NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063888

Metagenome / Metatranscriptome Family F063888

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063888
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 42 residues
Representative Sequence VQNGRQIDLSAQVERVKRRTRPWKSIIALLLAIAAAVIS
Number of Associated Samples 123
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.35 %
% of genes near scaffold ends (potentially truncated) 97.67 %
% of genes from short scaffolds (< 2000 bps) 89.92 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (54.264 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.457 % of family members)
Environment Ontology (ENVO) Unclassified
(20.930 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.713 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.76%    β-sheet: 0.00%    Coil/Unstructured: 52.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF01184Gpr1_Fun34_YaaH 89.92
PF08044DUF1707 7.75
PF00156Pribosyltran 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG1584Succinate-acetate transporter SatPEnergy production and conversion [C] 89.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms54.26 %
UnclassifiedrootN/A45.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_158540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. BRA 177681Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101281026Not Available891Open in IMG/M
3300003219|JGI26341J46601_10093906All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300003368|JGI26340J50214_10173903Not Available535Open in IMG/M
3300004092|Ga0062389_101914368All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300004470|Ga0068967_1052880All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300004618|Ga0068963_1444674Not Available775Open in IMG/M
3300005435|Ga0070714_100352082Not Available1383Open in IMG/M
3300005437|Ga0070710_10923223All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005538|Ga0070731_10358190All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300005591|Ga0070761_11104458Not Available505Open in IMG/M
3300005602|Ga0070762_10125906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1510Open in IMG/M
3300005602|Ga0070762_11109981Not Available545Open in IMG/M
3300005764|Ga0066903_100430400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2191Open in IMG/M
3300006028|Ga0070717_11291680All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300006050|Ga0075028_100617837All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300006176|Ga0070765_100073558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2876Open in IMG/M
3300006804|Ga0079221_10715492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales700Open in IMG/M
3300006806|Ga0079220_10362890All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300006904|Ga0075424_101608912All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300009036|Ga0105244_10229612All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300009090|Ga0099827_10447292Not Available1107Open in IMG/M
3300009137|Ga0066709_102216479All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300009162|Ga0075423_10599048All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300009520|Ga0116214_1008381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3678Open in IMG/M
3300009521|Ga0116222_1015154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3559Open in IMG/M
3300009698|Ga0116216_10790280All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300009700|Ga0116217_10174512Not Available1424Open in IMG/M
3300009700|Ga0116217_10314228Not Available1005Open in IMG/M
3300009792|Ga0126374_11589491All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300009839|Ga0116223_10449073All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300010376|Ga0126381_100773983All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300010379|Ga0136449_101839573Not Available903Open in IMG/M
