NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063836

Metagenome / Metatranscriptome Family F063836

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063836
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 71 residues
Representative Sequence MSLKKYNNFVSEEIDDFYKDLENSNRKLKLFSTFTKSTLGEVKTSFSLPEPKKRFQPKVKGYKKINNDKGIF
Number of Associated Samples 89
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 31.01 %
% of genes from short scaffolds (< 2000 bps) 65.12 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.822 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(41.861 % of family members)
Environment Ontology (ENVO) Unclassified
(72.868 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(66.667 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 6.00%    Coil/Unstructured: 69.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF04851ResIII 24.03
PF00166Cpn10 9.30
PF08804gp32 1.55
PF01391Collagen 0.78
PF00383dCMP_cyt_deam_1 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 9.30

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.25 %
UnclassifiedrootN/A7.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10078996All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1151Open in IMG/M
3300000127|SA_S1_NOR05_45mDRAFT_c10056758All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium980Open in IMG/M
3300001450|JGI24006J15134_10006741All Organisms → cellular organisms → Bacteria5874Open in IMG/M
3300001450|JGI24006J15134_10010750All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium4499Open in IMG/M
3300001450|JGI24006J15134_10011094All Organisms → cellular organisms → Bacteria4417Open in IMG/M
3300001460|JGI24003J15210_10015046All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3040Open in IMG/M
3300001460|JGI24003J15210_10022795All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2364Open in IMG/M
3300001460|JGI24003J15210_10033693All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1844Open in IMG/M
3300001460|JGI24003J15210_10038602All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1678Open in IMG/M
3300001460|JGI24003J15210_10043765All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1533Open in IMG/M
3300001472|JGI24004J15324_10020083All Organisms → Viruses → Predicted Viral2274Open in IMG/M
3300001589|JGI24005J15628_10009968All Organisms → cellular organisms → Bacteria4398Open in IMG/M
3300002482|JGI25127J35165_1080022All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium673Open in IMG/M
3300004097|Ga0055584_100749890All Organisms → Viruses → Predicted Viral1021Open in IMG/M
3300004448|Ga0065861_1001883All Organisms → cellular organisms → Bacteria55394Open in IMG/M
3300005913|Ga0075108_10030986All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2054Open in IMG/M
3300006193|Ga0075445_10011842All Organisms → Viruses → Predicted Viral3879Open in IMG/M
3300006399|Ga0075495_1075787All Organisms → Viruses → Predicted Viral2322Open in IMG/M
3300006749|Ga0098042_1161758All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium545Open in IMG/M
3300006750|Ga0098058_1086940All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium853Open in IMG/M
3300006752|Ga0098048_1065667All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1124Open in IMG/M
3300007074|Ga0075110_1108314All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium575Open in IMG/M
3300007516|Ga0105050_10011904All Organisms → cellular organisms → Bacteria9199Open in IMG/M
3300008470|Ga0115371_10405243All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium614Open in IMG/M
3300008470|Ga0115371_10642419All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium614Open in IMG/M
3300008470|Ga0115371_10730685All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1139Open in IMG/M
3300008470|Ga0115371_11066756All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2039Open in IMG/M
