| Basic Information | |
|---|---|
| Family ID | F063794 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VGFKLTIDAERAAFVPGLARSDAHNVKGSFKDMVEITKLLQVLTSLEAP |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.33 % |
| % of genes near scaffold ends (potentially truncated) | 96.12 % |
| % of genes from short scaffolds (< 2000 bps) | 95.35 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.023 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.853 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.434 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.512 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.26% β-sheet: 0.00% Coil/Unstructured: 59.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF01266 | DAO | 60.47 |
| PF00266 | Aminotran_5 | 5.43 |
| PF01979 | Amidohydro_1 | 3.10 |
| PF13620 | CarboxypepD_reg | 2.33 |
| PF13594 | Obsolete Pfam Family | 1.55 |
| PF04951 | Peptidase_M55 | 1.55 |
| PF02585 | PIG-L | 0.78 |
| PF02810 | SEC-C | 0.78 |
| PF13586 | DDE_Tnp_1_2 | 0.78 |
| PF01011 | PQQ | 0.78 |
| PF13517 | FG-GAP_3 | 0.78 |
| PF13439 | Glyco_transf_4 | 0.78 |
| PF00356 | LacI | 0.78 |
| PF12833 | HTH_18 | 0.78 |
| PF01739 | CheR | 0.78 |
| PF07786 | HGSNAT_cat | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 1.55 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.78 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.78 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.02 % |
| Unclassified | root | N/A | 6.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_108177975 | Not Available | 605 | Open in IMG/M |
| 3300004479|Ga0062595_102337810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300005093|Ga0062594_101951705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300005175|Ga0066673_10406392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300005178|Ga0066688_10886715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300005184|Ga0066671_10893293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300005332|Ga0066388_105860158 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005343|Ga0070687_100847813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300005344|Ga0070661_101915237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300005445|Ga0070708_101736658 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005450|Ga0066682_10548760 | Not Available | 731 | Open in IMG/M |
| 3300005454|Ga0066687_10693914 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005457|Ga0070662_101596556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300005459|Ga0068867_100291536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300005467|Ga0070706_101241892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300005471|Ga0070698_100674420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300005543|Ga0070672_100087470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2507 | Open in IMG/M |
| 3300005545|Ga0070695_101670724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300005553|Ga0066695_10419839 | Not Available | 827 | Open in IMG/M |
| 3300005561|Ga0066699_10671343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300005569|Ga0066705_10123351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1565 | Open in IMG/M |
| 3300005578|Ga0068854_101707105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300005616|Ga0068852_102609931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300005617|Ga0068859_100340276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1594 | Open in IMG/M |
| 3300005713|Ga0066905_102320093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300005764|Ga0066903_103720708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300006032|Ga0066696_10711910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300006046|Ga0066652_100642797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
