Basic Information | |
---|---|
Family ID | F063898 |
Family Type | Metagenome |
Number of Sequences | 129 |
Average Sequence Length | 41 residues |
Representative Sequence | MTALTAMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSLVVGIL |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 60.16 % |
% of genes near scaffold ends (potentially truncated) | 95.35 % |
% of genes from short scaffolds (< 2000 bps) | 93.02 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.496 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (43.411 % of family members) |
Environment Ontology (ENVO) | Unclassified (63.566 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.512 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF06411 | HdeA | 3.88 |
PF04392 | ABC_sub_bind | 3.10 |
PF03734 | YkuD | 1.55 |
PF00216 | Bac_DNA_binding | 0.78 |
PF04185 | Phosphoesterase | 0.78 |
PF01977 | UbiD | 0.78 |
PF13676 | TIR_2 | 0.78 |
PF13751 | DDE_Tnp_1_6 | 0.78 |
PF12951 | PATR | 0.78 |
PF00239 | Resolvase | 0.78 |
PF00313 | CSD | 0.78 |
PF01590 | GAF | 0.78 |
PF12895 | ANAPC3 | 0.78 |
PF13396 | PLDc_N | 0.78 |
PF13545 | HTH_Crp_2 | 0.78 |
PF09834 | DUF2061 | 0.78 |
PF00293 | NUDIX | 0.78 |
PF10908 | DUF2778 | 0.78 |
PF03401 | TctC | 0.78 |
PF13481 | AAA_25 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.10 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.55 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.78 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.78 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.78 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.78 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.78 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.50 % |
Unclassified | root | N/A | 15.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000580|AF_2010_repII_A01DRAFT_1024659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 948 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10070850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
3300000955|JGI1027J12803_100994580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
3300005332|Ga0066388_107121173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
3300005713|Ga0066905_100517422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 995 | Open in IMG/M |
3300005713|Ga0066905_100725061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
3300005713|Ga0066905_100839630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 799 | Open in IMG/M |
3300005713|Ga0066905_101858535 | Not Available | 556 | Open in IMG/M |
3300005764|Ga0066903_101264833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1375 | Open in IMG/M |
3300005764|Ga0066903_101919659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1135 | Open in IMG/M |
3300005764|Ga0066903_103296782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
3300005764|Ga0066903_104049376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
3300005764|Ga0066903_106140162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
3300005764|Ga0066903_106944357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
3300005764|Ga0066903_107822536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
3300006028|Ga0070717_10529304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
3300006175|Ga0070712_101646351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
3300006846|Ga0075430_101170977 | Not Available | 633 | Open in IMG/M |
3300009553|Ga0105249_12966896 | Not Available | 545 | Open in IMG/M |
3300010043|Ga0126380_10010486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4140 | Open in IMG/M |
3300010358|Ga0126370_11041623 | Not Available | 750 | Open in IMG/M |