3300009149|Ga0114918_10146007All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1416Open in IMG/M
3300009172|Ga0114995_10017095All Organisms → cellular organisms → Bacteria4391Open in IMG/M
3300009173|Ga0114996_10234147All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300009173|Ga0114996_10455637All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300009420|Ga0114994_10004016All Organisms → cellular organisms → Bacteria10702Open in IMG/M
3300009420|Ga0114994_10179019All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1431Open in IMG/M
3300009420|Ga0114994_10207131All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300009420|Ga0114994_10304221All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300009432|Ga0115005_10063229All Organisms → cellular organisms → Bacteria2831Open in IMG/M
3300009435|Ga0115546_1081319All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1197Open in IMG/M
3300009497|Ga0115569_10228165All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium846Open in IMG/M
3300009512|Ga0115003_10146946All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1433Open in IMG/M
3300009550|Ga0115013_10001944All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium11687Open in IMG/M
3300009705|Ga0115000_10725655All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium613Open in IMG/M
3300009786|Ga0114999_10508346All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium929Open in IMG/M
3300010392|Ga0118731_102079503Not Available800Open in IMG/M
3300010392|Ga0118731_102082420Not Available800Open in IMG/M
3300010430|Ga0118733_103998358Not Available792Open in IMG/M
3300010430|Ga0118733_103998361Not Available792Open in IMG/M
3300010883|Ga0133547_10700385All Organisms → cellular organisms → Bacteria2006Open in IMG/M
3300010883|Ga0133547_11135742All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1499Open in IMG/M
3300012413|Ga0138258_1543175All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium559Open in IMG/M
3300012416|Ga0138259_1373439All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium603Open in IMG/M
3300012920|Ga0160423_10190500All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1431Open in IMG/M
3300012928|Ga0163110_11781935Not Available502Open in IMG/M
3300017714|Ga0181412_1003434All Organisms → cellular organisms → Bacteria5498Open in IMG/M
3300017728|Ga0181419_1061535All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300017758|Ga0181409_1017649All Organisms → Viruses → Predicted Viral2321Open in IMG/M
3300017758|Ga0181409_1126505All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium753Open in IMG/M
3300020253|Ga0211685_1002012All Organisms → cellular organisms → Bacteria3736Open in IMG/M
3300020317|Ga0211688_1000391All Organisms → cellular organisms → Bacteria20851Open in IMG/M
3300020347|Ga0211504_1003924All Organisms → cellular organisms → Bacteria5500Open in IMG/M
3300020352|Ga0211505_1129651All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium597Open in IMG/M
3300020382|Ga0211686_10076206All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1363Open in IMG/M
3300020396|Ga0211687_10145813All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium979Open in IMG/M
3300020404|Ga0211659_10019912All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3305Open in IMG/M
3300020446|Ga0211574_10513772All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium513Open in IMG/M
3300021365|Ga0206123_10199005Not Available892Open in IMG/M
3300021368|Ga0213860_10208070All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium861Open in IMG/M
3300021375|Ga0213869_10000174All Organisms → cellular organisms → Bacteria52067Open in IMG/M
3300021375|Ga0213869_10003125All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium11130Open in IMG/M
3300021960|Ga0222715_10103476All Organisms → cellular organisms → Bacteria1835Open in IMG/M
