| Basic Information | |
|---|---|
| Family ID | F063862 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MILPAVRERLESVLRHPSMEGALAALRSGGNHISISGLHDVAKAL |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.38 % |
| % of genes near scaffold ends (potentially truncated) | 97.67 % |
| % of genes from short scaffolds (< 2000 bps) | 87.60 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.039 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.705 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.132 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.140 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.84% β-sheet: 0.00% Coil/Unstructured: 56.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF01467 | CTP_transf_like | 81.40 |
| PF12697 | Abhydrolase_6 | 5.43 |
| PF12146 | Hydrolase_4 | 1.55 |
| PF00664 | ABC_membrane | 0.78 |
| PF13340 | DUF4096 | 0.78 |
| PF01381 | HTH_3 | 0.78 |
| PF02371 | Transposase_20 | 0.78 |
| PF04299 | FMN_bind_2 | 0.78 |
| PF13450 | NAD_binding_8 | 0.78 |
| PF03486 | HI0933_like | 0.78 |
| PF13579 | Glyco_trans_4_4 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 1.55 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.55 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 0.78 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 0.78 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.78 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 0.78 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 0.78 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.78 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 0.78 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 0.78 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.04 % |
| Unclassified | root | N/A | 44.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001167|JGI12673J13574_1011937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300001593|JGI12635J15846_10485160 | Not Available | 731 | Open in IMG/M |
| 3300001661|JGI12053J15887_10247655 | Not Available | 887 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101721848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300004080|Ga0062385_10723645 | Not Available | 644 | Open in IMG/M |
| 3300004092|Ga0062389_100495072 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300004100|Ga0058904_1345481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300004635|Ga0062388_100001196 | All Organisms → cellular organisms → Bacteria | 10763 | Open in IMG/M |
| 3300005167|Ga0066672_10077862 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300005177|Ga0066690_10480327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300005178|Ga0066688_10017577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3710 | Open in IMG/M |
| 3300005179|Ga0066684_10262073 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300005181|Ga0066678_10005650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5704 | Open in IMG/M |
| 3300005434|Ga0070709_10187423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
| 3300005445|Ga0070708_100154718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2134 | Open in IMG/M |