| 3300006237|Ga0097621_100285411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1454 | Open in IMG/M |
| 3300006755|Ga0079222_10527636 | Not Available | 875 | Open in IMG/M |
| 3300006846|Ga0075430_101351564 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006847|Ga0075431_100284613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1673 | Open in IMG/M |
| 3300006854|Ga0075425_100744540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300006854|Ga0075425_101427097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300006854|Ga0075425_102085984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300006871|Ga0075434_100328855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1549 | Open in IMG/M |
| 3300006880|Ga0075429_100218668 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300006903|Ga0075426_10057670 | All Organisms → cellular organisms → Bacteria | 2771 | Open in IMG/M |
| 3300006931|Ga0097620_101153207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300006953|Ga0074063_13046942 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006969|Ga0075419_11141050 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300007076|Ga0075435_101670112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300007255|Ga0099791_10100849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
| 3300009012|Ga0066710_102863341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300009093|Ga0105240_11225381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300009098|Ga0105245_12028772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300009147|Ga0114129_10470366 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300009156|Ga0111538_10318877 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
| 3300009156|Ga0111538_13264605 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009176|Ga0105242_13041911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300009177|Ga0105248_11009115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300009177|Ga0105248_12509957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300010336|Ga0134071_10784259 | Not Available | 509 | Open in IMG/M |
| 3300010362|Ga0126377_13018375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300010375|Ga0105239_10378158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1601 | Open in IMG/M |
| 3300010375|Ga0105239_11363098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300010391|Ga0136847_11554583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300010400|Ga0134122_10059051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2959 | Open in IMG/M |
| 3300010400|Ga0134122_12730697 | Not Available | 546 | Open in IMG/M |
| 3300010401|Ga0134121_10167330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1884 | Open in IMG/M |
| 3300010401|Ga0134121_13117177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300010403|Ga0134123_11132992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300010403|Ga0134123_13070642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012096|Ga0137389_10612131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300012203|Ga0137399_10577209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300012204|Ga0137374_10227050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1585 | Open in IMG/M |
| 3300012209|Ga0137379_11078102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300012685|Ga0137397_11249177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300012899|Ga0157299_10114262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300012922|Ga0137394_10653848 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012929|Ga0137404_11272298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300013307|Ga0157372_11216774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300014157|Ga0134078_10303809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300015077|Ga0173483_10756720 | Not Available | 555 | Open in IMG/M |