3300022164|Ga0212022_1069447Not Available541Open in IMG/M
3300022885|Ga0222662_1085318All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium587Open in IMG/M
(restricted) 3300023210|Ga0233412_10223678All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium820Open in IMG/M
3300023296|Ga0222664_1022818All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1258Open in IMG/M
3300024262|Ga0210003_1125471All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1131Open in IMG/M
3300025048|Ga0207905_1000452All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium9628Open in IMG/M
3300025048|Ga0207905_1005709All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2325Open in IMG/M
3300025048|Ga0207905_1010326All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1640Open in IMG/M
3300025071|Ga0207896_1006731All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2086Open in IMG/M
3300025079|Ga0207890_1001147All Organisms → cellular organisms → Bacteria7131Open in IMG/M
3300025079|Ga0207890_1005398All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2949Open in IMG/M
3300025120|Ga0209535_1000245All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15737104Open in IMG/M
3300025120|Ga0209535_1000614All Organisms → cellular organisms → Bacteria25006Open in IMG/M
3300025120|Ga0209535_1005438All Organisms → cellular organisms → Bacteria7805Open in IMG/M
3300025120|Ga0209535_1050184All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1785Open in IMG/M
3300025120|Ga0209535_1050996All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1764Open in IMG/M
3300025120|Ga0209535_1052322All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1730Open in IMG/M
3300025127|Ga0209348_1003987All Organisms → cellular organisms → Bacteria6590Open in IMG/M
3300025127|Ga0209348_1056801All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300025168|Ga0209337_1018140All Organisms → cellular organisms → Bacteria4176Open in IMG/M
3300025168|Ga0209337_1088087All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1483Open in IMG/M
3300025168|Ga0209337_1129289All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1126Open in IMG/M
3300025276|Ga0208814_1133212Not Available579Open in IMG/M
3300025425|Ga0208646_1014380All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2077Open in IMG/M
3300025696|Ga0209532_1232989All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium503Open in IMG/M
3300027687|Ga0209710_1054929All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1779Open in IMG/M
3300027813|Ga0209090_10281898All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium830Open in IMG/M
3300027839|Ga0209403_10155503All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1410Open in IMG/M
3300027847|Ga0209402_10302208All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium998Open in IMG/M
3300027849|Ga0209712_10005082All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium10342Open in IMG/M
3300027849|Ga0209712_10127906All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1458Open in IMG/M
3300027976|Ga0209702_10146276All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1047Open in IMG/M
3300028196|Ga0257114_1001752All Organisms → cellular organisms → Bacteria15035Open in IMG/M
3300028418|Ga0228615_1054534All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300029318|Ga0185543_1046484All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300029448|Ga0183755_1032785All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1504Open in IMG/M
3300031141|Ga0308021_10130826All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300031167|Ga0308023_1043785All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium869Open in IMG/M
3300031167|Ga0308023_1055585Not Available756Open in IMG/M
3300031519|Ga0307488_10009119All Organisms → cellular organisms → Bacteria8066Open in IMG/M