| 3300005950|Ga0066787_10088727 | Not Available | 645 | Open in IMG/M |
| 3300006102|Ga0075015_100826039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300006176|Ga0070765_101833542 | Not Available | 569 | Open in IMG/M |
| 3300006797|Ga0066659_11080500 | Not Available | 670 | Open in IMG/M |
| 3300007255|Ga0099791_10445184 | Not Available | 626 | Open in IMG/M |
| 3300007255|Ga0099791_10518471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300007265|Ga0099794_10753231 | Not Available | 520 | Open in IMG/M |
| 3300009088|Ga0099830_10226582 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300009088|Ga0099830_11429144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300009090|Ga0099827_10521666 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300009143|Ga0099792_10870348 | Not Available | 595 | Open in IMG/M |
| 3300009525|Ga0116220_10409007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300009662|Ga0105856_1345089 | Not Available | 509 | Open in IMG/M |
| 3300010046|Ga0126384_10756538 | Not Available | 866 | Open in IMG/M |
| 3300010159|Ga0099796_10006471 | All Organisms → cellular organisms → Bacteria | 3000 | Open in IMG/M |
| 3300010322|Ga0134084_10062785 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300010359|Ga0126376_10146771 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300010361|Ga0126378_10678577 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300010361|Ga0126378_10949423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300010375|Ga0105239_13125116 | Not Available | 539 | Open in IMG/M |
| 3300010376|Ga0126381_102617112 | Not Available | 722 | Open in IMG/M |
| 3300010401|Ga0134121_10070511 | All Organisms → cellular organisms → Bacteria | 2891 | Open in IMG/M |
| 3300011120|Ga0150983_14003540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300011269|Ga0137392_10203718 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300011269|Ga0137392_11171545 | Not Available | 626 | Open in IMG/M |
| 3300012096|Ga0137389_10806599 | Not Available | 806 | Open in IMG/M |
| 3300012096|Ga0137389_10843438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300012189|Ga0137388_10686012 | Not Available | 951 | Open in IMG/M |
| 3300012189|Ga0137388_10826786 | Not Available | 858 | Open in IMG/M |
| 3300012200|Ga0137382_10960450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300012203|Ga0137399_11122161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300012207|Ga0137381_10884062 | Not Available | 773 | Open in IMG/M |
| 3300012362|Ga0137361_10331761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
| 3300012363|Ga0137390_11497169 | Not Available | 616 | Open in IMG/M |
| 3300012363|Ga0137390_11589276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300012917|Ga0137395_10450855 | Not Available | 924 | Open in IMG/M |
| 3300012923|Ga0137359_10853919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300014150|Ga0134081_10335954 | Not Available | 551 | Open in IMG/M |
| 3300014166|Ga0134079_10032781 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300015359|Ga0134085_10589780 | Not Available | 516 | Open in IMG/M |
