| Basic Information | |
|---|---|
| Family ID | F063872 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LDRIGAGMATEAALREVLHSDYNDVMQSTAEYLRKTYGR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.78 % |
| % of genes near scaffold ends (potentially truncated) | 98.45 % |
| % of genes from short scaffolds (< 2000 bps) | 93.80 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.450 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.783 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.884 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.062 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF01546 | Peptidase_M20 | 51.94 |
| PF07687 | M20_dimer | 27.13 |
| PF07977 | FabA | 2.33 |
| PF14257 | DUF4349 | 1.55 |
| PF06035 | Peptidase_C93 | 1.55 |
| PF13720 | Acetyltransf_11 | 0.78 |
| PF13646 | HEAT_2 | 0.78 |
| PF00117 | GATase | 0.78 |
| PF01346 | FKBP_N | 0.78 |
| PF00132 | Hexapep | 0.78 |
| PF13485 | Peptidase_MA_2 | 0.78 |
| PF01042 | Ribonuc_L-PSP | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0764 | 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase | Lipid transport and metabolism [I] | 2.33 |
| COG4706 | Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain | Lipid transport and metabolism [I] | 2.33 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 1.55 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.78 |
| COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.45 % |
| Unclassified | root | N/A | 1.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10330208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 542 | Open in IMG/M |
| 3300002911|JGI25390J43892_10149863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300002917|JGI25616J43925_10251359 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300003350|JGI26347J50199_1017622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300004082|Ga0062384_100438304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300004635|Ga0062388_100185301 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300005176|Ga0066679_10467690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300005179|Ga0066684_10442746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 873 | Open in IMG/M |
| 3300005552|Ga0066701_10529536 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005554|Ga0066661_10331889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300005554|Ga0066661_10703983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300005559|Ga0066700_11079177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300005566|Ga0066693_10028793 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300005576|Ga0066708_10001596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 8058 | Open in IMG/M |
| 3300005598|Ga0066706_11530365 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005764|Ga0066903_106399831 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006176|Ga0070765_100591351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300006176|Ga0070765_101916123 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006354|Ga0075021_10758848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300006797|Ga0066659_10464418 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300006797|Ga0066659_10769957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300006800|Ga0066660_10222941 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300006804|Ga0079221_11798245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300006806|Ga0079220_10023415 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
