Basic Information | |
---|---|
Family ID | F063888 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 42 residues |
Representative Sequence | VQNGRQIDLSAQVERVKRRTRPWKSIIALLLAIAAAVIS |
Number of Associated Samples | 123 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 95.35 % |
% of genes near scaffold ends (potentially truncated) | 97.67 % |
% of genes from short scaffolds (< 2000 bps) | 89.92 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (54.264 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.457 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.930 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.713 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF01184 | Gpr1_Fun34_YaaH | 89.92 |
PF08044 | DUF1707 | 7.75 |
PF00156 | Pribosyltran | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 89.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 54.26 % |
Unclassified | root | N/A | 45.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_158540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. BRA 177 | 681 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101281026 | Not Available | 891 | Open in IMG/M |
3300003219|JGI26341J46601_10093906 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300003368|JGI26340J50214_10173903 | Not Available | 535 | Open in IMG/M |
3300004092|Ga0062389_101914368 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300004470|Ga0068967_1052880 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300004618|Ga0068963_1444674 | Not Available | 775 | Open in IMG/M |
3300005435|Ga0070714_100352082 | Not Available | 1383 | Open in IMG/M |
3300005437|Ga0070710_10923223 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300005538|Ga0070731_10358190 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300005591|Ga0070761_11104458 | Not Available | 505 | Open in IMG/M |
3300005602|Ga0070762_10125906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1510 | Open in IMG/M |
3300005602|Ga0070762_11109981 | Not Available | 545 | Open in IMG/M |
3300005764|Ga0066903_100430400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2191 | Open in IMG/M |
3300006028|Ga0070717_11291680 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300006050|Ga0075028_100617837 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300006176|Ga0070765_100073558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2876 | Open in IMG/M |
3300006804|Ga0079221_10715492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 700 | Open in IMG/M |
3300006806|Ga0079220_10362890 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300006904|Ga0075424_101608912 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300009036|Ga0105244_10229612 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300009090|Ga0099827_10447292 | Not Available | 1107 | Open in IMG/M |
3300009137|Ga0066709_102216479 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300009162|Ga0075423_10599048 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300009520|Ga0116214_1008381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3678 | Open in IMG/M |
3300009521|Ga0116222_1015154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3559 | Open in IMG/M |
3300009698|Ga0116216_10790280 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300009700|Ga0116217_10174512 | Not Available | 1424 | Open in IMG/M |
3300009700|Ga0116217_10314228 | Not Available | 1005 | Open in IMG/M |
