| Basic Information | |
|---|---|
| Family ID | F063780 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MAELAALELEHKAAAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIW |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.38 % |
| % of genes near scaffold ends (potentially truncated) | 98.45 % |
| % of genes from short scaffolds (< 2000 bps) | 92.25 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.264 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.008 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.233 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.209 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.21% β-sheet: 7.89% Coil/Unstructured: 57.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF03466 | LysR_substrate | 51.94 |
| PF00126 | HTH_1 | 38.76 |
| PF06073 | DUF934 | 2.33 |
| PF01077 | NIR_SIR | 1.55 |
| PF03328 | HpcH_HpaI | 0.78 |
| PF13241 | NAD_binding_7 | 0.78 |
| PF01507 | PAPS_reduct | 0.78 |
| PF07394 | DUF1501 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG3749 | Uncharacterized conserved protein, DUF934 family | Function unknown [S] | 2.33 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.78 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.26 % |
| Unclassified | root | N/A | 45.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001179|JGI12660J13575_103576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300001545|JGI12630J15595_10035906 | Not Available | 1013 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100161277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2120 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100857532 | Not Available | 790 | Open in IMG/M |
| 3300002916|JGI25389J43894_1016319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1279 | Open in IMG/M |
| 3300003152|Ga0052254_1056601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 591 | Open in IMG/M |
| 3300003911|JGI25405J52794_10103077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300005171|Ga0066677_10132830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1349 | Open in IMG/M |
| 3300005329|Ga0070683_101006405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300005335|Ga0070666_10769632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 708 | Open in IMG/M |
| 3300005336|Ga0070680_100062944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3039 | Open in IMG/M |
| 3300005341|Ga0070691_10095740 | Not Available | 1469 | Open in IMG/M |
| 3300005345|Ga0070692_10759307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300005435|Ga0070714_102510369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300005536|Ga0070697_101452195 | Not Available | 613 | Open in IMG/M |
| 3300005548|Ga0070665_100331497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1526 | Open in IMG/M |
| 3300005549|Ga0070704_100543400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300005578|Ga0068854_101065586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300005578|Ga0068854_101918789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 545 | Open in IMG/M |
| 3300005591|Ga0070761_10829815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300005616|Ga0068852_102207645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 572 | Open in IMG/M |
| 3300005617|Ga0068859_103075884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300005842|Ga0068858_101801385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300006237|Ga0097621_102135550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 536 | Open in IMG/M |
| 3300006579|Ga0074054_11506772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300006794|Ga0066658_10859025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300006804|Ga0079221_10483788 | Not Available | 797 | Open in IMG/M |
| 3300006852|Ga0075433_10442201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1146 | Open in IMG/M |
| 3300006854|Ga0075425_102515082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300007265|Ga0099794_10409355 | Not Available | 709 | Open in IMG/M |
| 3300007788|Ga0099795_10351636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 659 | Open in IMG/M |