| 3300006954|Ga0079219_11179174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300007265|Ga0099794_10642295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300007265|Ga0099794_10772019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300009088|Ga0099830_11357640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300009088|Ga0099830_11556091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300009089|Ga0099828_10698430 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300009089|Ga0099828_11058652 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300009137|Ga0066709_100787335 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300009137|Ga0066709_101161857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1136 | Open in IMG/M |
| 3300009137|Ga0066709_102602663 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300009143|Ga0099792_10082614 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300010048|Ga0126373_11355468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300010048|Ga0126373_13132592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300010320|Ga0134109_10009892 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
| 3300010360|Ga0126372_10730916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300010360|Ga0126372_11042097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300010361|Ga0126378_12886052 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300010364|Ga0134066_10127308 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300010376|Ga0126381_103556968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300011120|Ga0150983_11017176 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300011120|Ga0150983_14579927 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300011270|Ga0137391_11364249 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300011271|Ga0137393_11332001 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300011271|Ga0137393_11533995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300012096|Ga0137389_11677762 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012096|Ga0137389_11736359 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012189|Ga0137388_11582493 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012189|Ga0137388_11884006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012200|Ga0137382_11178053 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012202|Ga0137363_10126724 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300012202|Ga0137363_10204301 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300012203|Ga0137399_10252117 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300012205|Ga0137362_10794712 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012205|Ga0137362_10854933 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300012205|Ga0137362_10941452 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012209|Ga0137379_10067867 | All Organisms → cellular organisms → Bacteria | 3431 | Open in IMG/M |
| 3300012211|Ga0137377_10136566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2344 | Open in IMG/M |