3300009792|Ga0126374_11589491 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300009839|Ga0116223_10449073 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300010376|Ga0126381_100773983 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300010379|Ga0136449_101839573 | Not Available | 903 | Open in IMG/M |
3300010858|Ga0126345_1192026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2787 | Open in IMG/M |
3300010867|Ga0126347_1275129 | Not Available | 532 | Open in IMG/M |
3300010876|Ga0126361_10073230 | Not Available | 1128 | Open in IMG/M |
3300012096|Ga0137389_11666738 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300012199|Ga0137383_10132367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1821 | Open in IMG/M |
3300012361|Ga0137360_11284081 | Not Available | 632 | Open in IMG/M |
3300012985|Ga0164308_11007559 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300013100|Ga0157373_11446838 | Not Available | 523 | Open in IMG/M |
3300013307|Ga0157372_12721487 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300014655|Ga0181516_10298008 | Not Available | 820 | Open in IMG/M |
3300016270|Ga0182036_11314599 | Not Available | 603 | Open in IMG/M |
3300017926|Ga0187807_1011523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2719 | Open in IMG/M |
3300017928|Ga0187806_1248283 | Not Available | 615 | Open in IMG/M |
3300017942|Ga0187808_10405744 | Not Available | 623 | Open in IMG/M |
3300017970|Ga0187783_11267116 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300017993|Ga0187823_10135993 | Not Available | 765 | Open in IMG/M |
3300017994|Ga0187822_10070406 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300018058|Ga0187766_10515870 | Not Available | 806 | Open in IMG/M |
3300018085|Ga0187772_10435871 | Not Available | 917 | Open in IMG/M |
3300018085|Ga0187772_10709718 | Not Available | 721 | Open in IMG/M |
3300018086|Ga0187769_10319950 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300018482|Ga0066669_12453282 | Not Available | 501 | Open in IMG/M |
3300020579|Ga0210407_10938556 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300021178|Ga0210408_10128108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2004 | Open in IMG/M |
3300021180|Ga0210396_11669588 | Not Available | 518 | Open in IMG/M |
3300021405|Ga0210387_10290720 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300021407|Ga0210383_11453575 | Not Available | 568 | Open in IMG/M |
3300021420|Ga0210394_11550829 | Not Available | 559 | Open in IMG/M |
3300021474|Ga0210390_10809513 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300021474|Ga0210390_11012352 | Not Available | 678 | Open in IMG/M |
3300021475|Ga0210392_10576017 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300021477|Ga0210398_10191293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1667 | Open in IMG/M |
3300021478|Ga0210402_10307752 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
3300021559|Ga0210409_11456400 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300022525|Ga0242656_1060012 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300022716|Ga0242673_1010785 | Not Available | 1148 | Open in IMG/M |
3300025904|Ga0207647_10125722 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300025906|Ga0207699_10964107 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300025915|Ga0207693_10075082 | All Organisms → cellular organisms → Bacteria | 2647 | Open in IMG/M |
3300025915|Ga0207693_10282354 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300025925|Ga0207650_10250547 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