| 3300017823|Ga0187818_10021391 | All Organisms → cellular organisms → Bacteria | 2770 | Open in IMG/M |
| 3300017955|Ga0187817_10877438 | Not Available | 574 | Open in IMG/M |
| 3300017994|Ga0187822_10064374 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300020199|Ga0179592_10430710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300020579|Ga0210407_10378294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300020579|Ga0210407_11155643 | Not Available | 584 | Open in IMG/M |
| 3300020581|Ga0210399_10421964 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300020581|Ga0210399_11173946 | Not Available | 611 | Open in IMG/M |
| 3300021170|Ga0210400_11668648 | Not Available | 502 | Open in IMG/M |
| 3300021171|Ga0210405_10707996 | Not Available | 777 | Open in IMG/M |
| 3300021178|Ga0210408_11427707 | Not Available | 520 | Open in IMG/M |
| 3300021180|Ga0210396_10643862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300021403|Ga0210397_11398852 | Not Available | 543 | Open in IMG/M |
| 3300021420|Ga0210394_11791930 | Not Available | 512 | Open in IMG/M |
| 3300021433|Ga0210391_10797352 | Not Available | 738 | Open in IMG/M |
| 3300021474|Ga0210390_10565754 | Not Available | 955 | Open in IMG/M |
| 3300021479|Ga0210410_10273479 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300021559|Ga0210409_10925144 | Not Available | 746 | Open in IMG/M |
| 3300021560|Ga0126371_13326232 | Not Available | 543 | Open in IMG/M |
| 3300024330|Ga0137417_1260361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1180 | Open in IMG/M |
| 3300026214|Ga0209838_1042390 | Not Available | 663 | Open in IMG/M |
| 3300026304|Ga0209240_1091037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300026310|Ga0209239_1372179 | Not Available | 502 | Open in IMG/M |
| 3300026328|Ga0209802_1026950 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300026342|Ga0209057_1086821 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300026515|Ga0257158_1130828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300026550|Ga0209474_10012851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6686 | Open in IMG/M |
| 3300026551|Ga0209648_10054578 | All Organisms → cellular organisms → Bacteria | 3407 | Open in IMG/M |
| 3300026551|Ga0209648_10055290 | All Organisms → cellular organisms → Bacteria | 3384 | Open in IMG/M |
| 3300026551|Ga0209648_10381772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300026551|Ga0209648_10411172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300026552|Ga0209577_10192529 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300027652|Ga0209007_1171558 | Not Available | 535 | Open in IMG/M |
| 3300027660|Ga0209736_1095138 | Not Available | 813 | Open in IMG/M |
| 3300027701|Ga0209447_10089827 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300027727|Ga0209328_10055176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300027727|Ga0209328_10239464 | Not Available | 543 | Open in IMG/M |