| 3300012361|Ga0137360_10486564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300012361|Ga0137360_11186961 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300012362|Ga0137361_11057533 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300012363|Ga0137390_11091683 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012918|Ga0137396_10190371 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300012918|Ga0137396_10202785 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300012918|Ga0137396_10314511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300012927|Ga0137416_10837166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300012929|Ga0137404_10720282 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300012930|Ga0137407_10227667 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300012930|Ga0137407_10479376 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300014153|Ga0181527_1223282 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300014154|Ga0134075_10027892 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300014155|Ga0181524_10293011 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300014155|Ga0181524_10302036 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300015357|Ga0134072_10072121 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300017822|Ga0187802_10131433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
| 3300017943|Ga0187819_10170395 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300017961|Ga0187778_10826521 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300018088|Ga0187771_11892914 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300018090|Ga0187770_11530055 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300020034|Ga0193753_10253467 | Not Available | 780 | Open in IMG/M |
| 3300020140|Ga0179590_1120916 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300020150|Ga0187768_1160612 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300020580|Ga0210403_11159952 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300020581|Ga0210399_10193052 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300020581|Ga0210399_10750228 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300020581|Ga0210399_11499003 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300021178|Ga0210408_10901331 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300021478|Ga0210402_10452054 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300021478|Ga0210402_10922235 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300021479|Ga0210410_11406503 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300024330|Ga0137417_1505134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1468 | Open in IMG/M |
| 3300025928|Ga0207700_11920792 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026296|Ga0209235_1071541 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300026307|Ga0209469_1141579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300026335|Ga0209804_1258384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300026355|Ga0257149_1012976 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300026527|Ga0209059_1239518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300026557|Ga0179587_10000474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16598 | Open in IMG/M |
| 3300027548|Ga0209523_1130536 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027729|Ga0209248_10142452 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300027765|Ga0209073_10053871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1327 | Open in IMG/M |
| 3300027795|Ga0209139_10166727 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300027862|Ga0209701_10296103 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300027875|Ga0209283_10528170 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300027875|Ga0209283_10612047 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300027894|Ga0209068_10437514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300027903|Ga0209488_10008263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7758 | Open in IMG/M |