| 3300015190|Ga0167651_1052205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300016270|Ga0182036_10207656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
| 3300017657|Ga0134074_1047449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1451 | Open in IMG/M |
| 3300018071|Ga0184618_10069729 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300018083|Ga0184628_10307893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300022756|Ga0222622_10150434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1500 | Open in IMG/M |
| 3300025315|Ga0207697_10072314 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300025910|Ga0207684_11010048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300025922|Ga0207646_10313965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1416 | Open in IMG/M |
| 3300025924|Ga0207694_11609516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300025927|Ga0207687_10200831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1558 | Open in IMG/M |
| 3300025927|Ga0207687_11479055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300025933|Ga0207706_11361861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300025933|Ga0207706_11667364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300025940|Ga0207691_10257559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
| 3300025941|Ga0207711_10142337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 2158 | Open in IMG/M |
| 3300026023|Ga0207677_12266542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300026089|Ga0207648_10439515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1186 | Open in IMG/M |
| 3300026118|Ga0207675_102670889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300026142|Ga0207698_11351275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300026312|Ga0209153_1122657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300027909|Ga0209382_11803495 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300028047|Ga0209526_10523774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300028380|Ga0268265_10862704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300028536|Ga0137415_10040285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4569 | Open in IMG/M |
| 3300028784|Ga0307282_10221894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300028807|Ga0307305_10048197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1963 | Open in IMG/M |
| 3300028819|Ga0307296_10488737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300028828|Ga0307312_10970378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300028906|Ga0308309_11543390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300031544|Ga0318534_10375596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300031546|Ga0318538_10656815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300031562|Ga0310886_10308390 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300031640|Ga0318555_10657595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300031716|Ga0310813_11986638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300031720|Ga0307469_11713700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300031858|Ga0310892_10514348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300031890|Ga0306925_12254301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300031903|Ga0307407_10188264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
| 3300031949|Ga0214473_11380339 | Not Available | 718 | Open in IMG/M |
| 3300031954|Ga0306926_10075291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 4095 | Open in IMG/M |