3300025929|Ga0207664_10147486 | Not Available | 1996 | Open in IMG/M |
3300026552|Ga0209577_10298145 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300026995|Ga0208761_1031249 | Not Available | 538 | Open in IMG/M |
3300027058|Ga0209111_1044991 | Not Available | 567 | Open in IMG/M |
3300027107|Ga0208367_101510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1549 | Open in IMG/M |
3300027307|Ga0209327_1073699 | Not Available | 504 | Open in IMG/M |
3300027497|Ga0208199_1095000 | Not Available | 618 | Open in IMG/M |
3300027570|Ga0208043_1139813 | Not Available | 636 | Open in IMG/M |
3300027604|Ga0208324_1000699 | Not Available | 14249 | Open in IMG/M |
3300027787|Ga0209074_10564728 | Not Available | 503 | Open in IMG/M |
3300027855|Ga0209693_10350168 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300027875|Ga0209283_10288980 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300027882|Ga0209590_10008625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4642 | Open in IMG/M |
3300027903|Ga0209488_10201046 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300028828|Ga0307312_10006743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 6219 | Open in IMG/M |
3300028875|Ga0307289_10263103 | Not Available | 710 | Open in IMG/M |
3300029943|Ga0311340_10220394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 1886 | Open in IMG/M |
3300029951|Ga0311371_10704340 | Not Available | 1268 | Open in IMG/M |
3300030494|Ga0310037_10022203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3063 | Open in IMG/M |
3300030503|Ga0311370_10806339 | Not Available | 1080 | Open in IMG/M |
3300030528|Ga0210277_10460774 | Not Available | 1182 | Open in IMG/M |
3300030580|Ga0311355_10116543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2936 | Open in IMG/M |
3300030618|Ga0311354_10312676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1619 | Open in IMG/M |
3300030624|Ga0210251_10679484 | Not Available | 1096 | Open in IMG/M |
3300030677|Ga0302317_10140149 | Not Available | 1135 | Open in IMG/M |
3300030707|Ga0310038_10114411 | Not Available | 1388 | Open in IMG/M |
3300030738|Ga0265462_11541158 | Not Available | 621 | Open in IMG/M |
3300031128|Ga0170823_17340743 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300031544|Ga0318534_10819689 | Not Available | 522 | Open in IMG/M |
3300031679|Ga0318561_10663625 | Not Available | 574 | Open in IMG/M |
3300031682|Ga0318560_10303303 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300031769|Ga0318526_10121585 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300031770|Ga0318521_10644980 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031781|Ga0318547_10656984 | Not Available | 651 | Open in IMG/M |
3300031781|Ga0318547_11085916 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031797|Ga0318550_10530899 | Not Available | 567 | Open in IMG/M |
3300031798|Ga0318523_10157354 | Not Available | 1131 | Open in IMG/M |
3300031819|Ga0318568_10248338 | Not Available | 1102 | Open in IMG/M |
3300031831|Ga0318564_10548783 | Not Available | 500 | Open in IMG/M |
3300031893|Ga0318536_10146354 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300031897|Ga0318520_10566251 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300031912|Ga0306921_10959286 | Not Available | 967 | Open in IMG/M |
3300031959|Ga0318530_10372185 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300032001|Ga0306922_11897702 | Not Available | 583 | Open in IMG/M |