3300010362|Ga0126377_10471442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1282 | Open in IMG/M |
3300010366|Ga0126379_12653284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
3300010366|Ga0126379_13825645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300010376|Ga0126381_100606064 | Not Available | 1558 | Open in IMG/M |
3300010376|Ga0126381_103144841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
3300010376|Ga0126381_103603907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
3300010376|Ga0126381_104410923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300010398|Ga0126383_10739939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1063 | Open in IMG/M |
3300012199|Ga0137383_10270387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1245 | Open in IMG/M |
3300012360|Ga0137375_10610874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 906 | Open in IMG/M |
3300012362|Ga0137361_10510672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1104 | Open in IMG/M |
3300012917|Ga0137395_10335107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1076 | Open in IMG/M |
3300012955|Ga0164298_10719575 | Not Available | 703 | Open in IMG/M |
3300012986|Ga0164304_10488111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 897 | Open in IMG/M |
3300014968|Ga0157379_11541456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
3300015201|Ga0173478_10436344 | Not Available | 638 | Open in IMG/M |
3300016319|Ga0182033_10393547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1169 | Open in IMG/M |
3300016319|Ga0182033_11232011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
3300016341|Ga0182035_10393537 | Not Available | 1163 | Open in IMG/M |
3300016341|Ga0182035_11945861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300016371|Ga0182034_10115902 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
3300016387|Ga0182040_11054988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
3300016387|Ga0182040_11331889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
3300016404|Ga0182037_10792124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 817 | Open in IMG/M |
3300016445|Ga0182038_10825931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 813 | Open in IMG/M |
3300021560|Ga0126371_10369746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1572 | Open in IMG/M |
3300025898|Ga0207692_10964406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
3300026118|Ga0207675_100525100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1180 | Open in IMG/M |
3300026320|Ga0209131_1272708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
3300027326|Ga0209731_1047486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
3300027646|Ga0209466_1126444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300027874|Ga0209465_10296989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
3300027909|Ga0209382_10535742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1284 | Open in IMG/M |
3300028379|Ga0268266_10258000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1615 | Open in IMG/M |
3300028828|Ga0307312_10440205 | Not Available | 858 | Open in IMG/M |
3300031544|Ga0318534_10421782 | Not Available | 765 | Open in IMG/M |
3300031561|Ga0318528_10099095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1528 | Open in IMG/M |
3300031572|Ga0318515_10508940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
3300031573|Ga0310915_10066334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2367 | Open in IMG/M |
3300031573|Ga0310915_10387220 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300031679|Ga0318561_10462523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