| 3300032000|Ga0310903_10322896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300032012|Ga0310902_11133867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300032013|Ga0310906_10992136 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300032163|Ga0315281_12100252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300032179|Ga0310889_10763399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300032179|Ga0310889_10784617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300032180|Ga0307471_100404907 | Not Available | 1493 | Open in IMG/M |
| 3300032211|Ga0310896_10607688 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300032782|Ga0335082_11477559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300032829|Ga0335070_10698265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300033004|Ga0335084_10636324 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300033004|Ga0335084_11477376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300033814|Ga0364930_0190489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300034819|Ga0373958_0154126 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1081779752 | 3300000956 | Soil | LDAERASYVPGLVRLDAHNVKGTFPDMIQVTKLLQVIANLEMP* |
| Ga0062595_1023378102 | 3300004479 | Soil | PVALEVGFKLTIDAERAAFVPGVTRSDAHNVKGTFRDMIEITKLLQVLTSLELP* |
| Ga0062594_1019517051 | 3300005093 | Soil | EVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ* |
| Ga0066673_104063921 | 3300005175 | Soil | DAERAAFVPGLSRSDAHNVKGSFKDMTEITKLLQVLTSLELP* |
| Ga0066688_108867151 | 3300005178 | Soil | IDLEVGFKLTIDAERAAFVPGLARSDAHNVKGTFRDMIEITKLLQVLTSLELP* |
| Ga0066671_108932931 | 3300005184 | Soil | QPYRVTTPVALEVGFKLTIDAERAAFVPGLARSDAHNVKGTFHDLIEITKLLQVLTSLELP* |
| Ga0066388_1058601582 | 3300005332 | Tropical Forest Soil | PYRVTAPIDLEVGFKLTIDAERAAFVPGLSRSDAHNVKGSFRDMVEITKLLQVLTSLETP |
| Ga0070687_1008478132 | 3300005343 | Switchgrass Rhizosphere | LEVGFKLTIDAERAAFVPGLTRSDAHNVKGTFKDMVQVSKLLQVVTSFAAP* |
| Ga0070661_1019152372 | 3300005344 | Corn Rhizosphere | IALEVGFKLTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITRLLQVLTSLELP* |
| Ga0070708_1017366581 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | APIALEVGFKLTIDAELAAYIPGLSRADAHNVKGTFKDMTEITKLLQVLTSLELP* |
| Ga0066682_105487601 | 3300005450 | Soil | DLEVGFKLTLDAERASYVPGLVRSDAHSVKGTFPDMIQITKLLQVIANLERP* |
| Ga0066687_106939142 | 3300005454 | Soil | PYRVTAPVALEVGFKLTIDAERAAFVPGLARSDAHNVKGTFRDMIEITKLLQVLTSLELP |
| Ga0070662_1015965561 | 3300005457 | Corn Rhizosphere | RVRMPIDLEVGFKLTLDAERAAYVPGLTRSDAHSVKGTFHDMTEITRLLQVVGGLELP* |
| Ga0068867_1002915362 | 3300005459 | Miscanthus Rhizosphere | LEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP* |
| Ga0070706_1012418922 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RTPIDLEVGFKLTIDAERAAFVPGLARSDAHNVKGTFPDLTQITKLLQVVASLELQ* |
| Ga0070698_1006744202 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FKLTIDAERAAFVPGLSRPDAHSVKGSFRDMVEITKLLQVLTSLEAP* |
| Ga0070672_1000874701 | 3300005543 | Miscanthus Rhizosphere | ALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ* |
| Ga0070695_1016707242 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DAERASYVPGLVRSDAHNVKGTFPDMIQITKLLQVIANLERP* |
| Ga0066695_104198392 | 3300005553 | Soil | AAFVPGLVRSDAHDVRGTFADMVQITKLLQVVANLERP* |
| Ga0066699_106713432 | 3300005561 | Soil | ALDVGFKLTIDAERAAFVPGLARSDAHNVKGTFRDMPEITKLLQVLTSLELP* |
| Ga0066705_101233511 | 3300005569 | Soil | VGFKLTIDAERAAFIPGLARSDAHNVKGTFRDMPEITKLLQVLTSLELP* |
| Ga0068854_1017071052 | 3300005578 | Corn Rhizosphere | PIALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ* |
| Ga0068852_1026099312 | 3300005616 | Corn Rhizosphere | LEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ* |
| Ga0068859_1003402763 | 3300005617 | Switchgrass Rhizosphere | GFKLTIDAERAAFVPGLTRSDAHSVKGTFKDMTEITRLLQVLTSLELP* |