3300032010|Ga0318569_10394522 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300032035|Ga0310911_10283573 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300032041|Ga0318549_10114244 | Not Available | 1186 | Open in IMG/M |
3300032044|Ga0318558_10161523 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300032064|Ga0318510_10055531 | Not Available | 1414 | Open in IMG/M |
3300032065|Ga0318513_10630030 | Not Available | 525 | Open in IMG/M |
3300032090|Ga0318518_10617417 | Not Available | 553 | Open in IMG/M |
3300032205|Ga0307472_100643067 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300032770|Ga0335085_10753182 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300032783|Ga0335079_10568141 | Not Available | 1200 | Open in IMG/M |
3300033158|Ga0335077_12218162 | Not Available | 504 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.46% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.85% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.43% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.33% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.55% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004470 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004618 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027107 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF029 (SPAdes) | Environmental | Open in IMG/M |
3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030528 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_02625430 | 2199352025 | Soil | VQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIAAAVISHQARNGNFTASNM |
INPhiseqgaiiFebDRAFT_1012810261 | 3300000364 | Soil | VQNGRQIDLSAQVERVKRRTRPWKSIIALLLAIAAAVIS |
JGI26341J46601_100939061 | 3300003219 | Bog Forest Soil | VHDVKQIDLSAQVERVKRKTRPWKSIIALVLAIAAAVISHRASHG |
JGI26340J50214_101739031 | 3300003368 | Bog Forest Soil | VHDVKQIDLSAQVERVKRKTRPWKSIIALVLAIAAAVISHRASHGRSNSHG |
Ga0062389_1019143681 | 3300004092 | Bog Forest Soil | VHNGKQVDLSAQVERVKRKTRPWKSIIALLLAIAAAVISHR |
Ga0068967_10528801 | 3300004470 | Peatlands Soil | MDIRQIDLSTQVERVKRKTRPWKSIIALLLAIVAAVISHRASHG |
Ga0068963_14446742 | 3300004618 | Peatlands Soil | VHDVKQIDLSAQVERVKRKTRPWKSIIALALAIAAAVISHRASHGRSTFVH |
Ga0070714_1003520821 | 3300005435 | Agricultural Soil | VQNGRQIDLPTQVERVRRKTRPWKSIIALLLAIAAAVISRQAR |
Ga0070710_109232231 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNGRQIDLSTQVERVKRGTRPWKSIIALLLAIASAVISHQAHRG |
Ga0070731_103581901 | 3300005538 | Surface Soil | VQERQIDLSAKVAQVKRRTRPWKSIIVLLVAIAAAVISHQARDQARGD |
Ga0070761_111044581 | 3300005591 | Soil | VQDGQIDLSAKVAQVKRKARPWKSIIALVLAIAAAVISRRA |
Ga0070762_101259063 | 3300005602 | Soil | MHEVRQLDLAEQVELVKRKTRPWKSIIALLLAIAAAVIS |
Ga0070762_111099812 | 3300005602 | Soil | VQSWDDIDLQGKVQTVRRKTRPWKAIIALLFAIAAAV |
Ga0066903_1004304001 | 3300005764 | Tropical Forest Soil | VQNGRQIDLPTQVRRVRRRTRPWKSIIALLLAIAAAVI |
Ga0070717_112916802 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNGRQIDLSAQVERVKRRTRPWKAIIALLFAIAA |
Ga0075028_1006178372 | 3300006050 | Watersheds | VQNGRQVDLPKQVERVRRRTRPWKSIIALLLAIAAAVISH |
Ga0070765_1000735585 | 3300006176 | Soil | VHHPQNGIDLSAQVALVKRKTRPWKAIIALVLAIAAAVVSHESR |
Ga0079221_107154922 | 3300006804 | Agricultural Soil | MSTVQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIASAVISH* |
Ga0079220_103628902 | 3300006806 | Agricultural Soil | VQNGRQIDLSTQVERVKHKTRPWKSIISLLLAIAAAV |
Ga0075424_1016089121 | 3300006904 | Populus Rhizosphere | VQNGRQIDLSAQVERVKHRARPWKAIIALLFAIAAGVLSHQA |