| 3300027738|Ga0208989_10211561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300027765|Ga0209073_10141920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
| 3300027795|Ga0209139_10082246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300027821|Ga0209811_10279293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 641 | Open in IMG/M |
| 3300027842|Ga0209580_10500111 | Not Available | 605 | Open in IMG/M |
| 3300027853|Ga0209274_10290503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300027862|Ga0209701_10253493 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300027862|Ga0209701_10425721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300027862|Ga0209701_10609805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300027867|Ga0209167_10170405 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300027875|Ga0209283_10879004 | Not Available | 544 | Open in IMG/M |
| 3300027884|Ga0209275_10136568 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300027894|Ga0209068_10218752 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300027908|Ga0209006_10463973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300028906|Ga0308309_11557960 | Not Available | 563 | Open in IMG/M |
| 3300030490|Ga0302184_10365212 | Not Available | 567 | Open in IMG/M |
| 3300030617|Ga0311356_11105498 | Not Available | 734 | Open in IMG/M |
| 3300030763|Ga0265763_1041055 | Not Available | 557 | Open in IMG/M |
| 3300031128|Ga0170823_14605792 | Not Available | 757 | Open in IMG/M |
| 3300031128|Ga0170823_15865764 | Not Available | 781 | Open in IMG/M |
| 3300031231|Ga0170824_114058772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300031718|Ga0307474_10582615 | Not Available | 881 | Open in IMG/M |
| 3300031720|Ga0307469_11303754 | Not Available | 690 | Open in IMG/M |
| 3300031740|Ga0307468_100243791 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300031740|Ga0307468_101290304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300031753|Ga0307477_10412839 | Not Available | 924 | Open in IMG/M |
| 3300031754|Ga0307475_10020631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4621 | Open in IMG/M |
| 3300031820|Ga0307473_10966808 | Not Available | 619 | Open in IMG/M |
| 3300031823|Ga0307478_10841068 | Not Available | 768 | Open in IMG/M |
| 3300031954|Ga0306926_11227999 | Not Available | 879 | Open in IMG/M |
| 3300032060|Ga0318505_10377012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300032067|Ga0318524_10409349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300033405|Ga0326727_10142778 | Not Available | 2870 | Open in IMG/M |
| 3300033547|Ga0316212_1023627 | Not Available | 861 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.10% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.33% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12673J13574_10119372 | 3300001167 | Forest Soil | MILPAVRERLEAVLRHAAMEGALAALRSGASHISITGLHDVAKALVASYLTRE |
| JGI12635J15846_104851601 | 3300001593 | Forest Soil | MILPAVRERLDAVLRQPAVEGALAALRTGANQVAFSGL |
| JGI12053J15887_102476552 | 3300001661 | Forest Soil | MILPAVRERLDAVLRQPAVEDALAALRSGANQVAFSGLHDVAKALVAAYLTHT |