| Ga0066905_1023200931 | 3300005713 | Tropical Forest Soil | INLEVGFKLTIEAELASFVPGMTRADAHNVRGTFRDMPEVTKLLQVLTSIQ* |
| Ga0066903_1037207081 | 3300005764 | Tropical Forest Soil | TIDAERAAFVPGLTRSDAHNVKGTFRDMIEVTKLLQVLTSFELP* |
| Ga0066696_107119101 | 3300006032 | Soil | KLTIDAERAAFIPGLARSDAHNVKGTFRDMPEITKLLQVLTSLELP* |
| Ga0066652_1006427972 | 3300006046 | Soil | VGFKLTLDAERAAYVPGLSRSDAHSVKGTFHDMTEITRLLQVISGLELP* |
| Ga0097621_1002854111 | 3300006237 | Miscanthus Rhizosphere | LTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITRLLQVLTSLELP* |
| Ga0079222_105276362 | 3300006755 | Agricultural Soil | KLTIDAERAAFTPGLTRSDAHDVKGTFPDMPTITRLLQVIANLELP* |
| Ga0075430_1013515641 | 3300006846 | Populus Rhizosphere | LDVGFKLTLDAERAAFVPGLTRSDAHNVKGSFKDMVEITKLLQVLTSLEAP* |
| Ga0075431_1002846133 | 3300006847 | Populus Rhizosphere | TPIALEVGFKLTIDAERASFIPGLTRSGAHTVKGSFPDMIQIVRLMQVLSSFEAPN* |
| Ga0075425_1007445402 | 3300006854 | Populus Rhizosphere | AFVPGLARSDAHNVKGTFHDMIEVTRLLQVLTSLELP* |
| Ga0075425_1014270971 | 3300006854 | Populus Rhizosphere | PVNLEVGFKLTIDAERAAFVPGLTRSDAHNVKGTFKDMVEVSKLLQVLTSFAAP* |
| Ga0075425_1020859841 | 3300006854 | Populus Rhizosphere | VALEVGFKLTIDAERAAFVPGVTRSDAHNVKGTFRDMIEITRLLQVLTSLELP* |
| Ga0075434_1003288553 | 3300006871 | Populus Rhizosphere | VTTPVALEVGFKLTIDAERAAFVPGLARSDAHNVKGTFHDMVEVTRLLQVLTSLELP* |
| Ga0075429_1002186682 | 3300006880 | Populus Rhizosphere | YRMTAPIALDVGFKFTIDAERAAFVPGLMRSDAHNVKGSFKDMVEITRLLQVLTSLEAP* |
| Ga0075426_100576701 | 3300006903 | Populus Rhizosphere | LEVGFKLTIDAERAAFIPGLTRSDAHNVKGTFPDMIQITKLLQVLTSLQTP* |
| Ga0097620_1011532071 | 3300006931 | Switchgrass Rhizosphere | ALEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP* |
| Ga0074063_130469421 | 3300006953 | Soil | FTLDAERAAFVPGLARSDAHNVRGSFRDMVEITKLLQVLTSLEAP* |
| Ga0075419_111410501 | 3300006969 | Populus Rhizosphere | AERAAFVPGLMRSDAHNVKGSFKDMVEITRLLQVLTSLEAP* |
| Ga0075435_1016701121 | 3300007076 | Populus Rhizosphere | RIRSPIDLEVGFKLTLDAERASYVPGLVRSDAHSVKGTFPDMIQITKLLQVIANLERP* |
| Ga0099791_101008492 | 3300007255 | Vadose Zone Soil | VPGLARSDAHNVKGTFKDMTEITKLLQVLTSLDVP* |
| Ga0066710_1028633412 | 3300009012 | Grasslands Soil | AAFIPGLARSDAHNVKGTFRDMPEITKLLQVLTSLELP |
| Ga0105240_112253812 | 3300009093 | Corn Rhizosphere | LTIDAERAAFVPGLARLDAHSVKGTFTDMVQVTRLLQVLTSLELP* |
| Ga0105245_120287722 | 3300009098 | Miscanthus Rhizosphere | ALEVGFKLTIDAERAAFVPGLTRSDAHSVKGTFKDMTEITRLLQVLTSLELP* |
| Ga0114129_104703662 | 3300009147 | Populus Rhizosphere | VGFKLTIDAERAAFVPGLARSDAHNVKGSFKDMVEITKLLQVLTSLEAP* |
| Ga0111538_103188771 | 3300009156 | Populus Rhizosphere | PGLTHSDAHNVTGSFKDMIEITKLLQVLTSLEAP* |
| Ga0111538_132646052 | 3300009156 | Populus Rhizosphere | DAERAAFVPGLSRADAHNVRGSFKDMVEITKLLQVLTSLDVP* |
| Ga0105242_130419112 | 3300009176 | Miscanthus Rhizosphere | PGLARSDAHNVKGTFKDMTEITKLLQVLTSLDLP* |
| Ga0105248_110091152 | 3300009177 | Switchgrass Rhizosphere | EVGFKLTIDAERAAFVPGLSRSDAHSVKGAFKDMIEITKLLQVVSSLEAP* |
| Ga0105248_125099572 | 3300009177 | Switchgrass Rhizosphere | TIDAERAAFVPGLTRADAHNVRGSFRDMVEITKLLQVLTSLEAP* |
| Ga0134071_107842592 | 3300010336 | Grasslands Soil | TIDAERASFIPGLSRPDAHTVKGSFHDMVEITKLLQVLTSLEAP* |
| Ga0126377_130183751 | 3300010362 | Tropical Forest Soil | EVGFKLTIDAERAAFVPGLSRSDAHDVKGSFRDMVEITKLLQVLTSLETP* |
| Ga0105239_103781583 | 3300010375 | Corn Rhizosphere | GFKLTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITRLLQVLTSLELP* |
| Ga0105239_113630982 | 3300010375 | Corn Rhizosphere | ERAAFVPGLARSDAHSVKGTFHDMVEVTRLLQVLTSLELP* |
| Ga0136847_115545832 | 3300010391 | Freshwater Sediment | DAERAAFVPGLTRSDAHVVKGSFKDMVEITKLLQVLTSLEAP* |
| Ga0134122_100590512 | 3300010400 | Terrestrial Soil | VPGVTRSDAHNVKGTFRDMIEITKLLQVLTSLELP* |