3300010858|Ga0126345_1192026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2787Open in IMG/M
3300010867|Ga0126347_1275129Not Available532Open in IMG/M
3300010876|Ga0126361_10073230Not Available1128Open in IMG/M
3300012096|Ga0137389_11666738All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300012199|Ga0137383_10132367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1821Open in IMG/M
3300012361|Ga0137360_11284081Not Available632Open in IMG/M
3300012985|Ga0164308_11007559All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300013100|Ga0157373_11446838Not Available523Open in IMG/M
3300013307|Ga0157372_12721487All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300014655|Ga0181516_10298008Not Available820Open in IMG/M
3300016270|Ga0182036_11314599Not Available603Open in IMG/M
3300017926|Ga0187807_1011523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2719Open in IMG/M
3300017928|Ga0187806_1248283Not Available615Open in IMG/M
3300017942|Ga0187808_10405744Not Available623Open in IMG/M
3300017970|Ga0187783_11267116All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300017993|Ga0187823_10135993Not Available765Open in IMG/M
3300017994|Ga0187822_10070406All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300018058|Ga0187766_10515870Not Available806Open in IMG/M
3300018085|Ga0187772_10435871Not Available917Open in IMG/M
3300018085|Ga0187772_10709718Not Available721Open in IMG/M
3300018086|Ga0187769_10319950All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300018482|Ga0066669_12453282Not Available501Open in IMG/M
3300020579|Ga0210407_10938556All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300021178|Ga0210408_10128108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2004Open in IMG/M
3300021180|Ga0210396_11669588Not Available518Open in IMG/M
3300021405|Ga0210387_10290720All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300021407|Ga0210383_11453575Not Available568Open in IMG/M
3300021420|Ga0210394_11550829Not Available559Open in IMG/M
3300021474|Ga0210390_10809513All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300021474|Ga0210390_11012352Not Available678Open in IMG/M
3300021475|Ga0210392_10576017All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300021477|Ga0210398_10191293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1667Open in IMG/M
3300021478|Ga0210402_10307752All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300021559|Ga0210409_11456400All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300022525|Ga0242656_1060012All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300022716|Ga0242673_1010785Not Available1148Open in IMG/M
3300025904|Ga0207647_10125722All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300025906|Ga0207699_10964107All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300025915|Ga0207693_10075082All Organisms → cellular organisms → Bacteria2647Open in IMG/M
3300025915|Ga0207693_10282354All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300025925|Ga0207650_10250547All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300025929|Ga0207664_10147486Not Available1996Open in IMG/M
3300026552|Ga0209577_10298145All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300026995|Ga0208761_1031249Not Available538Open in IMG/M
3300027058|Ga0209111_1044991Not Available567Open in IMG/M
3300027107|Ga0208367_101510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1549Open in IMG/M
3300027307|Ga0209327_1073699Not Available504Open in IMG/M
3300027497|Ga0208199_1095000Not Available618Open in IMG/M
3300027570|Ga0208043_1139813Not Available636Open in IMG/M
3300027604|Ga0208324_1000699Not Available14249Open in IMG/M
3300027787|Ga0209074_10564728Not Available503Open in IMG/M