| JGIcombinedJ26739_1017218481 | 3300002245 | Forest Soil | MILPAVRERLEAVLRHAAMEGALAALRSGASHISITGLHDVAKALVASYLT |
| Ga0062385_107236452 | 3300004080 | Bog Forest Soil | MILPAVRERLESVLRHPSMESALAALRAGGNHISVSGLHDV |
| Ga0062389_1004950723 | 3300004092 | Bog Forest Soil | MILPAVRERLDAVLRHPAVEGAVGALRDGAQHISLSGLHDVAKALL |
| Ga0058904_13454812 | 3300004100 | Forest Soil | MILPAVRERLEALLRHPAMEGALASLRTGGNFLSITGLHDVAKA |
| Ga0062388_1000011961 | 3300004635 | Bog Forest Soil | MILPAVRERLESLLRLPSVEGTLAELRQNSNFVSLSGLHDV |
| Ga0066672_100778623 | 3300005167 | Soil | MILPAVRERLEALLRHRSMEGALAELRANASLVSITGLHDV |
| Ga0066690_104803271 | 3300005177 | Soil | MILPAVRERLEAVLRHAAMEGALAALRSGASHISITGLHD |
| Ga0066688_100175774 | 3300005178 | Soil | MILPAARERLEALLRHPSMEGALGELRANAGVVSITGLHDVAKALVAVYL |
| Ga0066684_102620733 | 3300005179 | Soil | MILPAVRERLEALLRHAAMEGALAALRSGANHISITGLHDVA |
| Ga0066678_100056501 | 3300005181 | Soil | MILPAARERLEALLRHPSMEGALGELRANAGVVSITGLHDVAKALVAVY |
| Ga0070709_101874233 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MILPAVRERLESVLRHPSWEGALAALRANGNLIALSGLHDVAKALV |
| Ga0070708_1001547183 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MILPAVRERLETVLRHPSMDGAIAALRSGGQYASLAGLHDVAKALVA |
| Ga0066787_100887272 | 3300005950 | Soil | MILPAVRERLEAVLHQPAVEGALAALRSGANQVALSGLHD |
| Ga0075015_1008260392 | 3300006102 | Watersheds | MILPAVRERLEAVLRQPAMEGTLAALRAGATHVSLAGLHDVAKALVAAY |
| Ga0070765_1018335421 | 3300006176 | Soil | MILPAVRERLESVLRHPSMESALAALRAGGNHISLSGLHDVAKAL |
| Ga0066659_110805001 | 3300006797 | Soil | MILPAVRERLEAVLRHAAMEGALAALRSGASHISITGLHDVAKALVASYL |
| Ga0099791_104451842 | 3300007255 | Vadose Zone Soil | MILPAVRERLESVLRHPSMEAALAALRAGGQVVSISGL |
| Ga0099791_105184711 | 3300007255 | Vadose Zone Soil | MILPAARERLEALLRHAAMEGALAALRSGASHISITGL |
| Ga0099794_107532312 | 3300007265 | Vadose Zone Soil | MILPAVRERLEAVLRHAAMEGALASLRSGASHISITGLHDVA |
| Ga0099830_102265823 | 3300009088 | Vadose Zone Soil | MILPAVRERLEAVLRHASMDGALAALSSGANHVSITGLHDVAKALVAAYL |
| Ga0099830_114291441 | 3300009088 | Vadose Zone Soil | MILPAVRERLEAVLRHAAMDGALAALRSGATHISV |
| Ga0099827_105216661 | 3300009090 | Vadose Zone Soil | MILPAVRERLESVLRHPSMEAALAALRAGGQLVSISG |
| Ga0099792_108703482 | 3300009143 | Vadose Zone Soil | MILPAVRERLETVLRHPSMDGAIAALRSGGQHVSLAGLHDVAKALVAAYIAH |
| Ga0116220_104090072 | 3300009525 | Peatlands Soil | MILPAVRERLEAVLRHAAMDGALAALRSGASHVSLTGLHDVAKALVAAYLSR |
| Ga0105856_13450891 | 3300009662 | Permafrost Soil | MILPAVRERLESVLRHPSLESALAALRSGGNHISLSGLQDIAKALVAA |
| Ga0126384_107565381 | 3300010046 | Tropical Forest Soil | MILPAVRERLESVLRHPSLDGALAELRGGANHISLSGLHDVAKALVVAH |
| Ga0099796_100064717 | 3300010159 | Vadose Zone Soil | MILPAVRERLDAVLRHAAMEGALAALRSGASHISLTGL |
| Ga0134084_100627853 | 3300010322 | Grasslands Soil | MILPAVRERLEALLRHAAMQGALAALRSGANHISITGLH |
| Ga0126376_101467713 | 3300010359 | Tropical Forest Soil | MIQAAVRERWERVLRHPSMEGAIAALRSGEQHISVSGLHD |
| Ga0126378_106785771 | 3300010361 | Tropical Forest Soil | MILPAVRERLEGLLRHPSMDGALAELRANAGLVSITG |
| Ga0126378_109494231 | 3300010361 | Tropical Forest Soil | MILPAVRERLEALLRHPSMEGALAELRANAGLVSITGLHDV |