| 3300029993|Ga0302304_10215241 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300030056|Ga0302181_10346694 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300030763|Ga0265763_1034195 | Not Available | 589 | Open in IMG/M |
| 3300030878|Ga0265770_1110983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300030940|Ga0265740_1046578 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300030991|Ga0073994_12429921 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium GWF2_50_10 | 807 | Open in IMG/M |
| 3300031564|Ga0318573_10169614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
| 3300031682|Ga0318560_10063204 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300031769|Ga0318526_10327846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300031795|Ga0318557_10101820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300031954|Ga0306926_11379473 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300031962|Ga0307479_10327277 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300031962|Ga0307479_10558555 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300032035|Ga0310911_10611142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300032076|Ga0306924_11007116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300032180|Ga0307471_100548679 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300032782|Ga0335082_10774179 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300032897|Ga0335071_10234513 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300032955|Ga0335076_10461446 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.10% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.10% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.88% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_103302081 | 3300001356 | Peatlands Soil | QTDGMGDIERLLDRIAAGRSTEEALREVLHSDYGDLMQGTEEYLKKSYGR* |
| JGI25390J43892_101498632 | 3300002911 | Grasslands Soil | DRILERIGSGMAAERALREVLHSDYNDLMESTVXYLRKHNVHG* |
| JGI25616J43925_102513591 | 3300002917 | Grasslands Soil | HADGMGDVERILDRIGAGMTTEAALREVLHSDYNDVMQSTAEYLRATYGR* |
| JGI26347J50199_10176222 | 3300003350 | Bog Forest Soil | RILERIGSGEATEAALQEVLHSDYADVSQSTAEYLRKNYVH* |
| Ga0062384_1004383042 | 3300004082 | Bog Forest Soil | MSDVERILERIGSGEATEAALQEVLHSDYADVSQSTAEYLRKNYVH* |
| Ga0062388_1001853011 | 3300004635 | Bog Forest Soil | ILDRIGAGQATEAALREVLHSDYADVSQSTAEYLRKNYVH* |
| Ga0066679_104676901 | 3300005176 | Soil | RILDRIGAGMATDAALREVLHSDYSDLMQSTAEYLRKTYAR* |
| Ga0066684_104427462 | 3300005179 | Soil | DGMSDVERILDRIGAGMATEQALREVLHSDYSDLMESTAGYLRKNYVH* |
| Ga0066701_105295361 | 3300005552 | Soil | VLDRIAAGESTESALRNVIHSDYNDLMQATAEYLKKTYVH* |
| Ga0066661_103318893 | 3300005554 | Soil | RIGAGMATDAALREVLHSDYSDLMQSTAEYLRKTYAR* |
| Ga0066661_107039832 | 3300005554 | Soil | VDIDRILDRIGSGMATEQALREVLHSDYSDLMESTVKYLRKNYVH* |
| Ga0066700_110791772 | 3300005559 | Soil | AGMATDAALREVLHSDYSDLMQSTAEYLRKTYAR* |
| Ga0066693_100287933 | 3300005566 | Soil | AGMATEQALREVLHSDYRDLMESTVGYLRKNYIH* |
| Ga0066708_100015967 | 3300005576 | Soil | MSDVERILDRLGAGMATEQALREVLHSDYRDLMESTVGYLRKNYIH* |
| Ga0066706_115303652 | 3300005598 | Soil | TRILDRIARGGATEVAVREILHGDYGDVMQSTAEYLRKTYGR* |
| Ga0066903_1063998312 | 3300005764 | Tropical Forest Soil | LDRIGEGMTTEAAVREVTHDNYSDLMHSTADYLRKHYVH* |
| Ga0070765_1005913512 | 3300006176 | Soil | AGTSTEAAVREVLHSDYGDLSQSTAEYLRKNYVR* |
| Ga0070765_1019161232 | 3300006176 | Soil | DGMGDIERILDRIGSGMATEAALKEVLHSDYSDLMQSTVEYLKKTYGR* |
| Ga0075021_107588481 | 3300006354 | Watersheds | DRIGAGMATEQALKEVLRSDYNDVTQATAEYLRKTYGR* |
| Ga0066659_104644181 | 3300006797 | Soil | IERILDRIGAGMATEVALREVLHSDYNDVMQSTAEYLRKTYGR* |