Ga0105244_102296121 | 3300009036 | Miscanthus Rhizosphere | VQNGRQIDLSTQVERVKHKTRPWKSIIFLLLAIASAVL |
Ga0099827_104472921 | 3300009090 | Vadose Zone Soil | VQNGRQIDLSAQVERVKRRTRPWKSIIALLLAIAAAVI |
Ga0066709_1022164791 | 3300009137 | Grasslands Soil | MSTVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAITAAVISHQARRGTF |
Ga0075423_105990481 | 3300009162 | Populus Rhizosphere | VQNGRQIDLSTQVERVKHKTRPWKSIISLLLAIAAAVLSRQARNNS |
Ga0116214_10083814 | 3300009520 | Peatlands Soil | VQERQSDLSAQVARVKRKTRPWASIIALVLAIAAA |
Ga0116222_10151541 | 3300009521 | Peatlands Soil | VQERQIDVSAQVARVKRKTRPWASIIALVLAIAAAVISHR |
Ga0116216_107902802 | 3300009698 | Peatlands Soil | VQEIHADLSAQVRRVRRKTRPWKSIIALVLAIAAAVIS |
Ga0116217_101745121 | 3300009700 | Peatlands Soil | VQERQIDVSAQVARVKRKTRPWKSIIALVLAIAAAVISHRASH |
Ga0116217_103142282 | 3300009700 | Peatlands Soil | VHDAKQIDLSAQVERVKRKTRPWKSIIALLLAIAAAVISHRAS |
Ga0126374_115894911 | 3300009792 | Tropical Forest Soil | MRRSAVQNGRQIDLSTHVERVKRKTRPWKSIIALAL |
Ga0116223_104490732 | 3300009839 | Peatlands Soil | VHDAKQIDLSAQVERVKRQTRPWKSIIALLLAIAAAVISHRAAHGRSNF |
Ga0126381_1007739833 | 3300010376 | Tropical Forest Soil | MARKEELRVQERQNHLSTQVARVRRRTRPWKSIIALVLAIASAVIS |
Ga0136449_1018395732 | 3300010379 | Peatlands Soil | VQERQVDLSARVAQVKRRARPWKSIIALVLAIASAIISHLAS |
Ga0126345_11920264 | 3300010858 | Boreal Forest Soil | VQERQIDLSAKVAQVKRRTRPWKSIIALLLAIAAAVISDQARHDPH |
Ga0126347_12751292 | 3300010867 | Boreal Forest Soil | VHDGKQLDLSAQVELVKRKTRPWKSIIALVLAIAVAVVSYEAHRHSSIFPVNHT |
Ga0126361_100732302 | 3300010876 | Boreal Forest Soil | VHDGKPIDLSAQVELVKRKTRPWKSIIALVLAITA |
Ga0137389_116667382 | 3300012096 | Vadose Zone Soil | VHDVKQIDLSAQVERVKRRTRPWKSIIALLLAIAA |
Ga0137383_101323673 | 3300012199 | Vadose Zone Soil | MSTVQNGRQVDLSTQVERVKRKTRPWKSIIALLLAIAAAVISHQAR |
Ga0137360_112840811 | 3300012361 | Vadose Zone Soil | VHDLKQIDLSAQVERVKRKTRPWKSIIALLLAIAAAVI |
Ga0164308_110075591 | 3300012985 | Soil | VQNGRQIDLPTQVERVRRKTRPWKSIIALLLAIAAAV |
Ga0157373_114468382 | 3300013100 | Corn Rhizosphere | VQNGRQIDLSAQVERVKRKTRPWKAIIALLFAIAAGVLSRQ |
Ga0157372_127214872 | 3300013307 | Corn Rhizosphere | VQNGRQIDLSTQVERVKHKTRPWKSIIFLLLAIASAVLSRQ |
Ga0181516_102980082 | 3300014655 | Bog | VHHPPNGIDLSAQVALVKRKTRPWKAIIALVLAIAAAVVSHESRFD |
Ga0182036_113145991 | 3300016270 | Soil | VQNGRQVDLPARVERVRRKTRPWKSIIALLLAIAAAVISRQARHGAFTTSD |
Ga0187807_10115234 | 3300017926 | Freshwater Sediment | VQERQTDLSAQVARVKRKTRPWKSIIALVLAVAAAI |
Ga0187806_12482831 | 3300017928 | Freshwater Sediment | VQERQTDLSAQVARVKRKTRPWKSIIALVLAVAAAIISHRASHGS |
Ga0187808_104057442 | 3300017942 | Freshwater Sediment | VQERQIDLSARVERVKRRTRPWKSIIALVLAIASAVISGAA |
Ga0187783_112671161 | 3300017970 | Tropical Peatland | VQSRNGIHDELSAHVERVKRKTRPWKSIIALVLAIAA |
Ga0187823_101359931 | 3300017993 | Freshwater Sediment | VQERQTDLSAQVARVKRKTRPWMSIIALVLAVAAAVIS |
Ga0187822_100704062 | 3300017994 | Freshwater Sediment | VQERQAELSARVAQVKRKTRPWKSIIALVLAIACAVISNAA |
Ga0187766_105158702 | 3300018058 | Tropical Peatland | VHERQIDLSTQVERVKRRTRPWKSIIALVLAIVSAVICNA |
Ga0187772_104358711 | 3300018085 | Tropical Peatland | VQDRQNELSVRVERVKRKTRPWKSIIALLLAIAAAVI |
Ga0187772_107097181 | 3300018085 | Tropical Peatland | VRERQIDLSAKVATVKRKARPWKSIIALILAIAAAII |
Ga0187769_103199501 | 3300018086 | Tropical Peatland | VQNGRQIDLSAQVQRVKRRTRPWKSIIALLLAIAAAVISRRASHGKSNFAGT |
Ga0066669_124532822 | 3300018482 | Grasslands Soil | VQNGRQIDLSGQVERVKRRTRPWKAIIALLFAIAAGVLS |