| Ga0105239_131251162 | 3300010375 | Corn Rhizosphere | MILPAVRERLESVLRHPSLEGALAALRAGGHHVALSGLHDVAKALV |
| Ga0126381_1026171122 | 3300010376 | Tropical Forest Soil | MILPAVRERLEAVLRHPAMDGALAVLRSGGNRAALSGLHDVAKALVAAYVA |
| Ga0134121_100705111 | 3300010401 | Terrestrial Soil | MILPAVRERLESVLRHPSLEGALAALRAGGHHVALSGLHDVAKALVATYLV |
| Ga0150983_140035402 | 3300011120 | Forest Soil | MILPAVRERLEAVLRHAAMEGALAALRAGASHVSL |
| Ga0137392_102037181 | 3300011269 | Vadose Zone Soil | MILPAVRERLEPVIRHPGMEGALAALRSGGQHVSLAGLHD |
| Ga0137392_111715452 | 3300011269 | Vadose Zone Soil | MILPAVRERLETVLRHPSMDGAIAALRAGGQHVSLAGL |
| Ga0137389_108065992 | 3300012096 | Vadose Zone Soil | MILTAVRERVEALLRHAALQGALAALRSGAGEISLGGLHDVAKAFVAAYLT |
| Ga0137389_108434383 | 3300012096 | Vadose Zone Soil | LEAILRHEAMDGALAALRSGASHVSLTGLHDVAKALVAA |
| Ga0137388_106860123 | 3300012189 | Vadose Zone Soil | MILPAVRERLESVLRHPSLEGALAALRTGGNHISL |
| Ga0137388_108267861 | 3300012189 | Vadose Zone Soil | MILPAVRERLESVLRHPSMDGAIAALRAGGQHISLA |
| Ga0137382_109604501 | 3300012200 | Vadose Zone Soil | MILPAVRERLEAVLRHEAMEGALAALRSGSSHISI |
| Ga0137399_111221611 | 3300012203 | Vadose Zone Soil | MILPAVRERLEAVLRHAAMEGALAALRAGASHISITGLHD |
| Ga0137381_108840623 | 3300012207 | Vadose Zone Soil | MILPTVRERLEGVLRQPALEQALDALRGGAPDVSVSGLHDVAKALV |
| Ga0137361_103317611 | 3300012362 | Vadose Zone Soil | MILPAVRERLENLLRQPSVEGAIAALRSGRQHISL |
| Ga0137390_114971691 | 3300012363 | Vadose Zone Soil | MILPAVRERLESVLRHPSMEAALAALRAGGQVVSISGLHDVAKALVAAYVTHE |
| Ga0137390_115892762 | 3300012363 | Vadose Zone Soil | MILPAVRERLEAVLRHAAMEGALAALRSGASHISIT |
| Ga0137395_104508552 | 3300012917 | Vadose Zone Soil | MILPAVRERLDAVLRQPAVEGALAALRTGANQVAFSGLHDVA |
| Ga0137359_108539191 | 3300012923 | Vadose Zone Soil | MILPAVRERLEAVLRHEAMEGALAALRSGASHVSITGL |
| Ga0134081_103359541 | 3300014150 | Grasslands Soil | MILPAVRERLEAVLRHEAMEGALAALRSGSSHISITGL |
| Ga0134079_100327813 | 3300014166 | Grasslands Soil | MILPAVRDRLESLLRQPSVEGALAELRANAGLVSITGLHDVAKALVAVYLTHA |
| Ga0134085_105897802 | 3300015359 | Grasslands Soil | MILPTVRERLEGVLRQPALEQALDALRGGAPDVSVSGLHDVAKALVA |
| Ga0187818_100213914 | 3300017823 | Freshwater Sediment | MILPAVRERLDALLRHPAIEGTLAALRGGANHVSLAGLHD |
| Ga0187817_108774382 | 3300017955 | Freshwater Sediment | MILPAVRERLDALLRHPGIEGALAALRGGANHVSLAGLHDVAKSL |
| Ga0187822_100643741 | 3300017994 | Freshwater Sediment | MILPAVRERLEAVLRHPAVEGALGVLRDGARHISLSGLHHVAKA |
| Ga0179592_104307101 | 3300020199 | Vadose Zone Soil | MILPAARERLEALLRHAAMEGALAALRSGASHISITGLHDVAKALVAAY |
| Ga0210407_103782943 | 3300020579 | Soil | MILPAVRERLEALLRQAALQGALAALRSGANHVSITGLHDVAKALL |
| Ga0210407_111556432 | 3300020579 | Soil | MILPAVRERLDAVLRHPSLEGALGALRDGAQHVSLSGLHDVAK |
| Ga0210399_104219643 | 3300020581 | Soil | MILPAVRERLEAVLRHPAMEGALAALRSGAQHISL |
| Ga0210399_111739461 | 3300020581 | Soil | MILPAVRERLEAVLRHAAMDGALAALRSGASHVSFTGLH |
| Ga0210400_116686481 | 3300021170 | Soil | MILPAVRERLESVLRHPAMESALAALQAGGNHISV |
| Ga0210405_107079962 | 3300021171 | Soil | MILPAVRERLESVLRHPSMDGAIAALRAGGQHISLAGLQDVAKALVAAYIAHELR |