| Ga0066659_107699573 | 3300006797 | Soil | DRIGAGMATDAALREVLHGDYSDLMQSTAEYLRKTYVR* |
| Ga0066660_102229412 | 3300006800 | Soil | RIGAGMATEAALREVLHSDYNDVMQSTAEYLRKSYGR* |
| Ga0079221_117982452 | 3300006804 | Agricultural Soil | GAGMATEQALREVLHSDYNDLMESTVGYLRKNYVH* |
| Ga0079220_100234151 | 3300006806 | Agricultural Soil | DVERILDRIGAGMATEQALREVLHSDYSDLMGSTAAYLKKNYVH* |
| Ga0079219_111791741 | 3300006954 | Agricultural Soil | SDVERILDRIGAGMDTERALREVLHSDYSDLMESTVAYLKKNYLH* |
| Ga0099794_106422951 | 3300007265 | Vadose Zone Soil | IGAGMATEAALREVLHSDYNDLAQSTAEYLKKNYGR* |
| Ga0099794_107720191 | 3300007265 | Vadose Zone Soil | RIGAGMATEAALREVLHSGYDDLMQSTAKYLQKTYR* |
| Ga0099830_113576401 | 3300009088 | Vadose Zone Soil | DIERILDRIGAGMATEQALREVLHSDYSDLMESTAAYLRKNYVH* |
| Ga0099830_115560911 | 3300009088 | Vadose Zone Soil | IERILDRIGAGMAAEVALREVLHSDYNDVMQSTAEYLRKTYGR* |
| Ga0099828_106984302 | 3300009089 | Vadose Zone Soil | IERILDRIGAGMATEAALREVLHSDYNDLAQSTAEYLKKNYGR* |
| Ga0099828_110586521 | 3300009089 | Vadose Zone Soil | GMGDIERILDRIGAGTAVEVALKEVLHSDYNDVMQSTAEYLKKTYGR* |
| Ga0066709_1007873352 | 3300009137 | Grasslands Soil | SGMATEQALREVLHSDYSDLMESTVAYLRKNCVH* |
| Ga0066709_1011618571 | 3300009137 | Grasslands Soil | GGMVDVERILDRIGAGMATEAALREVLHSDYNDLMQSTAEYLKKTYGH* |
| Ga0066709_1026026631 | 3300009137 | Grasslands Soil | NNHIMDRNGTGMSREAAMKEVLNSDYNDLMKSTAEYLKKTYGR* |
| Ga0099792_100826141 | 3300009143 | Vadose Zone Soil | NRILDRIGSGMSTEAALKVVLHSDYNDLMQSTAEYLKKTYGR* |
| Ga0126373_113554681 | 3300010048 | Tropical Forest Soil | RILDRIGQGMATEQALREVLHSDYRDLMESTASYLKKNYVH* |
| Ga0126373_131325922 | 3300010048 | Tropical Forest Soil | DVERILDRIGAGMATEQALREVRHSDYNDLMESTVGYLRKNYIR* |
| Ga0134109_100098924 | 3300010320 | Grasslands Soil | LERIGSGMAAERALREVLHSDYNDLMESTVEYLRKHNVHG* |
| Ga0126372_107309161 | 3300010360 | Tropical Forest Soil | ERILDRIGAGMSTETALREVLHSDYNDLMQSTAEYLRKNYVR* |
| Ga0126372_110420971 | 3300010360 | Tropical Forest Soil | DAERILERVGSGMATEQALREVLHSDYADLMESTVAYLRKNYAR* |
| Ga0126378_128860522 | 3300010361 | Tropical Forest Soil | AGMGTEQALREVLHNDYNDLMESTVGYLRKNYMH* |
| Ga0134066_101273081 | 3300010364 | Grasslands Soil | IGAGMATETALRDVLHSGYDDLMQSAAEYLRKTYAR* |
| Ga0126381_1035569681 | 3300010376 | Tropical Forest Soil | GQGMATEQALREVLHSDYRDLMESTASYLKKNYVH* |
| Ga0150983_110171761 | 3300011120 | Forest Soil | RILDRIGSGSSTEEALRAVLHSDYNDLMQSTAQYLHKTYGP* |
| Ga0150983_145799272 | 3300011120 | Forest Soil | MSDINRILDRIGSGMSTEAALKEVLHSGYDDLMQSTAEYLKKTYGR* |
| Ga0137391_113642491 | 3300011270 | Vadose Zone Soil | RILDRIGAGMATEAALREVLHSNYNDLAQSTADYLKKNYGR* |
| Ga0137393_113320012 | 3300011271 | Vadose Zone Soil | LDRIGAGMATEAALREVLHSDYNDVMQSTAEYLRKTYGR* |
| Ga0137393_115339952 | 3300011271 | Vadose Zone Soil | GAGMATEAALREVLHSDYNDLAQSTAEYLKKNYGR* |
| Ga0137389_116777622 | 3300012096 | Vadose Zone Soil | IAAGSSTEQAVKDVLRDDYPELMKETATYLKKNYIR* |
| Ga0137389_117363592 | 3300012096 | Vadose Zone Soil | DRIGAGMATEAALREVLHSDYDDLMESTAEYLKKTYLR* |
| Ga0137388_115824931 | 3300012189 | Vadose Zone Soil | YIEQADGMGDIERILDRIGAGMATEAALREVLHSNYNDLAQSTADYLKKNYGR* |
| Ga0137388_118840062 | 3300012189 | Vadose Zone Soil | ILDRIGAGMATEAALREVLHSDYNDLAQSTAEYLKKNYGR* |
| Ga0137382_111780532 | 3300012200 | Vadose Zone Soil | DIERILDRIGAGMPTETALREVLHSDYNDLMQSTADYLRKSYGR* |
| Ga0137363_101267241 | 3300012202 | Vadose Zone Soil | GSGMSTEAALKEVLHSDYNDLMKSTAEYLKKTYGR* |
| Ga0137363_102043012 | 3300012202 | Vadose Zone Soil | GDIERILDRIGAGMAVEASLKEVLHSDYDDLMQSTAEYLRKTYGR* |