Ga0210407_109385561 | 3300020579 | Soil | VQNGRQVDLPKQVERVRRRTRPWKSIIALLLAIAAAVI |
Ga0210408_101281083 | 3300021178 | Soil | VQERQIDLSAQVARVKRKTRPWKSIIALLLAIAAAV |
Ga0210396_116695882 | 3300021180 | Soil | VHDGKQIGLTAEVALVKRKTRPWKSMIALVLAIAAGVLCD |
Ga0210387_102907202 | 3300021405 | Soil | VQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIAAA |
Ga0210383_114535751 | 3300021407 | Soil | VHNGKQVDLSAQVERVKRKTRPWKSIIALLLAIAAAVISHRAR |
Ga0210394_115508291 | 3300021420 | Soil | MSTVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAI |
Ga0210390_108095132 | 3300021474 | Soil | VHDVKQIDLSAQVERVKRKTRPWKSIIALLLAIAAAVISYRAS |
Ga0210390_110123522 | 3300021474 | Soil | VQERQIDLSAQVARVKRKTRPWKSIIALLLAIAVAVISRIAHHASD |
Ga0210392_105760172 | 3300021475 | Soil | VQNGRQVDLPKQVERVRRRTRPWKSIIALLLAIAAAVIS |
Ga0210398_101912933 | 3300021477 | Soil | VHDAKQIDLSAQVERVKRKTRPWKSIIALLLAIVSAF |
Ga0210402_103077521 | 3300021478 | Soil | VQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIAAA |
Ga0210409_114564001 | 3300021559 | Soil | VQERQIDLSAQVARVKRKTRPWKSIIALLLAIAAAVI |
Ga0242656_10600122 | 3300022525 | Soil | MQVHGGPQIDLSARVALVRRKTRPWKSIIALVLAI |
Ga0242673_10107851 | 3300022716 | Soil | VHDVKQIDLSARVERVKRKTRPWKSIIALLLAIVSALISHRARRDEPTFFTVNH |
Ga0207647_101257222 | 3300025904 | Corn Rhizosphere | VQNGRQIDLSTQVERVKHKTKPWKSIISLLLAIAAAVLS |
Ga0207699_109641071 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTVQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIAAAVIS |
Ga0207693_100750823 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNGRQIDLSAQVERVKRRTRPWKAIIALLFAIAAGVLSRQARHDSG |
Ga0207693_102823541 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNGRQVDLSAQVERVKRRTRPWKAIIALLFAIAAGVLSRQARHDSG |
Ga0207650_102505473 | 3300025925 | Switchgrass Rhizosphere | VQNGRQIDLSTQVERVKHKTRPWKSIISLLLAIAAAVLSRQARND |
Ga0207664_101474863 | 3300025929 | Agricultural Soil | VQNGRQIDLPTQVERVRRKTRPWKSIIALLLAIAAAVISRQARSGTFTANHL |
Ga0209577_102981452 | 3300026552 | Soil | VQNGRQIDLSTQVERVKRKTRPWKSIIALLLAITAAVIS |
Ga0208761_10312492 | 3300026995 | Soil | VQNGRQIDVSAQVERVRRRTRPWKSIIALLLAIAAAVISHQARRST |
Ga0209111_10449911 | 3300027058 | Forest Soil | VQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIAAAVISHQARRSTFTAG |
Ga0208367_1015101 | 3300027107 | Forest Soil | VQERQIDLSAQVARVKRKTRPWKSIIALLLAIAVAVLCFVSMLIGLA |
Ga0209327_10736991 | 3300027307 | Forest Soil | VQNGRQIDLPAQVERVRRKTRPWKSIISLLLAIAAAVISHQSRHS |
Ga0208199_10950002 | 3300027497 | Peatlands Soil | VQERQSDLSAQVARVKRKTRPWASIIALVLAIAAAVISHRASHGSST |
Ga0208043_11398132 | 3300027570 | Peatlands Soil | VQERQSDLSAQVARVKRKTRPWASIIALVLAIAAAVISHRA |
Ga0208324_100069922 | 3300027604 | Peatlands Soil | VQERQSDLSAQVARVKRKTRPWASIIALVLAVAAA |
Ga0209074_105647281 | 3300027787 | Agricultural Soil | VQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIASAVISHQARWGTFTTN |
Ga0209693_103501681 | 3300027855 | Soil | MSTVQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIAAAV |
Ga0209283_102889801 | 3300027875 | Vadose Zone Soil | VHDVRQIDLSAQVERVKRKTRPWKSIIALLLAIAAAVISHQARRDSNT |
Ga0209590_100086251 | 3300027882 | Vadose Zone Soil | VQNGRQIDLSAQVERVKRRTRPWKSIIALLLAIAAA |
Ga0209488_102010461 | 3300027903 | Vadose Zone Soil | VQNGRQIDLSTQVERVKRKTRPWKSIIALLLAVAFAVI |
Ga0307312_100067432 | 3300028828 | Soil | VQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIASAIL |
Ga0307289_102631032 | 3300028875 | Soil | VQNGRQIDLSTQVERVKRKTRPWKSIIALLLAIASAILSRQARND |