| Ga0134122_127306972 | 3300010400 | Terrestrial Soil | GFKLTVDAERASFVPGLSRPDAHSVKGSFKDMVEITKLLQVLTSLEAP* |
| Ga0134121_101673301 | 3300010401 | Terrestrial Soil | GAVLPGLARSDAHSVKGTFRGMVEGTELLQILTSLELP* |
| Ga0134121_131171771 | 3300010401 | Terrestrial Soil | ERAAFVPGLARSDAHNVKGTFKDMTEITKLLQVLTSLDLP* |
| Ga0134123_111329921 | 3300010403 | Terrestrial Soil | GFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP* |
| Ga0134123_130706421 | 3300010403 | Terrestrial Soil | KLTIDAERAAFVPGLSRSDAHNVKGTFTDMVEITKLLQVVSSLEAP* |
| Ga0137389_106121311 | 3300012096 | Vadose Zone Soil | GFKLTIYAERAAFVPGLSRSDAHNVKGSFKDMTEITKLLQVLTSLELP* |
| Ga0137399_105772092 | 3300012203 | Vadose Zone Soil | APIDLEVGFKLTIDAERASFIPGLSRPDAHTVKGSFRDMVEITKLLQVLTSLDTP* |
| Ga0137374_102270503 | 3300012204 | Vadose Zone Soil | YRVTTPIDLEVGFKLTIDAERAAFVPGLSRSDAHNVKGSFRDMIEITKLLQVLTSLEMP* |
| Ga0137379_110781021 | 3300012209 | Vadose Zone Soil | AYRITAPIALEVGFKLTIDAERAAYVPGLERADAHNVKGSFRDLVEISKLLQLLIAD* |
| Ga0137397_112491772 | 3300012685 | Vadose Zone Soil | TIDAERASFVPGLSRPDAHSVKGSFKDMVEITKLLQVLTSLEAP* |
| Ga0157299_101142622 | 3300012899 | Soil | LIGLSWRARRAERAAFVPGLSRADAHNVRGSFKDMVEITKLLQVLTSLDVP* |
| Ga0137394_106538483 | 3300012922 | Vadose Zone Soil | AERASFVPGLSRPDAHSVKGSFHDMVEITKLLQVLTSLDTP* |
| Ga0137404_112722982 | 3300012929 | Vadose Zone Soil | ALEVGFKLTLDAERAAFVPGLTRSDAHNVKGTFHDMTDITKLLQVLTSLELP* |
| Ga0157372_112167742 | 3300013307 | Corn Rhizosphere | LTIDAERAAFVPGLSRLDAHDVKGTFGDMLQVTKLLQVLTSLELP* |
| Ga0134078_103038092 | 3300014157 | Grasslands Soil | ELEVGFKLTIDAERAAFVPGLSRSDAHNVKGSFKDMTEITKLLQVLTSLELP* |
| Ga0173483_107567202 | 3300015077 | Soil | FVPGLVRSDAHNVKGSFKDMIGITKLLQVLTSLEAP* |
| Ga0167651_10522052 | 3300015190 | Glacier Forefield Soil | KLTIDAERAAFVPGLTRSDAHNVKGTFADMVQITRLLQVLTSLELP* |
| Ga0182036_102076562 | 3300016270 | Soil | FKLTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP |
| Ga0134074_10474491 | 3300017657 | Grasslands Soil | IELEVGFKLTIDAERAAFVPGLSRSDAHNVKGSFKDMTEITKLLQVLTSLELP |
| Ga0184618_100697291 | 3300018071 | Groundwater Sediment | VGFKLTLDAERAAFVPGLARSDAHSVTGTFPDMIQITKLLQVVTSLQTP |
| Ga0184628_103078931 | 3300018083 | Groundwater Sediment | AERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP |
| Ga0222622_101504341 | 3300022756 | Groundwater Sediment | QPYRISGAIGLEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMIEISKLLQVLSSLEA |
| Ga0207697_100723142 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | EVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ |
| Ga0207684_110100482 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IDLEVGFKLTIDAERAAFVPGLARSDAHNVKGTFPDLTQITKLLQVVASLELQ |
| Ga0207646_103139651 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ERAAFIPGLARSDAHNVKGTFRDMTEVTKLLQVLTSLELP |
| Ga0207694_116095161 | 3300025924 | Corn Rhizosphere | FVPGLARSDAHNVKGTFHDMVEVTRLLQVLTSLELP |
| Ga0207687_102008312 | 3300025927 | Miscanthus Rhizosphere | IDLEVGFKLTLDAERAAFVPGLARSDAHSVKGTFHDMAEITRLLQVIGGLELP |
| Ga0207687_114790552 | 3300025927 | Miscanthus Rhizosphere | VTAPVALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ |
| Ga0207706_113618611 | 3300025933 | Corn Rhizosphere | RVRMPIDLEVGFKLTLDAERAAYVPGLTRSDAHSVKGTFHDMTEITRLLQVVGGLELP |
| Ga0207706_116673642 | 3300025933 | Corn Rhizosphere | VPGLTRSDAHNVRGSFKDMVEITKLLQVLTSLEAP |
| Ga0207691_102575593 | 3300025940 | Miscanthus Rhizosphere | GFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP |
| Ga0207711_101423373 | 3300025941 | Switchgrass Rhizosphere | AAFVPGLTRSDAHSVKGTFRDMTEITRLLQVLTSLELP |
| Ga0207677_122665421 | 3300026023 | Miscanthus Rhizosphere | RVTAPVALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ |
| Ga0207648_104395153 | 3300026089 | Miscanthus Rhizosphere | VPGLSRSGAHGVKGTFRDMTEITKLLQVLTSLELP |