| Ga0137399_102521171 | 3300012203 | Vadose Zone Soil | VERILDRIGAGMTTEAALREVLHSDYNDVMQSTAEYLRATYGR* |
| Ga0137362_107947121 | 3300012205 | Vadose Zone Soil | GAGMATETALKEVLHSDYNDLMQSTADYLRKTYGR* |
| Ga0137362_108549332 | 3300012205 | Vadose Zone Soil | DRIGSGMSTEEALKEVLHSDYNDLMQSTAEYLKKTYGR* |
| Ga0137362_109414521 | 3300012205 | Vadose Zone Soil | IERILDRLGAGMATEAALREVLHSDYNDLAQSTAEYLKKNYGR* |
| Ga0137379_100678674 | 3300012209 | Vadose Zone Soil | ADGMGDIERILDRIGAGMATEAALREVLHSDYNDLMQSTAEYLKKTYR* |
| Ga0137377_101365664 | 3300012211 | Vadose Zone Soil | LDRIGAGMATEAALREVLHSDYNDLMQSTAEYLKKTYR* |
| Ga0137360_104865643 | 3300012361 | Vadose Zone Soil | QAGGMSDIERILDRIGAGMAAEVALKEVLHSDYNDLMQSTAEYLKKSYGH* |
| Ga0137360_111869612 | 3300012361 | Vadose Zone Soil | DINRILDRIGSGMSTEEALKEVLHSDYNDLMQSTAEYLKKTYGR* |
| Ga0137361_110575332 | 3300012362 | Vadose Zone Soil | ILDRIGSGMSTEEALKEVLHSDYNDLMQSTAEYLKKTYGR* |
| Ga0137390_110916831 | 3300012363 | Vadose Zone Soil | IAAGDSTESALREVLHSDYSDLMESTVQYLRKTYGN* |
| Ga0137396_101903711 | 3300012918 | Vadose Zone Soil | IGSGMSTEAALKEVLHSDYSDLMQSTAEYLKKTYGR* |
| Ga0137396_102027852 | 3300012918 | Vadose Zone Soil | ADGMGDIDRILDRIGSGMSTQAALKEVLHSDYDDLMQSTAEYLKKTYGR* |
| Ga0137396_103145111 | 3300012918 | Vadose Zone Soil | RPMGWATWNEILDRIGAGMATESAVREVLHSDYNDVMQSTAEYLRKTYGR* |
| Ga0137416_108371663 | 3300012927 | Vadose Zone Soil | RIGAGMATEAALREVLHSDYNDVMQSTAGYLRKTYGR* |
| Ga0137404_107202821 | 3300012929 | Vadose Zone Soil | LDRIGSGMSTEAALKEVLHSDYNDLMQSTAEYLRKTYGR* |
| Ga0137407_102276673 | 3300012930 | Vadose Zone Soil | ERILDRIGAGMATEAALKEVLHSDYDDLMRSTVDYLKKAYGR* |
| Ga0137407_104793761 | 3300012930 | Vadose Zone Soil | RILDRIGSGMSTEAALTEVLHSDYNDLMQSTAEYLKKTYGR* |
| Ga0181527_12232822 | 3300014153 | Bog | QTGGMGDIEKILDRIAAGRPTEEALREVLHSDYGDLMQGTVEYLKKSYVR* |
| Ga0134075_100278924 | 3300014154 | Grasslands Soil | VDIERILDRIGAGMPTETALREVLHSDYNDLMQSTADYLRKSYGR* |
| Ga0181524_102930111 | 3300014155 | Bog | KILDRIAAGRPTEEALREVLHSDYGDLMQGTVEYLKKSYVR* |
| Ga0181524_103020361 | 3300014155 | Bog | IAAGRPTEEALREVLHSDYGDLMQGTVEYLKKSYVR* |
| Ga0134072_100721212 | 3300015357 | Grasslands Soil | ILDRIGAGMATETALRDVLHSGYDDLMQSAAEYLRKTYAR* |
| Ga0187802_101314331 | 3300017822 | Freshwater Sediment | VQTDGMADVERILDRIGSGMATEAALREVLHSDYNDLMKSTAEYLQKTYGH |
| Ga0187819_101703951 | 3300017943 | Freshwater Sediment | IVQTDGMADVERILDRIGSGMATEAALREVLHSDYNDLMKSTAEYLQKTYGH |
| Ga0187778_108265212 | 3300017961 | Tropical Peatland | ETDGMGDIERILDRIAAGRSTEEALREVLHSDYGDLMQGTVEYLKKSYVR |
| Ga0187771_118929142 | 3300018088 | Tropical Peatland | DGLSTGTAPEQTLKEVLHVDYGDLMRSTAEYLRKSYGR |
| Ga0187770_115300552 | 3300018090 | Tropical Peatland | RIGEGMSTEAAVREVTRSDYNDLMQSTAEYLRKNYVR |
| Ga0193753_102534671 | 3300020034 | Soil | DGMGDVQRILDRIGSGTLPEVALREVLHSNYEDVMESTAQYLRKNYR |
| Ga0179590_11209162 | 3300020140 | Vadose Zone Soil | GAGSTAEAAVREVLHSDYDDLMQSTAQYLRKTYGN |
| Ga0187768_11606121 | 3300020150 | Tropical Peatland | MERILDRIGEGMSTEAAVREVTRSDYNDLMQSTAEYLRKTYGR |
| Ga0210403_111599521 | 3300020580 | Soil | RILDRLAAGSSTEAAAREVLHSDYADLMQSTAQYLRKTY |
| Ga0210399_101930523 | 3300020581 | Soil | AIAAGGTTEAAVKEVLHSDYDDLMQSTINYLRKTYGR |
| Ga0210399_107502281 | 3300020581 | Soil | EAIIQTNSMGDVERILDRIGSGSSTEEALREVLHSNYSDVMQSTAEYLRKNYVR |
| Ga0210399_114990032 | 3300020581 | Soil | IVETSGMGDIERILDRIGSGGSTEEALRAVLHSDYNDLMHSTAEYLHKTYGR |
| Ga0210408_109013312 | 3300021178 | Soil | DGMGDVERILNAIAAGSTTEAAVKEVLHGDYDDLMQSTINYLRKTYGR |
| Ga0210402_104520541 | 3300021478 | Soil | ERILDRIGTGMATEAALKEVLHSDYNDLMQSTAEYLKKTYGR |
