGAAQKGAGSKPTKDRHPVVSVVVGV
Ga0310913_1012571933300031945SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVA
Ga0310910_1011920813300031946SoilDKLLFWLGIGAAQKGAGSEPTKRRHPVVSLVVGVLMAALVAV
Ga0310910_1087746423300031946SoilMDKLLFWLGLGAAQKGAGSKPTKRGNWVVSLVVGTLIAALI
Ga0310910_1152370323300031946SoilMTALTAMDKLLFWLGLGAAQKVAGSNKRTDSRHWVISLVA
Ga0306926_1017832213300031954SoilMGNLLFWLGIGAAQKGARSKEVKPRRHPVISFVVGILLA
Ga0306926_1226230623300031954SoilMTALTAMDKLLFWLGLGAAQKGAGSKPTNDRHPVVSVEFDLLR
Ga0318531_1001611223300031981SoilMTALIAMDKLLFWFGIGAAQKSAGSKEIKPSRHWVVSLVVGILIAG
Ga0318531_1015714513300031981SoilMTALTAMDKLLFWLGIGAAQKGAGSKPAVDRHPVISFVAGILLAVLI
Ga0306922_1014787163300032001SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAG
Ga0306922_1043054433300032001SoilMDKLLFWLGIGAAQKGARSKESKPSRHPVVSFVVGIVLALLIAA
Ga0306922_1102381033300032001SoilMDKLLFWLGIGAAQKGAGSEPTKRRHPVVSLVVGILIAVLIA
Ga0318562_1054485013300032008SoilMTALTAMDKLLFWLGIGAAQKGARSKDVKPSRHWVISLVAG
Ga0318507_1038325113300032025SoilMDKLLFWLGIGAAQEGARSKEVKPNRHPVISLVIGILI
Ga0310911_1043185713300032035SoilMMALTAMDKLLFWLGIGAAQKGAGSKEVKPSRHPVTSFVVGTLLAL
Ga0310911_1078805923300032035SoilMGNLLFWLGIGAAQEGARSKEIKASRHWVMSFVAGILLALVI
Ga0310911_1084849813300032035SoilMDKLLFWLGIGAAQKAAGSNKRTDGRHRVISLVAGILLALL
Ga0310911_1090348423300032035SoilMRALTAMDKLLFWLGIGAAQEGAKSNERTDSRHWVISL
Ga0318559_1037974613300032039SoilMTALTTMDKLLFWLGIGAAQKGAGSNNRTDSRRWVISLVAGIL
Ga0318549_1025511133300032041SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAEILLALLI
Ga0318558_1058355813300032044SoilMMALSAMDKLLFWLGIGVAQKRAGSNKRTDSRHWVISLVAGILL
Ga0318532_1027459123300032051SoilMTALTAMDKLLFWLGLGAAQRGAGSNKRTDSRHWVISLVAGILLAL
Ga0318575_1038881223300032055SoilMDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGIL
Ga0318533_1010434913300032059SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRQWVISLV
Ga0318505_1016328033300032060SoilMRALTAMDKLLFWLGIGAAQEGAKSNERTDSRHWVISLVAGILLALLI
Ga0318504_1045150713300032063SoilMDKLLFWLGIGAAQEGARSKEVKPNRHPVISLVIGILIA
Ga0318504_1061850723300032063SoilMMGNLFFWLGIGAAQKGAGSKEVKPSRHPVISLVA
Ga0318513_1058349113300032065SoilMTALTAMDKLLFWLGIGAAQKSAGSKPAVDRHPVISFVAGIL
Ga0318514_1011658823300032066SoilMDKLLFWLGLGAAQKGAASKEVKPSRHPVTSFVVGILL
Ga0306924_1248918613300032076SoilMDKLLFWLGIGAAQKAAGSNKRTDGRHRVISLVAGILLALLI
Ga0318577_1063834013300032091SoilMMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILL
Ga0318540_1052807813300032094SoilMDKLLFWLGIGAAQKGAGPKPTKRQNWVVSLIVGTLVVAVII
Ga0306920_10003973413300032261SoilMDKLLFWLGIGATQKGAGSEEVKRSRHPVISFVVGILLAVL
Ga0310914_1181841713300033289SoilMMALTAMDKLLFWLGIGAAQKGAGSKEVKPSRHPVTSF
Ga0310914_1183826613300033289SoilMMALTAMDKLHFWLGIGAAQKGAGSEEVKPSRHWVVSFVV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.