3300027855|Ga0209693_10350168All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300027875|Ga0209283_10288980All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300027882|Ga0209590_10008625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4642Open in IMG/M
3300027903|Ga0209488_10201046All Organisms → cellular organisms → Bacteria1501Open in IMG/M
3300028828|Ga0307312_10006743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales6219Open in IMG/M
3300028875|Ga0307289_10263103Not Available710Open in IMG/M
3300029943|Ga0311340_10220394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae1886Open in IMG/M
3300029951|Ga0311371_10704340Not Available1268Open in IMG/M
3300030494|Ga0310037_10022203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3063Open in IMG/M
3300030503|Ga0311370_10806339Not Available1080Open in IMG/M
3300030528|Ga0210277_10460774Not Available1182Open in IMG/M
3300030580|Ga0311355_10116543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2936Open in IMG/M
3300030618|Ga0311354_10312676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1619Open in IMG/M
3300030624|Ga0210251_10679484Not Available1096Open in IMG/M
3300030677|Ga0302317_10140149Not Available1135Open in IMG/M
3300030707|Ga0310038_10114411Not Available1388Open in IMG/M
3300030738|Ga0265462_11541158Not Available621Open in IMG/M
3300031128|Ga0170823_17340743All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031544|Ga0318534_10819689Not Available522Open in IMG/M
3300031679|Ga0318561_10663625Not Available574Open in IMG/M
3300031682|Ga0318560_10303303All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300031769|Ga0318526_10121585All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300031770|Ga0318521_10644980All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300031781|Ga0318547_10656984Not Available651Open in IMG/M
3300031781|Ga0318547_11085916All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031797|Ga0318550_10530899Not Available567Open in IMG/M
3300031798|Ga0318523_10157354Not Available1131Open in IMG/M
3300031819|Ga0318568_10248338Not Available1102Open in IMG/M
3300031831|Ga0318564_10548783Not Available500Open in IMG/M
3300031893|Ga0318536_10146354All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300031897|Ga0318520_10566251All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300031912|Ga0306921_10959286Not Available967Open in IMG/M
3300031959|Ga0318530_10372185All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300032001|Ga0306922_11897702Not Available583Open in IMG/M
3300032010|Ga0318569_10394522All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300032035|Ga0310911_10283573All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300032041|Ga0318549_10114244Not Available1186Open in IMG/M
3300032044|Ga0318558_10161523All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300032064|Ga0318510_10055531Not Available1414Open in IMG/M
3300032065|Ga0318513_10630030Not Available525Open in IMG/M
3300032090|Ga0318518_10617417Not Available553Open in IMG/M
3300032205|Ga0307472_100643067All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300032770|Ga0335085_10753182All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300032783|Ga0335079_10568141Not Available1200Open in IMG/M
3300033158|Ga0335077_12218162Not Available504Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.46%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil10.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.43%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.33%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.55%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004470Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004618Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022525Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027058Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027107Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF029 (SPAdes)EnvironmentalOpen in IMG/M