| Ga0210408_114277071 | 3300021178 | Soil | MILPAVRERLETVLRHPSMEGAIAALRAGGQYVSLAGLHDVA |
| Ga0210396_106438621 | 3300021180 | Soil | MILPAVRERLESVLRHPAMESALAALQAGGNHISVSGLHDVAKA |
| Ga0210397_113988522 | 3300021403 | Soil | MILPAVRERLESVLRHPSLEGALAALRAGRNHIALSGLHDVAKALVATYL |
| Ga0210394_117919301 | 3300021420 | Soil | MIFPVVRERLEPVLRHPSLTAALTELRAGASHVSLSGLHDVAK |
| Ga0210391_107973521 | 3300021433 | Soil | MILPAVRERLDAVLRHPSVEGALGALRAGAQHISLS |
| Ga0210390_105657543 | 3300021474 | Soil | MILPAVRERLDAVLRHRSVEGALGALRDGAQHISLSGLHDV |
| Ga0210410_102734793 | 3300021479 | Soil | MILPAVRERLDAVLRHPSVEGALGALRDGAQHISLSGLHDVAKALLAAYL |
| Ga0210409_109251441 | 3300021559 | Soil | MILPAVRERLESVLRHRSMESALAALRAGGNHISVSGLHDVAKAL |
| Ga0126371_133262322 | 3300021560 | Tropical Forest Soil | MILPAVRERLEAVLRHPGMDGALAALRSRGNRVALSGLH |
| Ga0137417_12603613 | 3300024330 | Vadose Zone Soil | MILPAVRERLEALLRHAAMEGALAALRSGASHISITGLHDVA |
| Ga0209838_10423901 | 3300026214 | Soil | MILPAVRERLEAILHQPAVEDALAVLRSGANQVALSGLHDVAKALLA |
| Ga0209240_10910373 | 3300026304 | Grasslands Soil | MILPAVRERLETVLRHPSMDGAIAALRAGGQHVSLAGLHDVA |
| Ga0209239_13721791 | 3300026310 | Grasslands Soil | MILPAVRERLESLLRHPSVEGALAELRANAGLVSITGLHDV |
| Ga0209802_10269501 | 3300026328 | Soil | MILPAVRERLEALLRHAAMEGALAALRSGANHISITGLHDV |
| Ga0209057_10868211 | 3300026342 | Soil | MILPAVRERLEALLRHAAMEGALAALRSGANHISITGLHDVAKALVAAYLTH |
| Ga0257158_11308281 | 3300026515 | Soil | MILPAVRERLEAVLRHPAMEGALAALRSGASHISI |
| Ga0209474_100128516 | 3300026550 | Soil | MILPAVRERLESLLRQPSVEGALAELRANAGLVSITGLHD |
| Ga0209648_100545781 | 3300026551 | Grasslands Soil | MILPAVRERLEALLRHAAMEGALAALRSGASHISISGLHDVAKALVASYLTREL |
| Ga0209648_100552901 | 3300026551 | Grasslands Soil | MILPAVRERLEAVLRHAAMEGALAALRSGASHISI |
| Ga0209648_103817722 | 3300026551 | Grasslands Soil | MILPAVPERLEAVLRHAAMEGALAALRSGASHVAITGLHDVAKA |
| Ga0209648_104111721 | 3300026551 | Grasslands Soil | MILPAVRERLEAVLRHVAMEGALAALRSGVSHISITGLHDVAKAIVAAYL |
| Ga0209577_101925294 | 3300026552 | Soil | MILPAVRERLGALLRHAAMEGALAALRSGANHISITGLHDVAKA |
| Ga0209007_11715582 | 3300027652 | Forest Soil | MILPAVQERLESVLRHPSMEGALAALRPGGNHISVSGLHDVAKAL |
| Ga0209736_10951381 | 3300027660 | Forest Soil | MILPAVRERLESVLRHPSLEGALAALRTGGQHVSLAGLHDVAKALVAAYLTH |
| Ga0209447_100898271 | 3300027701 | Bog Forest Soil | MIFPVVRERLEPVLGHPSVHAALAELRGGANHVSLSGLHDVAKAL |
| Ga0209328_100551761 | 3300027727 | Forest Soil | MILPAVRERLDAVLRQPAVEGALAALRSGANQVAFSGLHDVAKALV |
| Ga0209328_102394642 | 3300027727 | Forest Soil | MILPAVRERLESVLRHPSMEAALAALRAGGQLVSISGLHDVAKALVA |
| Ga0208989_102115612 | 3300027738 | Forest Soil | MILPAVRERLEALLRHEAMEGAVAALRGGAAHVSVA |
| Ga0209073_101419201 | 3300027765 | Agricultural Soil | MILPAVRERLEGLLRHPSMEGALAELRANAGLVSVTGLHD |
| Ga0209139_100822461 | 3300027795 | Bog Forest Soil | MILPAVRERLESVLRHPSMESALAALRAGGNHISVSGL |
| Ga0209811_102792931 | 3300027821 | Surface Soil | MILPAVRERLDAVLRHPAVEGALGALRDGAQHISLSGLHDVAKAL |
| Ga0209580_105001112 | 3300027842 | Surface Soil | MILPAVRERLESVLRHPSMEAALAALRAGGQLVSISGLHD |