3300031589|Ga0307996_1187404All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium540Open in IMG/M
3300031598|Ga0308019_10153218All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300031599|Ga0308007_10002566All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium7734Open in IMG/M
3300031599|Ga0308007_10154638All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium818Open in IMG/M
3300031601|Ga0307992_1014235All Organisms → cellular organisms → Bacteria3795Open in IMG/M
3300031601|Ga0307992_1060610All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1603Open in IMG/M
3300031601|Ga0307992_1108032All Organisms → Viruses → Predicted Viral1118Open in IMG/M
3300031601|Ga0307992_1187722All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium776Open in IMG/M
3300031605|Ga0302132_10112391All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1367Open in IMG/M
3300031631|Ga0307987_1023004All Organisms → cellular organisms → Bacteria2302Open in IMG/M
3300031631|Ga0307987_1027374All Organisms → cellular organisms → Bacteria2036Open in IMG/M
3300031631|Ga0307987_1068816All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1031Open in IMG/M
3300031631|Ga0307987_1134142All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium636Open in IMG/M
3300031638|Ga0302125_10127258Not Available821Open in IMG/M
3300031658|Ga0307984_1001606All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium9457Open in IMG/M
3300031658|Ga0307984_1033629All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300031658|Ga0307984_1048665All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1330Open in IMG/M
3300031669|Ga0307375_10629483All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium628Open in IMG/M
3300031675|Ga0302122_10086771All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300033742|Ga0314858_116884All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium681Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine41.86%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.95%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.53%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.10%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.10%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment3.10%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake2.33%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.55%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.55%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.55%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.55%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.55%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.55%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.55%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.55%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.55%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.55%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.78%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.78%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.78%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.78%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.78%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.78%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.78%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.78%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.78%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005913Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1EnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300007074Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8EnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300020253Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945)EnvironmentalOpen in IMG/M