| 3300009093|Ga0105240_11246309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 786 | Open in IMG/M |
| 3300009098|Ga0105245_11754821 | Not Available | 673 | Open in IMG/M |
| 3300009551|Ga0105238_10228541 | Not Available | 1837 | Open in IMG/M |
| 3300009551|Ga0105238_11183052 | Not Available | 789 | Open in IMG/M |
| 3300009650|Ga0105857_1260385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 522 | Open in IMG/M |
| 3300010040|Ga0126308_11188857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 539 | Open in IMG/M |
| 3300010361|Ga0126378_13055806 | Not Available | 533 | Open in IMG/M |
| 3300010371|Ga0134125_11194906 | Not Available | 831 | Open in IMG/M |
| 3300010376|Ga0126381_100274621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 2296 | Open in IMG/M |
| 3300010376|Ga0126381_101247915 | Not Available | 1074 | Open in IMG/M |
| 3300010396|Ga0134126_11667429 | Not Available | 700 | Open in IMG/M |
| 3300010396|Ga0134126_12978972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 512 | Open in IMG/M |
| 3300010397|Ga0134124_12665778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 543 | Open in IMG/M |
| 3300012285|Ga0137370_10170503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1266 | Open in IMG/M |
| 3300012582|Ga0137358_10781181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 636 | Open in IMG/M |
| 3300012924|Ga0137413_10594005 | Not Available | 827 | Open in IMG/M |
| 3300014150|Ga0134081_10332099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 553 | Open in IMG/M |
| 3300014326|Ga0157380_13263370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 518 | Open in IMG/M |
| 3300014501|Ga0182024_10457084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1635 | Open in IMG/M |
| 3300015054|Ga0137420_1226764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 510 | Open in IMG/M |
| 3300015372|Ga0132256_103837475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 505 | Open in IMG/M |
| 3300016319|Ga0182033_10958205 | Not Available | 760 | Open in IMG/M |
| 3300016319|Ga0182033_11083311 | Not Available | 715 | Open in IMG/M |
| 3300016422|Ga0182039_10094100 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300016445|Ga0182038_12021308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 522 | Open in IMG/M |
| 3300017948|Ga0187847_10392942 | Not Available | 762 | Open in IMG/M |
| 3300017959|Ga0187779_11331871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 509 | Open in IMG/M |
| 3300017972|Ga0187781_10085321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2184 | Open in IMG/M |
| 3300017974|Ga0187777_11183918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 558 | Open in IMG/M |
| 3300017975|Ga0187782_11217685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 589 | Open in IMG/M |
| 3300018058|Ga0187766_10143370 | Not Available | 1478 | Open in IMG/M |
| 3300018433|Ga0066667_12051437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 527 | Open in IMG/M |
| 3300019888|Ga0193751_1260534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 526 | Open in IMG/M |
| 3300021168|Ga0210406_10037027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4362 | Open in IMG/M |
| 3300021178|Ga0210408_10645975 | Not Available | 836 | Open in IMG/M |
| 3300021401|Ga0210393_10353206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1197 | Open in IMG/M |
| 3300021402|Ga0210385_10893741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 682 | Open in IMG/M |
| 3300021420|Ga0210394_11830326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 505 | Open in IMG/M |
| 3300021474|Ga0210390_11568376 | Not Available | 519 | Open in IMG/M |
| 3300021479|Ga0210410_10230787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1659 | Open in IMG/M |
| 3300021560|Ga0126371_10597515 | Not Available | 1252 | Open in IMG/M |
| 3300021560|Ga0126371_13691622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 516 | Open in IMG/M |
| 3300022507|Ga0222729_1071569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300023268|Ga0247765_1134936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 530 | Open in IMG/M |