3300031723|Ga0318493_10706956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
3300031724|Ga0318500_10043714 | Not Available | 1870 | Open in IMG/M |
3300031744|Ga0306918_10256995 | Not Available | 1335 | Open in IMG/M |
3300031744|Ga0306918_10518472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 933 | Open in IMG/M |
3300031751|Ga0318494_10438886 | Not Available | 759 | Open in IMG/M |
3300031751|Ga0318494_10522426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
3300031763|Ga0318537_10082920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1182 | Open in IMG/M |
3300031765|Ga0318554_10575040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
3300031765|Ga0318554_10687632 | Not Available | 574 | Open in IMG/M |
3300031768|Ga0318509_10763466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
3300031771|Ga0318546_11042370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
3300031777|Ga0318543_10326718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
3300031778|Ga0318498_10495033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300031792|Ga0318529_10149484 | Not Available | 1074 | Open in IMG/M |
3300031793|Ga0318548_10207400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 962 | Open in IMG/M |
3300031793|Ga0318548_10349229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
3300031796|Ga0318576_10187922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 970 | Open in IMG/M |
3300031798|Ga0318523_10118081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1309 | Open in IMG/M |
3300031821|Ga0318567_10269043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 958 | Open in IMG/M |
3300031821|Ga0318567_10551102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300031821|Ga0318567_10628113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
3300031833|Ga0310917_10018515 | All Organisms → cellular organisms → Bacteria | 3967 | Open in IMG/M |
3300031879|Ga0306919_10237525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1367 | Open in IMG/M |
3300031890|Ga0306925_10198979 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
3300031890|Ga0306925_10432763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1407 | Open in IMG/M |
3300031890|Ga0306925_11547836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
3300031890|Ga0306925_11590253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
3300031897|Ga0318520_10274890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1010 | Open in IMG/M |
3300031910|Ga0306923_10512773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1355 | Open in IMG/M |
3300031910|Ga0306923_12306312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
3300031912|Ga0306921_12356810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
3300031941|Ga0310912_11082660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
3300031942|Ga0310916_11666502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300031945|Ga0310913_10125719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1754 | Open in IMG/M |
3300031946|Ga0310910_10119208 | Not Available | 1984 | Open in IMG/M |
3300031946|Ga0310910_10877464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
3300031946|Ga0310910_11523703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300031954|Ga0306926_10178322 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
3300031981|Ga0318531_10016112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 2910 | Open in IMG/M |
3300031981|Ga0318531_10157145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1019 | Open in IMG/M |
3300032001|Ga0306922_10147871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2510 | Open in IMG/M |