3300020317Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022885Saline water microbial communities from Ace Lake, Antarctica - #600EnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023296Saline water microbial communities from Ace Lake, Antarctica - #604EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025425Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027839Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031598Marine microbial communities from water near the shore, Antarctic Ocean - #284EnvironmentalOpen in IMG/M
3300031599Marine microbial communities from water near the shore, Antarctic Ocean - #71EnvironmentalOpen in IMG/M
3300031601Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133EnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300031631Marine microbial communities from Ellis Fjord, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1007899623300000115MarineMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFSTFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF*
SA_S1_NOR05_45mDRAFT_1005675813300000127MarineMMSLKNYNNFVSEEIDDFHKDLEIGNKKIKFFAKFDKSDLKEVKTNFSISEPKKKFQPKIKGYKKINNDKGIF*
JGI24006J15134_1000674153300001450MarineMSLKNYNNFVSEEVNDFYKDLENSNKRLKLFATFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF*
JGI24006J15134_1001075023300001450MarineMGIKNYISFVNEEIDDFYDDLNTDNKRLKFFANFDKSDLKKVKTNFYLPEPKKRFQPKVKSYKKSNNNKGIF*
JGI24006J15134_1001109483300001450MarineMGIKNYISFVNEEIDDFYDDLNTDNKRLKFFANFDKSDLKKVKTNFYLPEPKKRFQPKVKSYK
JGI24003J15210_1001504623300001460MarineMMSLKNYNNFVSEEVDDFYKDLENSNKKIKLFATFSKSELKDVKSNFSIPAPKKKFQPKVKGFKKINNNKGIF*
JGI24003J15210_1002279523300001460MarineMNFKNYNIFVSEEVNEFYDDLENSKKRLKFFATFSKSDLNQVKTNFSIPAPKKKFQPKVKGFKKINNDKGIF*
JGI24003J15210_1003369333300001460MarineMMSLKNYNNFVSEEVDDFYRDLENSNKRIKLFATFSKSELSQVKTNFSIPVPKKKFQPKVKGFKKINNDKGIF*
JGI24003J15210_1003860223300001460MarineMMSLKKYNNFVSEEVNDFYRDLENSNKRLKLFATFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF*
JGI24003J15210_1004376523300001460MarineMNLKNYNNFVNEEIDDFYKDLENSNKRLKLFATFDKSELKEVKTSFSIPAPKKKFQPKVKGFKKINKDKGIF*
JGI24004J15324_1002008323300001472MarineMGLKNYNNFVSEEVDDFYKDLENSNKRLKLFATFNKSKIEQVKTSFSIPAPKKFQPKVKGFKKINNDKGIF*
JGI24005J15628_1000996823300001589MarineMGIKNYISFVNEEIDDFYDDLNTDNKRLKFFANFDKSDLKKVKTNFSLPEPKKRFQPKVKSYKKSNNNKGIF*
JGI25127J35165_108002223300002482MarineMRVKNYTRFVNEEIDDFYKDLETSNKRLKFLSKFTKSELGEVNTSFSIPPPK
Ga0055584_10074989023300004097Pelagic MarineMMSLKNYNNFVNEEIDDFYKDLESNSKRLKLFSTFGKSELDEVKTNFSIPAPKKKFQPKVKGFKKINKDKGIF*
Ga0065861_1001883373300004448MarineMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFTTFNKSELTKVKTDFSITEVPKKKFQPKVKGYKKINKDKGIF*
Ga0075108_1003098633300005913Saline LakeMSIQKYNNFVSEEIDDFYKDLEEGSKKLRLFSKFSKSVLGEVKTSFTIPEPKKKFQPKVKGYKKINNDKGIF*
Ga0075445_1001184243300006193MarineMNIKNYNNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFFIPEPKKKFQPKVKGYKKINNDKGIF*
Ga0075495_107578733300006399AqueousMSLKNYNNFVNEEIDDFYKDLESNSKRLKLFSTFGKSELDEVKTNFSIPAPKKKFQPKVKGFKKINKDKGIF*
Ga0098042_116175823300006749MarineMSIKNYCSFVNEEIDDFYKDLENSNKRLKLFSTFSKSELSEVKTNFSITEPKKKFQPKVKGYKKINNDKGIF*
Ga0098058_108694023300006750MarineMDLKNYNNFVNEEIDDFYEDLENSNKRLKLFATFNKSELKDVKTSFSIPVPKKKFQPK
Ga0098048_106566723300006752MarineMDLKNYNNFVNEEIDDFYEDLENSNKRLKLFATFNKSELKDVKTSFSIPVPKKKFQPKVKGFKKINKDKGIF*
Ga0075110_110831413300007074Saline LakeMSMQKYNNFVSDEIDDFYKDLEEGSKKLRLFSKFTKSVLGEVKTNFSIPEPKKKFQPKVKGYKKVNNNKGIF*
Ga0105050_1001190493300007516FreshwaterMSMQKYNNFVSEEIDDFYKDLEEGSKNLRLFSKFSKSVLGEVKTNFSITEPKKRFQPKVKGYKKINNDKGIF*
Ga0115371_1040524313300008470SedimentMISIEKYNNFVIEETDEFYDDLENDGKKLRLFSTFVKSDLNQVESKFTISEPKKRFQPKIKVYKKTNNKGIF
Ga0115371_1064241923300008470SedimentMMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFATFNKSELANVKTNFSITEAPKMKFQPKVKGFKKINKDKGIF*
Ga0115371_1073068523300008470SedimentMMSLKKYNNFVSEEIDDFYKDLENSSRKLRLFSTFNKSILGEVKTNFSLPPPKKRFQPKVKSYKKINNDKGVF*
Ga0115371_1106675633300008470SedimentMSMQKYNNFVSEEIDDFYKDLENGSKKLRLFSKFSKSVLGEVRTSFSIPEPKKRFQPKVKGYKKINNDKGIF*