| 3300025909|Ga0207705_10479470 | Not Available | 965 | Open in IMG/M |
| 3300025913|Ga0207695_10874601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 778 | Open in IMG/M |
| 3300026118|Ga0207675_101300022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 748 | Open in IMG/M |
| 3300026142|Ga0207698_12476641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 529 | Open in IMG/M |
| 3300027502|Ga0209622_1090381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 561 | Open in IMG/M |
| 3300027643|Ga0209076_1114094 | Not Available | 764 | Open in IMG/M |
| 3300027894|Ga0209068_10312586 | Not Available | 884 | Open in IMG/M |
| 3300030503|Ga0311370_11671717 | Not Available | 655 | Open in IMG/M |
| 3300030520|Ga0311372_11283100 | Not Available | 927 | Open in IMG/M |
| 3300030906|Ga0302314_10839099 | Not Available | 912 | Open in IMG/M |
| 3300031543|Ga0318516_10108431 | Not Available | 1574 | Open in IMG/M |
| 3300031544|Ga0318534_10373077 | Not Available | 820 | Open in IMG/M |
| 3300031545|Ga0318541_10426175 | Not Available | 742 | Open in IMG/M |
| 3300031545|Ga0318541_10557584 | Not Available | 641 | Open in IMG/M |
| 3300031616|Ga0307508_10634713 | Not Available | 672 | Open in IMG/M |
| 3300031668|Ga0318542_10574974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 587 | Open in IMG/M |
| 3300031708|Ga0310686_101614343 | Not Available | 857 | Open in IMG/M |
| 3300031744|Ga0306918_10482205 | Not Available | 970 | Open in IMG/M |
| 3300031747|Ga0318502_10207621 | Not Available | 1134 | Open in IMG/M |
| 3300031768|Ga0318509_10136428 | Not Available | 1347 | Open in IMG/M |
| 3300031769|Ga0318526_10136320 | Not Available | 995 | Open in IMG/M |
| 3300031777|Ga0318543_10197876 | Not Available | 892 | Open in IMG/M |
| 3300031778|Ga0318498_10156978 | Not Available | 1036 | Open in IMG/M |
| 3300031779|Ga0318566_10545226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 567 | Open in IMG/M |
| 3300031780|Ga0318508_1224205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 539 | Open in IMG/M |
| 3300031793|Ga0318548_10031281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2337 | Open in IMG/M |
| 3300031797|Ga0318550_10293974 | Not Available | 788 | Open in IMG/M |
| 3300031821|Ga0318567_10156447 | Not Available | 1262 | Open in IMG/M |
| 3300031833|Ga0310917_10177324 | Not Available | 1418 | Open in IMG/M |
| 3300031860|Ga0318495_10213343 | Not Available | 868 | Open in IMG/M |
| 3300031894|Ga0318522_10094733 | Not Available | 1101 | Open in IMG/M |
| 3300031912|Ga0306921_11348369 | Not Available | 787 | Open in IMG/M |
| 3300031946|Ga0310910_11493593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 518 | Open in IMG/M |
| 3300031962|Ga0307479_10949012 | Not Available | 831 | Open in IMG/M |
| 3300032008|Ga0318562_10365839 | Not Available | 838 | Open in IMG/M |
| 3300032010|Ga0318569_10142729 | Not Available | 1099 | Open in IMG/M |
| 3300032039|Ga0318559_10575924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 525 | Open in IMG/M |
| 3300032042|Ga0318545_10072089 | Not Available | 1189 | Open in IMG/M |
| 3300032042|Ga0318545_10131064 | Not Available | 887 | Open in IMG/M |
| 3300032044|Ga0318558_10039753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2034 | Open in IMG/M |
| 3300032054|Ga0318570_10046396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1789 | Open in IMG/M |
| 3300032059|Ga0318533_10374881 | Not Available | 1038 | Open in IMG/M |
| 3300032064|Ga0318510_10230576 | Not Available | 756 | Open in IMG/M |
| 3300032089|Ga0318525_10105188 | Not Available | 1440 | Open in IMG/M |
| 3300032180|Ga0307471_102646968 | Not Available | 636 | Open in IMG/M |
| 3300032261|Ga0306920_100307953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2358 | Open in IMG/M |
| 3300032261|Ga0306920_103188016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 614 | Open in IMG/M |
| 3300032893|Ga0335069_10045669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5798 | Open in IMG/M |
| 3300032898|Ga0335072_11345746 | Not Available | 622 | Open in IMG/M |