Ga0311340_102203941 | 3300029943 | Palsa | VHSPNGIQVELSAQVERVKRRTRPWKSIIALVLAIAAAVIS |
Ga0311371_107043401 | 3300029951 | Palsa | VQDRQIDLSAKVARVKRRTRPWKSIIALVLAIAAAVISREAAVPY |
Ga0310037_100222031 | 3300030494 | Peatlands Soil | VQERQSDLSAQVARVKRKTRPWASIIALVLAIAAAVI |
Ga0311370_108063392 | 3300030503 | Palsa | VHSPNGIQTELSAQVERVKGRTRPWKSIIALVLAIAAAIIS |
Ga0210277_104607742 | 3300030528 | Soil | VQERQIDLSAKVARVKRKARPWKSIVALLLAIAAAVI |
Ga0311355_101165434 | 3300030580 | Palsa | VHDGKPIDLSAQVALVKRKTRPWKAIIALLLAIAAGVIS |
Ga0311354_103126761 | 3300030618 | Palsa | VHSPNGIQVELSAQVERVKRRTRPWKSIIALVLAIAAAVISHSAHR |
Ga0210251_106794841 | 3300030624 | Soil | VQERQIDLSAKVARVKRKARPWKSIVALLLAIAAAVISHR |
Ga0302317_101401491 | 3300030677 | Palsa | VHSPNGIQVELSAQVERVKRRTRPWKSIIALVLAIAAA |
Ga0310038_101144111 | 3300030707 | Peatlands Soil | VQERQSDLSAQVARVKRKTRPWASIIALVLAIAAAV |
Ga0265462_115411581 | 3300030738 | Soil | MAWQEEVRVQDRQIDLSAKVAQVKRKTRPWKSIIALVLAIAAAVIS |
Ga0170823_173407431 | 3300031128 | Forest Soil | MQNGRQIDLSTQVERVKRRTRPWKSIIALLLAIASAVISHQARRGTLTRRM |
Ga0318534_108196892 | 3300031544 | Soil | VQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISHQAHRDTFT |
Ga0318561_106636252 | 3300031679 | Soil | VQERQIDLSERVAQVKRKTRPWKSIIALVLAIASAIISDAARHDSE |
Ga0318560_103033031 | 3300031682 | Soil | VQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISHQAHRDT |
Ga0318526_101215851 | 3300031769 | Soil | VQGRQNHLSTQVARVRRRTRPWKSIIALVLAIAFAVISHLASPS |
Ga0318521_106449802 | 3300031770 | Soil | VQNGRQVDLPARVERVRHKTRPWKSIIALLLAIAAAVISHQA |
Ga0318547_106569842 | 3300031781 | Soil | VQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISH |
Ga0318547_110859162 | 3300031781 | Soil | VQSRNGRENELSAHVERVKRRTRPWKSIIALVLAIAS |
Ga0318550_105308991 | 3300031797 | Soil | VQNGRQIDLSAQVERVRRKTRPWKSIIALLLAIAAAVIS |
Ga0318523_101573541 | 3300031798 | Soil | VQNGRQIDLPARVERVRRKTRPWKSIIALLLAIASAVISH |
Ga0318568_102483381 | 3300031819 | Soil | VQERQNHLSVQVARVRHKARPWKSIIALVLAIASAVISHLAS |
Ga0318564_105487831 | 3300031831 | Soil | VQNGRQVDLPARVERVRRKTRPWKSIIALLLAIAAAVISRQ |
Ga0318536_101463542 | 3300031893 | Soil | VQNGRQVDLPARVERVRRKTRPWKSIIALLLAIAAA |
Ga0318520_105662512 | 3300031897 | Soil | VQNGRQIDLPARVERVRRKTRPWKSIIALLLAIASAVISHQAR |
Ga0306921_109592862 | 3300031912 | Soil | VHDVRQINLSAQVERVRRKTRPWKSIIALLLAIAAAIISHEARRDTPFG |
Ga0318530_103721851 | 3300031959 | Soil | VQNGRQVDLPARVERVRHKTRPWKSIIALLLAIAAAVISHQAHRA |
Ga0306922_118977022 | 3300032001 | Soil | VQNGRQVDLEAHVERVRRRARPWKSIIALLLAIASAVISHQARRGAFTE |
Ga0318569_103945221 | 3300032010 | Soil | VQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISHQAHRDTLTEN |
Ga0310911_102835732 | 3300032035 | Soil | VQERQNHLSAQVARVRRKTRPWKSIIALVLAIAAAVIS |
Ga0318549_101142441 | 3300032041 | Soil | VQNGRQVDLPARVERVRHKTRPWKSIIALLLAIAAAVI |
Ga0318558_101615232 | 3300032044 | Soil | VQNGRQIDLPARVERVRRKTRPWKSIIALLLAIAAAVISHQAHRD |
Ga0318510_100555312 | 3300032064 | Soil | VQNGRQVDLPARVERVRHKTRPWKSIIALLLAIAAAVIS |
Ga0318513_106300301 | 3300032065 | Soil | VQNGRQVDLPARVERVRRRTRPWKSIIALLLAIAAAVISHQAHR |
Ga0318518_106174171 | 3300032090 | Soil | VQERQNHLSVQVARVRHKARPWKSIIALVLAIASAVISH |
Ga0307472_1006430672 | 3300032205 | Hardwood Forest Soil | VQNGRQVDLPTHVERVRRKTRPWKSIIALLLAIAAAVISHQSRRSPFT |
Ga0335085_107531822 | 3300032770 | Soil | VQNGRQIDLPARVERVRRKTRPWKSIIALLLAIAAAVISNQ |
Ga0335079_105681411 | 3300032783 | Soil | VQNGRQVDLPARVERVRRKTRPWKSIIALLLAIAAAVIS |
Ga0335077_122181621 | 3300033158 | Soil | VQNGRQIDLSEKVQRVKRKTRPWKSIIFLLLAIAAAVISHQARRGTL |
⦗Top⦘ |