Ga0114918_1014600723300009149Deep SubsurfaceMMSLKKYNNFVSEEIDDFYKDLENGSRKLRLFSTFSKSILGEVKTNFILPQPKKRFQPKVKSYKKINNDKGIF*
Ga0114995_1001709533300009172MarineMNIKNYDNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFVIPEPKKKFQPKVKGYKKINNDKGIF*
Ga0114996_1023414713300009173MarineYFYMMSLKKYNNFVSEELDDFYKDLENGSRKLRLFSTFNKSILGEFKTNFILPQPKKRFQPKVKSYKKINNDKGIF*
Ga0114996_1045563723300009173MarineMSLKKYNNFVNEEIDDFYEDLKKSNKKLRLFSTFNKSELGETKTKFSVPIPKKKFQPKIKGFKKINNNKGIF*
Ga0114994_1000401633300009420MarineMNIKNYNNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFVIPEPKKKFQPKVKGYKKINNDKGIF*
Ga0114994_1017901933300009420MarineMSIQKYNNFVSEEIDDFYKDLENGSKKLRLFSNFSKSVLGEVRTSFSIPEPKKRFQPKVKGYKKINNNKGIF*
Ga0114994_1020713133300009420MarineVSEEEDNFYDDLETSKKRLKFFATFNKSELNQVKTSFSIPAPKKRFQPKVKGFKKINNDKGIF*
Ga0114994_1030422133300009420MarineYLYMMSLKKYNNFVSEELDDFYKDLENGSRKLRLFSTFNKSILGEFKTNFILPQPKKRFQPKVKSYKKINNDKGIF*
Ga0115005_1006322933300009432MarineMSMQKYNNFVSEEVDDFYKDLENGNKKLRLFSKFSKSVLGEVKTSFSIPEPKKRFQPKVKGYKKINNDKGIF*
Ga0115546_108131923300009435Pelagic MarineMMSLKNYNNFVNEEIDDFYKDLESNSKRLKLFSTFGKSELDEVKTNFSIPAPKKKFQPKVKGFKKI
Ga0115569_1022816513300009497Pelagic MarineMMSLKNYNNFVNEEIDDFYKDLESNSKRLKLFSTFGKSELDEVKTNFSIPAPKKKFQPKVKG
Ga0115003_1014694623300009512MarineMMSLKKYNNFVSEELDDFYKDLENGSRKLRLFSTFNKSILGEVKTNFILPQPKKRFQPKVKSYKKINNDKGIF*
Ga0115013_10001944123300009550MarineMRVKKYNSFVNEEIDDFYKDLENSNKKLKLFSTFNKSELSEVKTKFSITEPKKKFQPKVKGYKKINNDKGIF*
Ga0115000_1072565523300009705MarineMMSLKKYNNFVSEELDDFYKDLENGSRKLRLFSTFNKSILGEFKTNFILPQPKKRFQPKVKSYKKINNDKGIF*
Ga0114999_1050834623300009786MarineMISIEKYNDFVIEETDEFYDDLENDGKKLRLFSTFVKSDLDQVKTNFTIPEPKKRFQPKIKAYKKTNNNKGIF*
Ga0118731_10207950313300010392MarineYKGFIRYYFYIMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFSTFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF*
Ga0118731_10208242013300010392MarineYKGFIRYYFYIMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFTTFNKSELTKVKTDFSITEVPKKKFQPKVKGYKKINKDKGIF*
Ga0118733_10399835813300010430Marine SedimentKGFIRYYFYIMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFSTFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF*
Ga0118733_10399836113300010430Marine SedimentKGFIRYYFYIMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFTTFNKSELTKVKTDFSITEVPKKKFQPKVKGYKKINKDKGIF*
Ga0133547_1070038513300010883MarineMQKYNNFVSEEIDDFYKDLEEGSKNLRLFSKFSKSVLGEVKTNFSIPEPKKRFQPKVKGYKKINNDKGIF*
Ga0133547_1113574223300010883MarineMSLKKYNNFVNEEIGDFYDDLERSNKKLRLFSTFDKSELGEVKAKFSIPIPKKKFQPKIKGFKKINNNKGIF*
Ga0138258_154317523300012413Polar MarineMSLKKYNNFVSEEIDDFYKDLENSNRKLKLFSTFTKSTLGEVKTSFSLPEPKKRFQPKVKGYKKINNDKGIF*
Ga0138259_137343913300012416Polar MarineMSLKKYNNFVSEELDDFYKDLENSNRKLKLFSTFTKSTLGEVKTSFSLPEPKKRFQPKVKGYKKINNDKGIF*
Ga0160423_1019050023300012920Surface SeawaterMSIKKYNDFVTEEIDDFYKDLENSNKRLKLFSTFNKSELSDVKTKFSITEPKKKFQPKVKGFKKINNDKGIF*
Ga0163110_1178193523300012928Surface SeawaterRFVNEEIDDFYKDLETSNKRLKFLSKFTKSELGEVNTSFSIPPPKKKFQPKVKKYKKNNNDKGIF*
Ga0181412_100343473300017714SeawaterMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFATFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF
Ga0181419_106153513300017728SeawaterYFYIMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFATFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF
Ga0181409_101764913300017758SeawaterMSLKNYNNFVNEEVDDFYKDLEDNNKRLKLFATFNKSELADVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF
Ga0181409_112650513300017758SeawaterMNLKKYNNFVNEEIDDFYNDLDISNKRLKLFTTFDKSELKEVKTKFSLPTPKKKFQPKI
Ga0211685_100201253300020253MarineMNIKNYNNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFFIPEPKKKFQPKVKGYKKINNDKGIF
Ga0211688_1000391143300020317MarineMMSLKNYNNFVNEEVDDFYKDLENSNKRLKLFATFSKSEVSQVKTNFSIPAPKKKFQPKVKGFKKINKDKGIF
Ga0211504_100392463300020347MarineMDLKNYNNFVNEEIDDFYEDLENSNKRLKLFATFNKSELKDVKTSFSIPVPKKKFQPKVKGFKKINKDKGIF