| Ga0207675_1026708893 | 3300026118 | Switchgrass Rhizosphere | YRVRTPIDLEVGFKLTIDAERAAFVPGLARSDAHNVKGTFKELTEIMKLLQVVSSLEAP |
| Ga0207698_113512752 | 3300026142 | Corn Rhizosphere | VALEVGFKLTIDAERAAYVPGLSRADAHNVKGTFKDMVEVTKLLQVLTSFQ |
| Ga0209153_11226572 | 3300026312 | Soil | VALEVGFKLTIDAERAAFVPGLARSDAHNVKGTFHDLIEITKLLQVLTSLELP |
| Ga0209382_118034952 | 3300027909 | Populus Rhizosphere | RAAFVPGLTRSDAHNVKGSFKDMVEITKLLQVLTSLEAP |
| Ga0209526_105237743 | 3300028047 | Forest Soil | AAERAAFVPGLARSDAHNVKGTFTDMTQITKLLQVVASLELP |
| Ga0268265_108627042 | 3300028380 | Switchgrass Rhizosphere | LTGPVGLEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDVIEISKLLQVVSSLEAP |
| Ga0137415_100402853 | 3300028536 | Vadose Zone Soil | APIDLEVGFKLTIDAERASFIPGLSRPDAHTVKGSFRDMVEITKLLQVLTSLDTP |
| Ga0307282_102218942 | 3300028784 | Soil | TIDAERAAFVPGLVRSDAHNVKGSFKDMVEITKLLQVLTSLEAP |
| Ga0307305_100481971 | 3300028807 | Soil | LEVGFKLTLDAERAAFVPGLARSDAHSVTGTFPDMIQITKLLQVVTSLQTP |
| Ga0307296_104887371 | 3300028819 | Soil | ERAAFVPGLSRSDAHNVKGTFKDMIEITKLLQVVSSLEAP |
| Ga0307312_109703782 | 3300028828 | Soil | AFVPGLVRSDAHNVKGSFKDMVEITKLLQVLTSLEAP |
| Ga0308309_115433901 | 3300028906 | Soil | RLYRIAAPVQLDLGFKLTIDAERAAYVPGLTRVDAHNVRGTFPDVISIGKLIEVLVSLEA |
| Ga0318534_103755961 | 3300031544 | Soil | RLTPPIALEVGFKLTIDAERAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP |
| Ga0318538_106568152 | 3300031546 | Soil | GFKLTIDAERASFVPGLSRSDAHSVKGTFADMVQITKLLQVIANLEAP |
| Ga0310886_103083901 | 3300031562 | Soil | IALDVGFKLTIDAERAAYVPGLTRGDAHHVQGSFKTMVEITKLLQVLTSLEAP |
| Ga0318555_106575952 | 3300031640 | Soil | IDAERAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP |
| Ga0310813_119866381 | 3300031716 | Soil | GFKLTIDAERAAFVPGLTRSDAHSVKGTFKDMTEITKLLQVLTSFELP |
| Ga0307469_117137002 | 3300031720 | Hardwood Forest Soil | QPYRVQTPVALDVGFKLTIDAERAAFIPGLARSDAHNVKGTFKDMPEITKLLQVLTSLEL |
| Ga0310892_105143481 | 3300031858 | Soil | PIALEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP |
| Ga0306925_122543012 | 3300031890 | Soil | PIALEVGFKLTLDAERAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP |
| Ga0307407_101882642 | 3300031903 | Rhizosphere | LEVGFKLTLDAERASYIPGLKRVDAHAVAGTFPDMTACSRLLQVLSSLAPI |
| Ga0214473_113803391 | 3300031949 | Soil | LDAERAAFVPGLSRVDAHTVKGTFADMVPITKLLQVVTSLEQP |
| Ga0306926_100752911 | 3300031954 | Soil | KRAAFVPGLTRSDAHSVKGTFRDMTEITKLLQVLTSLELP |
| Ga0310903_103228962 | 3300032000 | Soil | FKLTIEAEIAAYLPGMSRSDAHNVKGTFHDMPEVTKLLQVLTSIQ |
| Ga0310902_111338672 | 3300032012 | Soil | ERAAFVPGLTRVDAHNVKGTFRDMPEVTRLLQVLTSFAAP |
| Ga0310906_109921361 | 3300032013 | Soil | ALDVGFKFTIDAERAAFVPGLMRSDAHNVKGSFKDMVEITRLLQVLTSLEAP |
| Ga0315281_121002522 | 3300032163 | Sediment | VLEVGFKLTLDAERAAFVPGLTRADAHNVKGTFRDMTDITKLLQVLTSLELP |
| Ga0310889_107633991 | 3300032179 | Soil | IDAERAAFVPGLSRSDAHNVKGTFKDMVEISKLLQVVSSLEAP |
| Ga0310889_107846172 | 3300032179 | Soil | IALEVGFKLTIDAERAAFVPGLSRSDAHNVKGTFKDMTEISKLLQVVSSLEAP |
| Ga0307471_1004049071 | 3300032180 | Hardwood Forest Soil | VGFKLTLDAERAAFVPGLVRSDAHSVKGTFPDMIQITKLLQVIASLERP |
| Ga0310896_106076881 | 3300032211 | Soil | TIDAERAAFVPGLARSDAHNVKGSFKDMVEITRLLQVLTSLEAP |
| Ga0335082_114775592 | 3300032782 | Soil | DLEVGFKLTLDAERASFVPGLTRADAHNVKGTFPDMTTITRLLQVVANLEMP |
| Ga0335070_106982651 | 3300032829 | Soil | PYTVRTPIDLEVGFKLTIDAERASFTPGLTRSDAHNVKGQFTDMVQITKLLQVIGNLEMP |
| Ga0335084_106363241 | 3300033004 | Soil | PYRIATPVQLDLGFKLTIDAERAAYVPGLTRTDAHNVRGTFPDLISIQKLILVLASLEAP |
| Ga0335084_114773762 | 3300033004 | Soil | YRLTTPIALEVGFKLTIDAERAAFVPGLSRVDAHMVKGTFRDMPEITKLLQVLTSFAAP |
| Ga0364930_0190489_8_157 | 3300033814 | Sediment | VGFKLTIDAERAAYIPGLTRVDAHTVRGTFPDLVTIVKLLHVLTSLEQP |
| Ga0373958_0154126_411_575 | 3300034819 | Rhizosphere Soil | PIALDVGFKLTIDAERAAFVPGLTRADAHNVKGSFKDMVEITKLLQVLTSLEAP |
| ⦗Top⦘ |