3300027307Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_026254302199352025SoilVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIAAAVISHQARNGNFTASNM
INPhiseqgaiiFebDRAFT_10128102613300000364SoilVQNGRQIDLSAQVERVKRRTRPWKSIIALLLAIAAAVIS
JGI26341J46601_1009390613300003219Bog Forest SoilVHDVKQIDLSAQVERVKRKTRPWKSIIALVLAIAAAVISHRASHG
JGI26340J50214_1017390313300003368Bog Forest SoilVHDVKQIDLSAQVERVKRKTRPWKSIIALVLAIAAAVISHRASHGRSNSHG
Ga0062389_10191436813300004092Bog Forest SoilVHNGKQVDLSAQVERVKRKTRPWKSIIALLLAIAAAVISHR
Ga0068967_105288013300004470Peatlands SoilMDIRQIDLSTQVERVKRKTRPWKSIIALLLAIVAAVISHRASHG
Ga0068963_144467423300004618Peatlands SoilVHDVKQIDLSAQVERVKRKTRPWKSIIALALAIAAAVISHRASHGRSTFVH
Ga0070714_10035208213300005435Agricultural SoilVQNGRQIDLPTQVERVRRKTRPWKSIIALLLAIAAAVISRQAR
Ga0070710_1092322313300005437Corn, Switchgrass And Miscanthus RhizosphereVQNGRQIDLSTQVERVKRGTRPWKSIIALLLAIASAVISHQAHRG
Ga0070731_1035819013300005538Surface SoilVQERQIDLSAKVAQVKRRTRPWKSIIVLLVAIAAAVISHQARDQARGD
Ga0070761_1110445813300005591SoilVQDGQIDLSAKVAQVKRKARPWKSIIALVLAIAAAVISRRA
Ga0070762_1012590633300005602SoilMHEVRQLDLAEQVELVKRKTRPWKSIIALLLAIAAAVIS
Ga0070762_1110998123300005602SoilVQSWDDIDLQGKVQTVRRKTRPWKAIIALLFAIAAAV
Ga0066903_10043040013300005764Tropical Forest SoilVQNGRQIDLPTQVRRVRRRTRPWKSIIALLLAIAAAVI
Ga0070717_1129168023300006028Corn, Switchgrass And Miscanthus RhizosphereVQNGRQIDLSAQVERVKRRTRPWKAIIALLFAIAA
Ga0075028_10061783723300006050WatershedsVQNGRQVDLPKQVERVRRRTRPWKSIIALLLAIAAAVISH
Ga0070765_10007355853300006176SoilVHHPQNGIDLSAQVALVKRKTRPWKAIIALVLAIAAAVVSHESR
Ga0079221_1071549223300006804Agricultural SoilMSTVQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIASAVISH*
Ga0079220_1036289023300006806Agricultural SoilVQNGRQIDLSTQVERVKHKTRPWKSIISLLLAIAAAV
Ga0075424_10160891213300006904Populus RhizosphereVQNGRQIDLSAQVERVKHRARPWKAIIALLFAIAAGVLSHQA
Ga0105244_1022961213300009036Miscanthus RhizosphereVQNGRQIDLSTQVERVKHKTRPWKSIIFLLLAIASAVL
Ga0099827_1044729213300009090Vadose Zone SoilVQNGRQIDLSAQVERVKRRTRPWKSIIALLLAIAAAVI
Ga0066709_10221647913300009137Grasslands SoilMSTVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAITAAVISHQARRGTF
Ga0075423_1059904813300009162Populus RhizosphereVQNGRQIDLSTQVERVKHKTRPWKSIISLLLAIAAAVLSRQARNNS
Ga0116214_100838143300009520Peatlands SoilVQERQSDLSAQVARVKRKTRPWASIIALVLAIAAA
Ga0116222_101515413300009521Peatlands SoilVQERQIDVSAQVARVKRKTRPWASIIALVLAIAAAVISHR
Ga0116216_1079028023300009698Peatlands SoilVQEIHADLSAQVRRVRRKTRPWKSIIALVLAIAAAVIS
Ga0116217_1017451213300009700Peatlands SoilVQERQIDVSAQVARVKRKTRPWKSIIALVLAIAAAVISHRASH
Ga0116217_1031422823300009700Peatlands SoilVHDAKQIDLSAQVERVKRKTRPWKSIIALLLAIAAAVISHRAS
Ga0126374_1158949113300009792Tropical Forest SoilMRRSAVQNGRQIDLSTHVERVKRKTRPWKSIIALAL
Ga0116223_1044907323300009839Peatlands SoilVHDAKQIDLSAQVERVKRQTRPWKSIIALLLAIAAAVISHRAAHGRSNF
Ga0126381_10077398333300010376Tropical Forest SoilMARKEELRVQERQNHLSTQVARVRRRTRPWKSIIALVLAIASAVIS
Ga0136449_10183957323300010379Peatlands SoilVQERQVDLSARVAQVKRRARPWKSIIALVLAIASAIISHLAS
Ga0126345_119202643300010858Boreal Forest SoilVQERQIDLSAKVAQVKRRTRPWKSIIALLLAIAAAVISDQARHDPH
Ga0126347_127512923300010867Boreal Forest SoilVHDGKQLDLSAQVELVKRKTRPWKSIIALVLAIAVAVVSYEAHRHSSIFPVNHT
Ga0126361_1007323023300010876Boreal Forest SoilVHDGKPIDLSAQVELVKRKTRPWKSIIALVLAITA
Ga0137389_1166673823300012096Vadose Zone SoilVHDVKQIDLSAQVERVKRRTRPWKSIIALLLAIAA
Ga0137383_1013236733300012199Vadose Zone SoilMSTVQNGRQVDLSTQVERVKRKTRPWKSIIALLLAIAAAVISHQAR
Ga0137360_1128408113300012361Vadose Zone SoilVHDLKQIDLSAQVERVKRKTRPWKSIIALLLAIAAAVI
Ga0164308_1100755913300012985SoilVQNGRQIDLPTQVERVRRKTRPWKSIIALLLAIAAAV