| Ga0209274_102905031 | 3300027853 | Soil | MILPAVRERLDAVLRHPSVEGALGALRDGAQHISLSGLHDVAKALIAAYLTH |
| Ga0209517_104315962 | 3300027854 | Peatlands Soil | MILPAVRERLEGLLRHASIEGVVAELRAGGGLAGLSG |
| Ga0209701_102534931 | 3300027862 | Vadose Zone Soil | MILPAVRERLEAVLRHAAMEGALAALRSGASHISITGLHDVAKALVASY |
| Ga0209701_104257212 | 3300027862 | Vadose Zone Soil | MILPAVRERLEAVLRHAAMEGALAALRSGASHISITGLHDVAKALV |
| Ga0209701_106098051 | 3300027862 | Vadose Zone Soil | MILPAVRERLEALLRHAAMEGALASLRSGASHISITGLHDVAK |
| Ga0209167_101704053 | 3300027867 | Surface Soil | MILPAVRERLESILRHPSMEAALAALRSGNNHISLAG |
| Ga0209283_108790041 | 3300027875 | Vadose Zone Soil | MILPAVRERLEAVLRHAAMEGALAALRSGASHISITRLHDVA |
| Ga0209275_101365681 | 3300027884 | Soil | MILPAVRERLESILRHPSMDGALATLRSGANHISLAGLHDVAKSLVTAYITHE |
| Ga0209068_102187523 | 3300027894 | Watersheds | MILPAVRERLESVLRHPSLDGALGALRAGGNHVAISGLHDVAKA |
| Ga0209006_104639731 | 3300027908 | Forest Soil | MILPAVRERLESILRHPSMDAALAALRSGANHVSPTGLHDVAKA |
| Ga0308309_115579601 | 3300028906 | Soil | MILPAVRERLESILRHPSMESALAALRSGNNHISLAG |
| Ga0302184_103652121 | 3300030490 | Palsa | MIFPVVRERLEPVLRLPAVDGALAELRGGGNQVSLSGLHDVAKCLVV |
| Ga0311356_111054982 | 3300030617 | Palsa | MIFPVVRERLEPVLRLPAVDGALAELRGGGNQVSLS |
| Ga0265763_10410552 | 3300030763 | Soil | MILPAVRERLDAVLRHPSVEGALGALRDGAQHISLS |
| Ga0170823_146057921 | 3300031128 | Forest Soil | MILPAVRERLDAVLRQPAVEGALAALRSGANQVTFSGLHDVAKAL |
| Ga0170823_158657641 | 3300031128 | Forest Soil | MILPAVHERLDAVLRQPAVEGALAALRTGANQVAFSGLHDVAKALVAAYATHAL |
| Ga0170824_1140587722 | 3300031231 | Forest Soil | MILPAVRERLDAVLRHPSVDGALGALRDGAQHISLSGLHDVA |
| Ga0307474_105826153 | 3300031718 | Hardwood Forest Soil | MILPAVRERLESVLRHPSMEGALAALRSGGNHISISGLHDVAKAL |
| Ga0307469_113037542 | 3300031720 | Hardwood Forest Soil | MILPAVRERLESVLRHPSWEGALAALRANGNLIALSGLHDVAKALVATYL |
| Ga0307468_1002437911 | 3300031740 | Hardwood Forest Soil | MILPAVRERLDAVLRHPSVEGAVGALRDGAQHISLSGLHDVAKALLAVYLTHEL |
| Ga0307468_1012903041 | 3300031740 | Hardwood Forest Soil | MILPAVRERLEALLRHEAMESALAALRGGAVHVSVAGL |
| Ga0307477_104128393 | 3300031753 | Hardwood Forest Soil | MILPAVRERLESVLRHPAMESALAALQAGGNHISVSGLHNVAK |
| Ga0307475_100206315 | 3300031754 | Hardwood Forest Soil | MILPAVRERLDAVLRQPAVESALATLRTGVNQLAFSG |
| Ga0318557_103294841 | 3300031795 | Soil | MILPAVRERLEGLLRHPSLEGVVGELRAGGSLVGLS |
| Ga0307473_109668081 | 3300031820 | Hardwood Forest Soil | MILPAVRERLESVLRHPSMEAALAALRSGGQLVSISG |
| Ga0307478_108410681 | 3300031823 | Hardwood Forest Soil | MILPAVRERLETVLRHPSMEGAIAALRAGGQHVSLAGLHDVAKAL |
| Ga0306926_112279991 | 3300031954 | Soil | MILPAVRERLEAVLRHPAVEGAVGALRSERHHLALTGLHDVAKALVAAYIS |
| Ga0318505_103770121 | 3300032060 | Soil | MILPAARERLEALLRHRSMEGALAELRANAAVVSITGLHDVAK |
| Ga0318524_104093491 | 3300032067 | Soil | MILPAARERLEALLRHRSMEGALAELRANAAVVSITGLHDVA |
| Ga0311301_110877802 | 3300032160 | Peatlands Soil | MILPAVRERLEGLLRHASIEGVVAELRAGGGLAGLS |
| Ga0326727_101427781 | 3300033405 | Peat Soil | VILPAVRERLENLLRHPSLEGALAELRVGGSQIGLAGLQDVAK |
| Ga0316212_10236271 | 3300033547 | Roots | MIFPVVRERLEPVLSHPALHGALAELRAGGNHVSLSGLHDVAKA |
| ⦗Top⦘ |