Ga0211505_112965113300020352MarineMDLKNYNNFVNEEIDDFYEDLENSNKRLKLFATFNKSELKDVKTSFSIPVPKKKFQPKV
Ga0211686_1007620613300020382MarineMSMQKYNNFVSEEIDDFYKDLENGSKKLRLFSKFSKSVLGEVRTSFSIPEPKKRFQPKVKGYKKINNDKGIF
Ga0211687_1014581323300020396MarineMGIKNYIRFVNEEIDDFYDDLNTDSKRLKFFASFNKTELKEVKTNFSLPEPKKRFQPKVKSYKKSNNNKGIF
Ga0211659_1001991213300020404MarineMSIKNYCSFVNEEIDDFYKDLENSNKRLKLFSTFSKSELSEVKTNFSITEPKKKFQPKVKGYKKINNDKGIF
Ga0211574_1051377213300020446MarineMRVKNYTRFVNEEIDDFYKDLETSNKRLKFLSKFTKSELGEVNTSFSIPPP
Ga0206123_1019900523300021365SeawaterMSLKNYNNFVNEEIDDFYKDLESNSKRLKLFSTFGKSELDEVKTNFSIPAPKKKFQPKVKGFKKINKDKGIF
Ga0213860_1020807023300021368SeawaterMMSIKKYNDFVTEEIDDFYKDLENSNKRLKLFSTFNKSELSDVKTKFSITEPKKKFQPKVKGFKKINNDKGIF
Ga0213869_10000174383300021375SeawaterMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFSTFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF
Ga0213869_1000312533300021375SeawaterMMSLKNYNNFVNEEIDDFYKDLESNSKRLKLFSTFGKSELDEVKTNFSIPAPKKKFQPKVKGFKKINKDKGIF
Ga0222715_1010347633300021960Estuarine WaterEVDDFYKDLENSNKKLKLFSNFNKSKLSNIETKFSIPEPKKRFQPKVKGFKKINNDKGIF
Ga0212022_106944723300022164AqueousNYNNFVNEEIDDFYKDLESNSKRLKLFSTFGKSELDEVKTNFSIPAPKKKFQPKVKGFKKINKDKGIF
Ga0222662_108531823300022885Saline WaterMSMQKYNNFVSDEIDDFYKDLEEGSKKLRLFSKFTKSVLGEVKTNFSIPEPKKKFQPKVKGYKKVNNNKGIF
(restricted) Ga0233412_1022367823300023210SeawaterMMSLKKYNNFVSEELNDFYKDLENGGRKLRLFSTFNKSILGEFKTNFILPQPKKRFQPKVKSYKKINNDKGIF
Ga0222664_102281823300023296Saline WaterMQKYNNFVSDEIDDFYKDLEEGSKKLRLFSKFTKSVLGEVKTNFSIPEPKKKFQPKVKGYKKVNNNKGIF
Ga0210003_112547123300024262Deep SubsurfaceMMSLKKYNNFVSEEIDDFYKDLENGSRKLRLFSTFSKSILGEVKTNFILPQPKKRFQPKVKSYKKIN
Ga0207905_100045243300025048MarineMGLKNYNNFVSEEVDDFYKDLENSNKRLKLFATFNKSKIEQVKTSFSIPAPKKKFQPKVKGFKKINNDKGIF
Ga0207905_100570933300025048MarineMMSLKNYNNFVSEEVDDFYKDLENSNKKIKLFATFSKSELKDVKSNFSIPAPKKKFQPKVKGFKKINNNKGIF
Ga0207905_101032623300025048MarineMSLKNYNNFVSEEVNDFYKDLENSNKRLKLFATFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF
Ga0207896_100673133300025071MarineMGIKNYISFVNEEIDDFYDDLNTDNKRLKFFANFDKSDLKKVKTNFSLPEPKKRFQPKVKSYKKSNNNKGIF
Ga0207890_100114753300025079MarineMGIKNYISFVNEEIDDFYDDLNTDNKRLKFFANFDKSDLKKVKTNFYLPEPKKRFQPKVKSYKKSNNNKGIF
Ga0207890_100539833300025079MarineMSLKNYNNFVSEEVDDFYKDLENSNKKIKLFATFSKSELKDVKSNFSIPAPKKKFQPKVKGFKKINNNKGIF
Ga0209535_1000245293300025120MarineMNLKNYNNFVNEEIDDFYKDLENSNKRLKLFATFDKSELKEVKTSFSIPAPKKKFQPKVKGFKKINKDKGIF
Ga0209535_1000614173300025120MarineMMSLKNYNNFVSEEVDDFYRDLENSNKRIKLFATFSKSELSQVKTNFSIPVPKKKFQPKVKGFKKINNDKGIF
Ga0209535_100543833300025120MarineMNFKNYNIFVSEEVNEFYDDLENSKKRLKFFATFSKSDLNQVKTNFSIPAPKKKFQPKVKGFKKINNDKGIF
Ga0209535_105018423300025120MarineMMSLKNYNNFVSEEVDDFYKDLENSNKKIKLFATFSKSELKDVKSNFSIPAPKKKFQPKVKGFKKINNDKGIF
Ga0209535_105099623300025120MarineMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFTTFNKSELTKVKTDFSITEVPKKKFQPKVKGYKKINKDKGIF
Ga0209535_105232223300025120MarineMSLKKYNNFVSEEVNDFYRDLENSNKRLKLFATFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF
Ga0209348_100398753300025127MarineMRVKNYTRFVNEEIDDFYKDLETSNKRLKFLSKFTKSELGEVNTSFSIPPPKKKFQPKVKKYKKNNNDKGIF
Ga0209348_105680123300025127MarineMRVKKYNSFVNEEIDDFYKDLENSNKKLKLFSTFNKSELSEVKTKFSITEPKKKFQPKVKGYKKINNDKGIF
Ga0209337_101814013300025168MarineYISFVNEEIDDFYDDLNTDNKRLKFFANFDKSDLKKVKTNFSLPEPKKRFQPKVKSYKKSNNNKGIF
Ga0209337_108808733300025168MarineMMSLKKYNNFVSEELDDFYKDLENGGRKLRLFSTFNKSILGEVKTNFILPQPKKRFQPKVKSYKKINNDKGIF
Ga0209337_112928913300025168MarineMGIKNYISFVNEEIDDFYDDLNTDNKRLKFFANFDKSDLKKVKTNFYLPEPKKRFQPKVKSYKKSNNNK
Ga0208814_113321213300025276Deep OceanNFVTEEIDDFHKDLETSNKKIKFFAKFDKSDLKEVKTNFSIPEPKKRFQPKIKGFKKINNNKGIF
Ga0208646_101438023300025425Saline LakeMSIQKYNNFVSEEIDDFYKDLEEGSKKLRLFSKFSKSVLGEVKTSFTIPEPKKKFQPKVKGYKKINNDKGIF
Ga0209532_123298913300025696Pelagic MarineMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFSTFNKSELTNVKTNFSITEVPKKKFQPKVKGYKKINKDKG