3300032001|Ga0306922_10430544 | Not Available | 1411 | Open in IMG/M |
3300032001|Ga0306922_11023810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
3300032008|Ga0318562_10544850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
3300032025|Ga0318507_10383251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
3300032035|Ga0310911_10431857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
3300032035|Ga0310911_10788059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
3300032035|Ga0310911_10848498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
3300032035|Ga0310911_10903484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
3300032039|Ga0318559_10379746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
3300032041|Ga0318549_10255111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 789 | Open in IMG/M |
3300032044|Ga0318558_10583558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
3300032051|Ga0318532_10274591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
3300032055|Ga0318575_10388812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
3300032059|Ga0318533_10104349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1965 | Open in IMG/M |
3300032060|Ga0318505_10163280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1035 | Open in IMG/M |
3300032063|Ga0318504_10451507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
3300032063|Ga0318504_10618507 | Not Available | 521 | Open in IMG/M |
3300032065|Ga0318513_10583491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 547 | Open in IMG/M |
3300032066|Ga0318514_10116588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
3300032076|Ga0306924_12489186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
3300032091|Ga0318577_10638340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300032094|Ga0318540_10528078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
3300032261|Ga0306920_100039734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6792 | Open in IMG/M |
3300033289|Ga0310914_11818417 | Not Available | 513 | Open in IMG/M |
3300033289|Ga0310914_11838266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 43.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.16% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.10% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.10% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A01DRAFT_10246591 | 3300000580 | Forest Soil | MTGLTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLA |
AF_2010_repII_A001DRAFT_100708503 | 3300000793 | Forest Soil | MTALTTMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLA |
JGI1027J12803_1009945803 | 3300000955 | Soil | MDKLLFWLGLGAAQKAAGSKPIERWNWVVSLVVGALVAAVM |
Ga0066388_1071211732 | 3300005332 | Tropical Forest Soil | MTALTAMDKLLFWLGLGAAQKGARSKEVKPSRHWVVSLVAGILLAL |
Ga0066905_1005174222 | 3300005713 | Tropical Forest Soil | MTALTGMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSLVVGIH* |
Ga0066905_1007250612 | 3300005713 | Tropical Forest Soil | MDKLLFWLGLGAAQKGAGSKPTVDWHFAVSFVVGILIAVL* |
Ga0066905_1008396302 | 3300005713 | Tropical Forest Soil | MMALTGMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSFVVGI* |
Ga0066905_1018585352 | 3300005713 | Tropical Forest Soil | MDKLLFWLGIGAAQKGARSKELKLSRHPVTSFFVGVLIALLIA |
Ga0066903_1012648333 | 3300005764 | Tropical Forest Soil | MDKLLFWLGIGAAQKGAGSEEVERSRHPGISFVVGVLIAC* |
Ga0066903_1019196591 | 3300005764 | Tropical Forest Soil | MTALTAMDKLLFWLGIGAAQKGAGSEEVKRSRHPVISF |
Ga0066903_1032967822 | 3300005764 | Tropical Forest Soil | MDKLLFWLGLGAAQKGAGSKEIKPTRHPVIAFVVGIL |
Ga0066903_1040493761 | 3300005764 | Tropical Forest Soil | MGRLLFWLGLGAAQKGAGSKPTKDRHPVVSVLVGILIAVLI |