Ga0157373_1144683823300013100Corn RhizosphereVQNGRQIDLSAQVERVKRKTRPWKAIIALLFAIAAGVLSRQ
Ga0157372_1272148723300013307Corn RhizosphereVQNGRQIDLSTQVERVKHKTRPWKSIIFLLLAIASAVLSRQ
Ga0181516_1029800823300014655BogVHHPPNGIDLSAQVALVKRKTRPWKAIIALVLAIAAAVVSHESRFD
Ga0182036_1131459913300016270SoilVQNGRQVDLPARVERVRRKTRPWKSIIALLLAIAAAVISRQARHGAFTTSD
Ga0187807_101152343300017926Freshwater SedimentVQERQTDLSAQVARVKRKTRPWKSIIALVLAVAAAI
Ga0187806_124828313300017928Freshwater SedimentVQERQTDLSAQVARVKRKTRPWKSIIALVLAVAAAIISHRASHGS
Ga0187808_1040574423300017942Freshwater SedimentVQERQIDLSARVERVKRRTRPWKSIIALVLAIASAVISGAA
Ga0187783_1126711613300017970Tropical PeatlandVQSRNGIHDELSAHVERVKRKTRPWKSIIALVLAIAA
Ga0187823_1013599313300017993Freshwater SedimentVQERQTDLSAQVARVKRKTRPWMSIIALVLAVAAAVIS
Ga0187822_1007040623300017994Freshwater SedimentVQERQAELSARVAQVKRKTRPWKSIIALVLAIACAVISNAA
Ga0187766_1051587023300018058Tropical PeatlandVHERQIDLSTQVERVKRRTRPWKSIIALVLAIVSAVICNA
Ga0187772_1043587113300018085Tropical PeatlandVQDRQNELSVRVERVKRKTRPWKSIIALLLAIAAAVI
Ga0187772_1070971813300018085Tropical PeatlandVRERQIDLSAKVATVKRKARPWKSIIALILAIAAAII
Ga0187769_1031995013300018086Tropical PeatlandVQNGRQIDLSAQVQRVKRRTRPWKSIIALLLAIAAAVISRRASHGKSNFAGT
Ga0066669_1245328223300018482Grasslands SoilVQNGRQIDLSGQVERVKRRTRPWKAIIALLFAIAAGVLS
Ga0210407_1093855613300020579SoilVQNGRQVDLPKQVERVRRRTRPWKSIIALLLAIAAAVI
Ga0210408_1012810833300021178SoilVQERQIDLSAQVARVKRKTRPWKSIIALLLAIAAAV
Ga0210396_1166958823300021180SoilVHDGKQIGLTAEVALVKRKTRPWKSMIALVLAIAAGVLCD
Ga0210387_1029072023300021405SoilVQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIAAA
Ga0210383_1145357513300021407SoilVHNGKQVDLSAQVERVKRKTRPWKSIIALLLAIAAAVISHRAR
Ga0210394_1155082913300021420SoilMSTVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAI
Ga0210390_1080951323300021474SoilVHDVKQIDLSAQVERVKRKTRPWKSIIALLLAIAAAVISYRAS
Ga0210390_1101235223300021474SoilVQERQIDLSAQVARVKRKTRPWKSIIALLLAIAVAVISRIAHHASD
Ga0210392_1057601723300021475SoilVQNGRQVDLPKQVERVRRRTRPWKSIIALLLAIAAAVIS
Ga0210398_1019129333300021477SoilVHDAKQIDLSAQVERVKRKTRPWKSIIALLLAIVSAF
Ga0210402_1030775213300021478SoilVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIAAA
Ga0210409_1145640013300021559SoilVQERQIDLSAQVARVKRKTRPWKSIIALLLAIAAAVI
Ga0242656_106001223300022525SoilMQVHGGPQIDLSARVALVRRKTRPWKSIIALVLAI
Ga0242673_101078513300022716SoilVHDVKQIDLSARVERVKRKTRPWKSIIALLLAIVSALISHRARRDEPTFFTVNH
Ga0207647_1012572223300025904Corn RhizosphereVQNGRQIDLSTQVERVKHKTKPWKSIISLLLAIAAAVLS
Ga0207699_1096410713300025906Corn, Switchgrass And Miscanthus RhizosphereMSTVQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIAAAVIS
Ga0207693_1007508233300025915Corn, Switchgrass And Miscanthus RhizosphereVQNGRQIDLSAQVERVKRRTRPWKAIIALLFAIAAGVLSRQARHDSG
Ga0207693_1028235413300025915Corn, Switchgrass And Miscanthus RhizosphereVQNGRQVDLSAQVERVKRRTRPWKAIIALLFAIAAGVLSRQARHDSG
Ga0207650_1025054733300025925Switchgrass RhizosphereVQNGRQIDLSTQVERVKHKTRPWKSIISLLLAIAAAVLSRQARND
Ga0207664_1014748633300025929Agricultural SoilVQNGRQIDLPTQVERVRRKTRPWKSIIALLLAIAAAVISRQARSGTFTANHL
Ga0209577_1029814523300026552SoilVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAITAAVIS
Ga0208761_103124923300026995SoilVQNGRQIDVSAQVERVRRRTRPWKSIIALLLAIAAAVISHQARRST
Ga0209111_104499113300027058Forest SoilVQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIAAAVISHQARRSTFTAG
Ga0208367_10151013300027107Forest SoilVQERQIDLSAQVARVKRKTRPWKSIIALLLAIAVAVLCFVSMLIGLA
Ga0209327_107369913300027307Forest SoilVQNGRQIDLPAQVERVRRKTRPWKSIISLLLAIAAAVISHQSRHS
Ga0208199_109500023300027497Peatlands SoilVQERQSDLSAQVARVKRKTRPWASIIALVLAIAAAVISHRASHGSST
Ga0208043_113981323300027570Peatlands SoilVQERQSDLSAQVARVKRKTRPWASIIALVLAIAAAVISHRA
Ga0208324_1000699223300027604Peatlands SoilVQERQSDLSAQVARVKRKTRPWASIIALVLAVAAA
Ga0209074_1056472813300027787Agricultural SoilVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIASAVISHQARWGTFTTN
Ga0209693_1035016813300027855SoilMSTVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIAAAV
Ga0209283_1028898013300027875Vadose Zone SoilVHDVRQIDLSAQVERVKRKTRPWKSIIALLLAIAAAVISHQARRDSNT
Ga0209590_1000862513300027882Vadose Zone SoilVQNGRQIDLSAQVERVKRRTRPWKSIIALLLAIAAA
Ga0209488_1020104613300027903Vadose Zone SoilVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAVAFAVI
Ga0307312_1000674323300028828SoilVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIASAIL
Ga0307289_1026310323300028875SoilVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIASAILSRQARND
Ga0311340_1022039413300029943PalsaVHSPNGIQVELSAQVERVKRRTRPWKSIIALVLAIAAAVIS
Ga0311371_1070434013300029951PalsaVQDRQIDLSAKVARVKRRTRPWKSIIALVLAIAAAVISREAAVPY
Ga0310037_1002220313300030494Peatlands SoilVQERQSDLSAQVARVKRKTRPWASIIALVLAIAAAVI
Ga0311370_1080633923300030503PalsaVHSPNGIQTELSAQVERVKGRTRPWKSIIALVLAIAAAIIS
Ga0210277_1046077423300030528SoilVQERQIDLSAKVARVKRKARPWKSIVALLLAIAAAVI
Ga0311355_1011654343300030580PalsaVHDGKPIDLSAQVALVKRKTRPWKAIIALLLAIAAGVIS
Ga0311354_1031267613300030618PalsaVHSPNGIQVELSAQVERVKRRTRPWKSIIALVLAIAAAVISHSAHR
Ga0210251_1067948413300030624SoilVQERQIDLSAKVARVKRKARPWKSIVALLLAIAAAVISHR
Ga0302317_1014014913300030677PalsaVHSPNGIQVELSAQVERVKRRTRPWKSIIALVLAIAAA
Ga0310038_1011441113300030707Peatlands SoilVQERQSDLSAQVARVKRKTRPWASIIALVLAIAAAV
Ga0265462_1154115813300030738SoilMAWQEEVRVQDRQIDLSAKVAQVKRKTRPWKSIIALVLAIAAAVIS
Ga0170823_1734074313300031128Forest SoilMQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIASAVISHQARRGTLTRRM
Ga0318534_1081968923300031544SoilVQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISHQAHRDTFT
Ga0318561_1066362523300031679SoilVQERQIDLSERVAQVKRKTRPWKSIIALVLAIASAIISDAARHDSE
Ga0318560_1030330313300031682SoilVQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISHQAHRDT
Ga0318526_1012158513300031769SoilVQGRQNHLSTQVARVRRRTRPWKSIIALVLAIAFAVISHLASPS
Ga0318521_1064498023300031770SoilVQNGRQVDLPARVERVRHKTRPWKSIIALLLAIAAAVISHQA
Ga0318547_1065698423300031781SoilVQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISH
Ga0318547_1108591623300031781SoilVQSRNGRENELSAHVERVKRRTRPWKSIIALVLAIAS
Ga0318550_1053089913300031797SoilVQNGRQIDLSAQVERVRRKTRPWKSIIALLLAIAAAVIS
Ga0318523_1015735413300031798SoilVQNGRQIDLPARVERVRRKTRPWKSIIALLLAIASAVISH
Ga0318568_1024833813300031819SoilVQERQNHLSVQVARVRHKARPWKSIIALVLAIASAVISHLAS
Ga0318564_1054878313300031831SoilVQNGRQVDLPARVERVRRKTRPWKSIIALLLAIAAAVISRQ
Ga0318536_1014635423300031893SoilVQNGRQVDLPARVERVRRKTRPWKSIIALLLAIAAA
Ga0318520_1056625123300031897SoilVQNGRQIDLPARVERVRRKTRPWKSIIALLLAIASAVISHQAR
Ga0306921_1095928623300031912SoilVHDVRQINLSAQVERVRRKTRPWKSIIALLLAIAAAIISHEARRDTPFG
Ga0318530_1037218513300031959SoilVQNGRQVDLPARVERVRHKTRPWKSIIALLLAIAAAVISHQAHRA
Ga0306922_1189770223300032001SoilVQNGRQVDLEAHVERVRRRARPWKSIIALLLAIASAVISHQARRGAFTE
Ga0318569_1039452213300032010SoilVQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISHQAHRDTLTEN
Ga0310911_1028357323300032035SoilVQERQNHLSAQVARVRRKTRPWKSIIALVLAIAAAVIS
Ga0318549_1011424413300032041SoilVQNGRQVDLPARVERVRHKTRPWKSIIALLLAIAAAVI
Ga0318558_1016152323300032044SoilVQNGRQIDLPARVERVRRKTRPWKSIIALLLAIAAAVISHQAHRD
Ga0318510_1005553123300032064SoilVQNGRQVDLPARVERVRHKTRPWKSIIALLLAIAAAVIS
Ga0318513_1063003013300032065SoilVQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISHQAHR
Ga0318518_1061741713300032090SoilVQERQNHLSVQVARVRHKARPWKSIIALVLAIASAVISH
Ga0307472_10064306723300032205Hardwood Forest SoilVQNGRQVDLPTHVERVRRKTRPWKSIIALLLAIAAAVISHQSRRSPFT
Ga0335085_1075318223300032770SoilVQNGRQIDLPARVERVRRKTRPWKSIIALLLAIAAAVISNQ
Ga0335079_1056814113300032783SoilVQNGRQVDLPARVERVRRKTRPWKSIIALLLAIAAAVIS
Ga0335077_1221816213300033158SoilVQNGRQIDLSEKVQRVKRKTRPWKSIIFLLLAIAAAVISHQARRGTL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.