Ga0209710_105492933300027687MarineMNIKNYNNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFVIPEPKKKFQPKVKGYKKINNDKGIF
Ga0209090_1028189813300027813MarineMSIQKYNNFVSEEIDDFYKDLENGSKKLRLFSNFSKSVLGEVRTSFSIPEPKKRFQPKVKGYKKINNNKGIF
Ga0209403_1015550323300027839MarineMSLKKYNNFVNEEIDDFYEDLKKSNKKLRLFSTFNKSELGETKTKFSVPIPKKKFQPKIKGFKKINNNKGIF
Ga0209402_1030220823300027847MarineMISIEKYNDFVIEETDEFYDDLENDGKKLRLFSTFVKSDLDQVKTNFTIPEPKKRFQPKIKAYKKTNNNKGIF
Ga0209712_10005082123300027849MarineMNIKNYDNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFVIPEPKKKFQPKVKGYKKINNDKGIF
Ga0209712_1012790633300027849MarineMSMQKYNNFVSEEVDDFYKDLENGNKKLRLFSKFSKSVLGEVKTSFSIPEPKKRFQPKVKGYKKINNDKGIF
Ga0209702_1014627623300027976FreshwaterMSMQKYNNFVSEEIDDFYKDLEEGSKNLRLFSKFSKSVLGEVKTNFSITEPKKRFQPKVK
Ga0257114_1001752133300028196MarineRYYLHMMNLKNYNNFVSEEVDDFYKDLENSNKKLKLFSNFNKSELADVKTNFSITEVPKKKFQPKVKGYKKINKDKGIF
Ga0228615_105453413300028418SeawaterNNFVSEEVDDFYKDLENSNKKLKLFSNFNKSKLSNIETKFSIPEPKKRFQPKVKGFKKINNDKGIF
Ga0185543_104648433300029318MarineRYCIRVMRVKNYTRFVNEEIDDFYKDLETSNKRLKFLSKFTKSELGEVNTSFSIPPPKKKFQPKVKKYKKNNNDKGIF
Ga0183755_103278533300029448MarineMMSLKNYNNFVSEEVDDFYKDLENSNKRLKLFSTFNKSKLDNIETKFSIPKPKKRFQPKVKGFKKINNDKGIF
Ga0308021_1013082633300031141MarineMQKYNNFVSEEIDDFYKDLENGSKKLRLFSKFSKSVLGEVRTSFSIPEPKKRFQPKVKGYKKINNDKGIF
Ga0308023_104378523300031167MarineMSIQKYNNFVSEELDDFYKDAEEDGKKLRLFSKFSKSVLGEVKTKFSIPEPKKKFQPKVKSYKKINNDKGIF
Ga0308023_105558523300031167MarineYFYIMSMQKYNNFVSEEIDDFYKDLEEGSKNLRLFSKFSKSVLGEVKTNFSIPEPKKRFQPKVKGYKKINNDKGIF
Ga0307488_1000911973300031519Sackhole BrineMMSLKKYNNFVSEELDDFYKDLENGSRKLRLFSTFNKSILGEFKTNFILPQPKKRFQPKVKSYKKINNDKGIF
Ga0307996_118740413300031589MarineMSMQKYNNFVSEEIDDFYKDLEEGSKNLRLFSKFSKSVLGEVKTNFSIPEPKKRFQPKVKGYKKINNDKG
Ga0308019_1015321813300031598MarineYFYIMSMQKYNNFVSEEIDDFYKDLENGSKKLRLFSKFSKSVLGEVRTSFSIPEPKKRFQPKVKGYKKINNDKGIF
Ga0308007_1000256613300031599MarineMNIKNYNNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFFIPEPKKKFQPKVKGYKKINN
Ga0308007_1015463823300031599MarineMQKYNNFVSEEIDDFYKDLEEGSKNLRLFSKFSKSVLGEVKTNFSIPEPKKRFQPKVKGYKKINNDKGIF
Ga0307992_101423543300031601MarineMSMQKYNSFVSEEIDDFYKDVEEGNKKLRLFSTFSKSVLGEVNTTFSIPEPKKKFQPKVKGYKKINNDKGIF
Ga0307992_106061023300031601MarineMQKYNNFVSEELDDFYKDLAEDGKKLRLFSKFSKSVLGEVKTSFIMPEPKKKFQPKVKGYKKINNDKGIF
Ga0307992_110803223300031601MarineMMSLKNYNNFVTEEIDDFHKDLETSNKKIKFFAKFDKSDLKEVKTSFFIPEPKKRFQPKIKSFKKINNDKGIF
Ga0307992_118772213300031601MarineMILKKYNNFVSEEIDDFYKDLENSNRKLKLFSTFTKSTLDEVKTNFSLPEPKKRFQPKVKRYKKTNNNKGIF
Ga0302132_1011239123300031605MarineMMSLKKYNNFVSEELDDFYKDLENGSRKLRLFSTFNKSILGEVKTNFILPQPKKRFQPKVKSYKKINNDKGIF
Ga0307987_102300443300031631MarineMQKYNSFVSEEIDDFYKDVEEGNKKLRLFSTFSKSVLGEVNTTFSIPEPKKKFQPKVKGYKKINNDKGIF
Ga0307987_102737433300031631MarineIQKYNNFVSEELDDFYKDAEEDGKKLRLFSKFTKSVLGEVKTSFSISKPKKKFQPKVKSYRKINNNKGIF
Ga0307987_106881633300031631MarineMQKYNNFVSEEIDDFYKDLEEGSKNLRLFSKFSKSVLGEVKTNFSITEPKKRFQPKVKGYKKINNDKGIF
Ga0307987_113414223300031631MarineMMSFKKYNNFVSEEIDDFYKDLENSSRKLRLFSKFNKSIFDDVKTTFSLPPPKKKFQPKVKSYKKINNDKGIF
Ga0302125_1012725813300031638MarineIFYKQFIRYYFYIMNIKNYDNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFVIPEPKKKFQPKVKGYKKINNDKGIF
Ga0307984_1001606123300031658MarineMSMQKYNNFVSEEIDDFYKDLEEGSKNLRLFSKFSKSVLGEVKTNFSIPEPKKRFQPKVKGYKKINNDKGIF
Ga0307984_103362913300031658MarineNNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFFIPEPKKKFQPKVKGYKKINNDKGIF
Ga0307984_104866523300031658MarineMSIQKYNNFVSEEIDDFYKDAEEGGKKLRLFSKFSKSVLGEVKTSFTIPEPKKKFQPKVKGYKKINNDKGIF
Ga0307375_1062948323300031669SoilMMSLKKYNNFVSEEIDDFYKDLENGSRKLRLFSTFSKSILGEVKTNFILPQPKKRFQPKVKSYKKINNDKGIF
Ga0302122_1008677133300031675MarineNFVSEEIDDFYKDSENSKRKLRLFSTFTKSTLGEVKSSFVIPEPKKKFQPKVKGYKKINNDKGIF
Ga0314858_116884_478_6813300033742Sea-Ice BrineMISIEKYNDFVIEETDEFYDDLENDGKKLRLFSTFVKSDLDQVKTNFTIPEPKKRFQPKIKAYKKTNN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.