Ga0066903_1061401622 | 3300005764 | Tropical Forest Soil | MMALSAMDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGIL |
Ga0066903_1069443572 | 3300005764 | Tropical Forest Soil | MALSAMDKLLFWLGIGAAQKGARSNEVKPSLHPVVSFVVGILLA |
Ga0066903_1078225361 | 3300005764 | Tropical Forest Soil | MTALTGVDKLLFWLGIGVAQKGAGSKEVKPSRHWV |
Ga0070717_105293041 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKLLFWLGLGAAQKGAGSKPTVDRHWVVSLVVGILIAVL |
Ga0070712_1016463511 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTALTAMDKLLFWLGLGAAQKGARSKEVKPSRHWV |
Ga0075430_1011709773 | 3300006846 | Populus Rhizosphere | MTALTTMDKLLCWLGLGAAQKGAGSKEVNPSRHWV |
Ga0105249_129668961 | 3300009553 | Switchgrass Rhizosphere | MGNLPFWLGIGAAQKSAGSKQLKPSRHPILAFIVG |
Ga0126380_100104861 | 3300010043 | Tropical Forest Soil | PAPMMALTGMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSFVVGI* |
Ga0126370_110416231 | 3300010358 | Tropical Forest Soil | MMALTAMDKLLFWLGIGAAQKGARSKEVKPSRHPVTSFVVGNPVDSCR |
Ga0126377_104714423 | 3300010362 | Tropical Forest Soil | MALTGMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSFVVGI* |
Ga0126379_126532842 | 3300010366 | Tropical Forest Soil | MTALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLALLI |
Ga0126379_138256452 | 3300010366 | Tropical Forest Soil | MDKLLFWLGLGAAQKGAGSKPTVDRHPVISLVVGILIA |
Ga0126381_1006060641 | 3300010376 | Tropical Forest Soil | MMALSAMDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGI |
Ga0126381_1031448411 | 3300010376 | Tropical Forest Soil | MTALTAMNKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLALL |
Ga0126381_1036039072 | 3300010376 | Tropical Forest Soil | MMALTAMDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGILL |
Ga0126381_1044109231 | 3300010376 | Tropical Forest Soil | MTALTAMDKLLFWLGLGAAQKVAGSNKRTDSRHWVIS |
Ga0126383_107399392 | 3300010398 | Tropical Forest Soil | MTALTTMDKLLFWLGIGAAQKGAGSNKRTDSRHWVI |
Ga0137383_102703871 | 3300012199 | Vadose Zone Soil | MDKLLFWLGIGAAQKSAGSKPTDNRHPVTSFVVGILLAP |
Ga0137375_106108741 | 3300012360 | Vadose Zone Soil | MDNLLFWLGIGAAQKGAGSKPIKRRHWVASLVVGILIAVLIAA |
Ga0137361_105106724 | 3300012362 | Vadose Zone Soil | MGNLLFWLGIGAAQKGARSKEVKPSRHPVTSFVVGVLIA |
Ga0137395_103351071 | 3300012917 | Vadose Zone Soil | MGNLLFWLGIGAAQKGARSKPTDSRHWIGSFIVGIL |
Ga0164298_107195751 | 3300012955 | Soil | MGNLLFWLGIGAAQKGAGSTGLKPSRHPVISFVFGLVVAL |
Ga0164304_104881113 | 3300012986 | Soil | MGNLLFWLGLGAAQKGARSKEVKARRHWVISLLAGILVALL |
Ga0157379_115414563 | 3300014968 | Switchgrass Rhizosphere | MTALTAMDKLLFWLGLGAAQKGARSNEVKPGRHWVVSLVAGILIALLI |
Ga0173478_104363441 | 3300015201 | Soil | MGNLPFWLGIGAAQKSAGSKELKPSRHPIIAFVVGTLIALAI |
Ga0182033_103935474 | 3300016319 | Soil | MTDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVA |
Ga0182033_112320111 | 3300016319 | Soil | MTALTAMDKLLFWLGLGAAQKGARSKEVKPSRHWVVSL |
Ga0182035_103935371 | 3300016341 | Soil | MTALTAMDKLLSWLGLGAAQKGAGSKPTKDRHPVVSVVVG |
Ga0182035_119458611 | 3300016341 | Soil | MTALTAMDKLLFWLGLGAAQKGAGSKPTKDRHPVVSVVVGILIAL |
Ga0182034_101159024 | 3300016371 | Soil | MMALTAMDKLLFWLGIGAAQKGAGSKAVKPSRHPVT |
Ga0182040_110549881 | 3300016387 | Soil | MTDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGIL |
Ga0182040_113318891 | 3300016387 | Soil | MDKLLFWLGIGAAQKGARSKESKPSRHPVVSFVVGI |
Ga0182037_107921243 | 3300016404 | Soil | MDKLLFWLGLGAVQKGAGSNKRTDSRHWVISLVAG |
Ga0182038_108259312 | 3300016445 | Soil | MTALTAMDKLLFWLGLGAAQKVAGSNKRTDSRHWVISLVAGILLALLIAA |
Ga0126371_103697461 | 3300021560 | Tropical Forest Soil | MTALTAMNKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLA |
Ga0207692_109644062 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTALTAMNKLLFWLGLGAAQKGARSKEVKPSRHWVIALV |
Ga0207675_1005251001 | 3300026118 | Switchgrass Rhizosphere | MGKLLFWLGIGAAQKSAGSKPPVQRNWVVSLVVGALVAAVMI |
Ga0209131_12727082 | 3300026320 | Grasslands Soil | MGNLLFWLGIGAAQKGARSKPTDSRHWIGSFIVGILFPLLIAA |
Ga0209731_10474861 | 3300027326 | Forest Soil | MDKLLFWLGIGAAQKGAGSKEVKPSRHWVVSLVVGILIAVLIGV |
Ga0209466_11264441 | 3300027646 | Tropical Forest Soil | MTALTAMNKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLAL |
Ga0209465_102969891 | 3300027874 | Tropical Forest Soil | MDKLLFWLGIGAAQKGAGSKEVKPSRHPVTSFVVGT |
Ga0209382_105357424 | 3300027909 | Populus Rhizosphere | VALTAMDKLLFWLGIGAAQEGAGSKPTDSRHPVISFLVGVLIAL |
Ga0268266_102580001 | 3300028379 | Switchgrass Rhizosphere | MGNLPFWLGIGAAQKSAGSKQLKPSRHPILAFIVGTLI |
Ga0307312_104402052 | 3300028828 | Soil | MSNLPFWLGIGAAQKGAGSKGLKPSRHPLIAFVVGIL |
Ga0318534_104217822 | 3300031544 | Soil | MDKLLFWLGIGAAQKGARSKEAKPSRHPVVSFVAGTL |
Ga0318528_100990951 | 3300031561 | Soil | MTALTAMDKLLFWLGIGAAQKGAGSKPAVDRHPVISFVAGIL |
Ga0318515_105089402 | 3300031572 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGIL |
Ga0310915_100663346 | 3300031573 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLAL |
Ga0310915_103872201 | 3300031573 | Soil | MMGNLLFWLGIGAAQKSARSKPTDNRHWVSSFVVGILFPL |
Ga0318561_104625231 | 3300031679 | Soil | MTDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAG |
Ga0318493_107069562 | 3300031723 | Soil | MDKLLFWLGIGAAQEGARSKEVKPNRHPVISLVIGILIAVLITFG |
Ga0318500_100437143 | 3300031724 | Soil | MMGNLFFWLGIGAAQKGAGSKEVKPSRHPVISLVAGILLALLIA |
Ga0306918_102569953 | 3300031744 | Soil | MTALTAMDKLLSWLGLGAAQKGAGSKPTKDRHPVVSVVVGVLIAVLIAA |
Ga0306918_105184721 | 3300031744 | Soil | MTALSAMDKLLFWLGIGAAQKGARSKEVKPSRHWVISFVAGILLALV |
Ga0318494_104388863 | 3300031751 | Soil | MDKLLFWLGLGAAQKGAASKEVKPSRHPVTSFVVGILLA |
Ga0318494_105224261 | 3300031751 | Soil | MDKLLFWLGMGAAQKGAGPNKRTDSRHWVISLVAGILLALLIAAG |
Ga0318537_100829201 | 3300031763 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAEILLAL |
Ga0318554_105750402 | 3300031765 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWV |
Ga0318554_106876322 | 3300031765 | Soil | MDKLLFWLGIGAAQKGARSKEAKPSRHPVVSFVAGTLLA |
Ga0318509_107634661 | 3300031768 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISL |
Ga0318546_110423701 | 3300031771 | Soil | MTALTAMDKLLFWLGLGAAQKGAGSKEVKPSRHPVISFVVGILLALLI |
Ga0318543_103267183 | 3300031777 | Soil | MTALVAMDKLLFWLGLGAAQKGAGSKEVNASRHWVVSLVVGILI |
Ga0318498_104950331 | 3300031778 | Soil | MALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISL |
Ga0318529_101494844 | 3300031792 | Soil | MDKLLFWLGLGAAQKGAASKEVKPSRHPVTSFVVGILLALLI |
Ga0318548_102074001 | 3300031793 | Soil | MDKLLFWLGMGAAQKGAGPNKRTDSRHWVISLVAGILLAL |
Ga0318548_103492293 | 3300031793 | Soil | MTALTAMDKLLFWLGLGAAQKGAGSKEVKPSRHPVISF |
Ga0318576_101879221 | 3300031796 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGI |
Ga0318523_101180813 | 3300031798 | Soil | MMALTAMDKLLFWLGLGAAQKGAGANKRTDSRHWVISLVAGILL |
Ga0318567_102690431 | 3300031821 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILLA |
Ga0318567_105511022 | 3300031821 | Soil | MDKLLFWLGIGAAQEGARSKEVKPNRHPVISLVLGILIAV |
Ga0318567_106281133 | 3300031821 | Soil | MTALTAMDKLLFWVGLGAAQKGAGSKPSASRHPFISFVVGILIA |
Ga0310917_100185151 | 3300031833 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWL |
Ga0306919_102375253 | 3300031879 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVIS |
Ga0306925_101989791 | 3300031890 | Soil | MTALTAMDKLLFWLGLGAAQKGAGSKPTKDRHPVVSVV |
Ga0306925_104327634 | 3300031890 | Soil | MTALTAMDKLLFWLGLGAAQKGAGSKEVQPSRHWVVSVVAGI |