| Ga0210402_109222352 | 3300021478 | Soil | MGDVERILDRIGSGMATEAAVKEVLHSDYNDLMQSTAEYLKKTYGH |
| Ga0210410_114065031 | 3300021479 | Soil | LDRIGSGSATEEALRAVLHSDYNDLMQSTAEYLRKTYGR |
| Ga0137417_15051341 | 3300024330 | Vadose Zone Soil | ACRWMGDVERILDRIGAGMTTEAALREVLHSDYNDVMQSTAEYLRATYGR |
| Ga0207700_119207922 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MERVLDHLREGMATEAALKTVLRDDYSDLMDSTAQYLRKTYAVH |
| Ga0209235_10715412 | 3300026296 | Grasslands Soil | ILDRIGAGMAVEVALKEVLHSDYNDLMQSTAEYLRKTYGR |
| Ga0209469_11415792 | 3300026307 | Soil | RTDGMDDIDRILERIGSGMAAERALREVLHSDYNDLMESTVEYLRKHNVHG |
| Ga0209804_12583842 | 3300026335 | Soil | IERILDRISAGMATEQALREVLHRDYNDLMESTAAYLRKNYAP |
| Ga0257149_10129761 | 3300026355 | Soil | GAGMTTEAALREVLHSDYNDVMQFTAQYLRATYGR |
| Ga0209059_12395182 | 3300026527 | Soil | DGMGDIERILDRISAGMATEQALREVLHSDYNDLMESTAAYLRKNYAH |
| Ga0179587_100004741 | 3300026557 | Vadose Zone Soil | MGDVERILDRIGAGMTTEAALREVLHSDYNDVMQSTAEYLRATYGR |
| Ga0209523_11305362 | 3300027548 | Forest Soil | DGMSDVERILDRIGAGMATEQALREVLHSDYGDLMESTVGFLRKNYVH |
| Ga0209248_101424522 | 3300027729 | Bog Forest Soil | NGMGDVERILDRIGSGTPPEDAVHEVLHSNYDEVMHATAEYLRKNYVR |
| Ga0209073_100538711 | 3300027765 | Agricultural Soil | DVERILDRIGAGMATEQALREVLHSDYSDLMGSTAAYLKKNYVH |
| Ga0209139_101667272 | 3300027795 | Bog Forest Soil | GDVERILDRIASGSSTEEALREVLHSNYSDVMQSTAEYLRKNYVR |
| Ga0209701_102961031 | 3300027862 | Vadose Zone Soil | RIGAGTAVEVALKEVLHSDYNDVMQSTAEYLRKTYGR |
| Ga0209283_105281701 | 3300027875 | Vadose Zone Soil | GDIERILDRIGAGMATEAALREVLHSDYDDLMESTAEYLKKTYLR |
| Ga0209283_106120471 | 3300027875 | Vadose Zone Soil | RILDRIGAGMAAEVALKEVLHSDYNDLMQSTAEYLRKTYGR |
| Ga0209068_104375141 | 3300027894 | Watersheds | RIGAGMATEQALKEVLRSDYNDVTQATAEYLRKTYGR |
| Ga0209488_100082631 | 3300027903 | Vadose Zone Soil | NRILDRIGSGMSTEAALKVVLHSDYNDLMQSTAEYLKKTYGR |
| Ga0302304_102152412 | 3300029993 | Palsa | TDIERILDRIGSGQPTEAALREVLHSDYADVSQSTDEFLRRTYVH |
| Ga0302181_103466941 | 3300030056 | Palsa | ERILNRIAAGDSTEAGLSEVLHSDYEDLMQSTVNYLRKTYIR |
| Ga0265763_10341951 | 3300030763 | Soil | RILEHISAGQPTEAALREVLHSDYADVSQSTNAFLLRNYVR |
| Ga0265770_11109831 | 3300030878 | Soil | VERILDRIGAGQPTESALREVLHSDYADVSQSTDEFLRKNYMH |
| Ga0265740_10465781 | 3300030940 | Soil | DRIGSGSSTEAALREVLHSDYNDLMQSTSEYLRKTYGH |
| Ga0073994_124299211 | 3300030991 | Soil | RIGAGMTTEAALREVLHSDYNDVMQSTAQYLRATYGR |
| Ga0318573_101696142 | 3300031564 | Soil | IGSGMATDQALREVLHSDYNDLMESTVEYLRKNYVHG |
| Ga0318560_100632041 | 3300031682 | Soil | DDIDRILERIGSGMATDQALREVLHSDYNDLMESTVEYLRKNYVHG |
| Ga0318526_103278461 | 3300031769 | Soil | ILDRIGSGMATEQALREVLHSDYNDLMESTVEFLKKHYMHG |
| Ga0318557_101018202 | 3300031795 | Soil | GMDDIDRILERIGSGMATDQALREVLHSDYNDLMESTVEYLRKSYVHG |
| Ga0306926_113794731 | 3300031954 | Soil | DRLASGAPTEAAVHEVLHSDYQDLMKDTTNYLRKTYGR |
| Ga0307479_103272772 | 3300031962 | Hardwood Forest Soil | SDIERILDRIGAGMATEAALREVLHSDYNDLMQSTAEYLQKTYGR |
| Ga0307479_105585552 | 3300031962 | Hardwood Forest Soil | TDVERILDRLAVGSTTEAAAREVLHSDYADLMQSTAKYLRKTY |
| Ga0310911_106111421 | 3300032035 | Soil | GSGMATEQALREVLHSDYNDLMESTVEFLKKHYMHG |
| Ga0306924_110071161 | 3300032076 | Soil | RILDRIGSGMATEQALREVLHSDYNDLMESTVEFLKKHYMHG |
| Ga0307471_1005486793 | 3300032180 | Hardwood Forest Soil | DGMGDIERILDRIGAGESTESALRAVLHSDYNDVMQSTAEFLKKTYVR |
| Ga0335082_107741792 | 3300032782 | Soil | LDAIGAGQSAEAALRSVMRDDYNDLMQTTAEYLKKNYVR |
| Ga0335071_102345134 | 3300032897 | Soil | LDRLAAGSSTEQALRDVLHDDYSDLMQSTADYLKKNYGH |
| Ga0335076_104614461 | 3300032955 | Soil | AGGESAEAALRDVLHSDYNDLMQSTAEYLRKTYGH |
| ⦗Top⦘ |