Ga0306925_115478362 | 3300031890 | Soil | MTALTAMDKLLSWLGLGAAQKGAGSKPTKDRHPVVSV |
Ga0306925_115902531 | 3300031890 | Soil | MTALTAMDKLLFWLGLGAAQKGAGSKEVKPSRHWVVSLVVGIL |
Ga0318520_102748903 | 3300031897 | Soil | MTALTAMDKLLFWLGLGAAQKVAGSNKRTDSRHWVISLV |
Ga0306923_105127733 | 3300031910 | Soil | MDKLLFWLGLGAAQKGAGSKPTVDRHWVISLVAGILLA |
Ga0306923_123063121 | 3300031910 | Soil | MTAAHCMGNLLFWLGIGAAQKGARPKEVKPSRHWVVSFVVGTLLA |
Ga0306921_123568102 | 3300031912 | Soil | MRALTAMDKLLFWLGIGAAQEGAKSNERTDSRHWVISLVA |
Ga0310912_110826602 | 3300031941 | Soil | MDKLLFWLGIGAAQKGSGSKPSASRHPVLSFVVGILLAL |
Ga0310916_116665021 | 3300031942 | Soil | MTALTAMDKLLSWLGLGAAQKGAGSKPTKDRHPVVSVVVGV |
Ga0310913_101257193 | 3300031945 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVA |
Ga0310910_101192081 | 3300031946 | Soil | DKLLFWLGIGAAQKGAGSEPTKRRHPVVSLVVGVLMAALVAV |
Ga0310910_108774642 | 3300031946 | Soil | MDKLLFWLGLGAAQKGAGSKPTKRGNWVVSLVVGTLIAALI |
Ga0310910_115237032 | 3300031946 | Soil | MTALTAMDKLLFWLGLGAAQKVAGSNKRTDSRHWVISLVA |
Ga0306926_101783221 | 3300031954 | Soil | MGNLLFWLGIGAAQKGARSKEVKPRRHPVISFVVGILLA |
Ga0306926_122623062 | 3300031954 | Soil | MTALTAMDKLLFWLGLGAAQKGAGSKPTNDRHPVVSVEFDLLR |
Ga0318531_100161122 | 3300031981 | Soil | MTALIAMDKLLFWFGIGAAQKSAGSKEIKPSRHWVVSLVVGILIAG |
Ga0318531_101571451 | 3300031981 | Soil | MTALTAMDKLLFWLGIGAAQKGAGSKPAVDRHPVISFVAGILLAVLI |
Ga0306922_101478716 | 3300032001 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAG |
Ga0306922_104305443 | 3300032001 | Soil | MDKLLFWLGIGAAQKGARSKESKPSRHPVVSFVVGIVLALLIAA |
Ga0306922_110238103 | 3300032001 | Soil | MDKLLFWLGIGAAQKGAGSEPTKRRHPVVSLVVGILIAVLIA |
Ga0318562_105448501 | 3300032008 | Soil | MTALTAMDKLLFWLGIGAAQKGARSKDVKPSRHWVISLVAG |
Ga0318507_103832511 | 3300032025 | Soil | MDKLLFWLGIGAAQEGARSKEVKPNRHPVISLVIGILI |
Ga0310911_104318571 | 3300032035 | Soil | MMALTAMDKLLFWLGIGAAQKGAGSKEVKPSRHPVTSFVVGTLLAL |
Ga0310911_107880592 | 3300032035 | Soil | MGNLLFWLGIGAAQEGARSKEIKASRHWVMSFVAGILLALVI |
Ga0310911_108484981 | 3300032035 | Soil | MDKLLFWLGIGAAQKAAGSNKRTDGRHRVISLVAGILLALL |
Ga0310911_109034842 | 3300032035 | Soil | MRALTAMDKLLFWLGIGAAQEGAKSNERTDSRHWVISL |
Ga0318559_103797461 | 3300032039 | Soil | MTALTTMDKLLFWLGIGAAQKGAGSNNRTDSRRWVISLVAGIL |
Ga0318549_102551113 | 3300032041 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAEILLALLI |
Ga0318558_105835581 | 3300032044 | Soil | MMALSAMDKLLFWLGIGVAQKRAGSNKRTDSRHWVISLVAGILL |
Ga0318532_102745912 | 3300032051 | Soil | MTALTAMDKLLFWLGLGAAQRGAGSNKRTDSRHWVISLVAGILLAL |
Ga0318575_103888122 | 3300032055 | Soil | MDKLLFWLGIGAAQKGAGSNKRTDSRHWVISLVAGIL |
Ga0318533_101043491 | 3300032059 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRQWVISLV |
Ga0318505_101632803 | 3300032060 | Soil | MRALTAMDKLLFWLGIGAAQEGAKSNERTDSRHWVISLVAGILLALLI |
Ga0318504_104515071 | 3300032063 | Soil | MDKLLFWLGIGAAQEGARSKEVKPNRHPVISLVIGILIA |
Ga0318504_106185072 | 3300032063 | Soil | MMGNLFFWLGIGAAQKGAGSKEVKPSRHPVISLVA |
Ga0318513_105834911 | 3300032065 | Soil | MTALTAMDKLLFWLGIGAAQKSAGSKPAVDRHPVISFVAGIL |
Ga0318514_101165882 | 3300032066 | Soil | MDKLLFWLGLGAAQKGAASKEVKPSRHPVTSFVVGILL |
Ga0306924_124891861 | 3300032076 | Soil | MDKLLFWLGIGAAQKAAGSNKRTDGRHRVISLVAGILLALLI |
Ga0318577_106383401 | 3300032091 | Soil | MMALTAMDKLLFWLGLGAAQKGAGSNKRTDSRHWVISLVAGILL |
Ga0318540_105280781 | 3300032094 | Soil | MDKLLFWLGIGAAQKGAGPKPTKRQNWVVSLIVGTLVVAVII |
Ga0306920_1000397341 | 3300032261 | Soil | MDKLLFWLGIGATQKGAGSEEVKRSRHPVISFVVGILLAVL |
Ga0310914_118184171 | 3300033289 | Soil | MMALTAMDKLLFWLGIGAAQKGAGSKEVKPSRHPVTSF |
Ga0310914_118382661 | 3300033289 | Soil | MMALTAMDKLHFWLGIGAAQKGAGSEEVKPSRHWVVSFVV |
⦗Top⦘ |