| 3300033134|Ga0335073_10872848 | Not Available | 952 | Open in IMG/M |
| 3300033158|Ga0335077_11388711 | Not Available | 677 | Open in IMG/M |
| 3300033289|Ga0310914_11001275 | Not Available | 736 | Open in IMG/M |
| 3300033290|Ga0318519_10741665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 602 | Open in IMG/M |
| 3300034384|Ga0372946_0140002 | Not Available | 1152 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.55% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.78% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.78% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001179 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023268 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6 | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12660J13575_1035762 | 3300001179 | Forest Soil | MGEVAALELEHKATAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIWSYLP |
| JGI12630J15595_100359061 | 3300001545 | Forest Soil | MGDLAALELEHKAAAVRTQLTAALGQHGRLVYSNS |
| JGIcombinedJ26739_1001612771 | 3300002245 | Forest Soil | MGDLAALELEHKAAAVRTQLTAALGQHGRLVYSNSLGAEAMVLTDI |
| JGIcombinedJ26739_1008575321 | 3300002245 | Forest Soil | MGELLNLELEQKAVGVRERLAAAIQEYGRVIYSSSLGAESVV |
| JGI25389J43894_10163192 | 3300002916 | Grasslands Soil | MGDLAALELEHKAAAVRTLLTGALGQHGRLVYSNSLGAEAMVLTDI |
| Ga0052254_10566011 | 3300003152 | Sediment | MRGLPPIVLATMGELLNLELEQKATAVRERLAAAVAEYGKIVYSSSLGAEAIVLTDIIW |
| JGI25405J52794_101030771 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MGDVLTLELEQKAAAVRDQLAAAVQEYGRVVYSNSLGAEAMVLTDII |
| Ga0066677_101328301 | 3300005171 | Soil | MAELTALGLERKAAAVHAQLAAALARHGRLVYSNSLGAEAMVLTDIIATQL |
| Ga0070683_1010064052 | 3300005329 | Corn Rhizosphere | MGELLNLDLDLEQKASAVREQLSAAVRQYGRVIYSNSLGAEAMVLTDIIWSHV |
| Ga0070666_107696321 | 3300005335 | Switchgrass Rhizosphere | MGGPEPIVPPTMGELLNLELEQKAIAVRERLHSAVAEYGRVVYSSSLGAESVVLTDIIWSHVPGID |
| Ga0070680_1000629441 | 3300005336 | Corn Rhizosphere | MGELLNLDLDLEQKASAVREQLSAAVCQYGRVIYSNSLGAEAMVLTDIIWSH |
| Ga0070691_100957402 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MGELLNLDLDLEQKASAVREQLSAAVCQYGRVIYSNSLARKPWC* |
| Ga0070692_107593071 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDVLTLELEQKAAAVRDALQAAVRDHGRVVYSNSLGAEAMVLTDI |
| Ga0070714_1025103691 | 3300005435 | Agricultural Soil | MRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMVLTDIIW |
| Ga0070697_1014521952 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEVAALELEHKAAAVRAQLAAALGQHGRLVYSNSLGAEAMVL |
| Ga0070665_1003314973 | 3300005548 | Switchgrass Rhizosphere | MRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMVLTDI |
| Ga0070704_1005434001 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMV |
| Ga0068854_1010655861 | 3300005578 | Corn Rhizosphere | MGELLNLELEQKAVAVRERLAAAVAEYGRVIYSSSLGAESIVLTDI |
| Ga0068854_1019187892 | 3300005578 | Corn Rhizosphere | MGELLNLDLDLEQKASAVREQLSAAVCQYGRVIYSNSLGAEAMVLT |
| Ga0070761_108298152 | 3300005591 | Soil | MGALAGVEIERKAAAVRSLLGEALERHGRLIYANSLGAEAMVLTD |
| Ga0068852_1022076451 | 3300005616 | Corn Rhizosphere | MRDPTSAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMVLTD |
| Ga0068859_1030758841 | 3300005617 | Switchgrass Rhizosphere | MGDVLTLELEQKAAAVRDTLASGVQQYGRVVYSNSLGAEAMVLTDIICGH |
| Ga0068858_1018013852 | 3300005842 | Switchgrass Rhizosphere | VAIVHRIMGELLTLELEQKATAVREHLAAAVREHGRVVYSNSLGAEAMVLTDIIW |
| Ga0097621_1021355502 | 3300006237 | Miscanthus Rhizosphere | MGDVLTLELEQKAAAVRDTLASGVQQYGRVVYSNSLGAEA |
| Ga0074054_115067722 | 3300006579 | Soil | MRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGAE |
| Ga0066658_108590251 | 3300006794 | Soil | MAELTALGLERKAAAVHAQLAAALARHGRLVYSNSLGAEAMVLTDIIAT |
| Ga0079221_104837881 | 3300006804 | Agricultural Soil | MGNLLNLDLEQKAVSVREQLAAAVRDHGRVIYSNSLG |
| Ga0075433_104422011 | 3300006852 | Populus Rhizosphere | MPELEHKAAAVRALLGRALAQHGRLAYANSLGAEAMVLTD |
| Ga0075425_1025150821 | 3300006854 | Populus Rhizosphere | MAELPIADLKQKAAAVRALLGRALEQHARLAYANSLGAEAMVLTDIIWT |
| Ga0099794_104093551 | 3300007265 | Vadose Zone Soil | MAEVAALELEHKAAAVRAQLVAALGLHRRLVYSNS |
| Ga0099795_103516362 | 3300007788 | Vadose Zone Soil | MGEVLTLDLEQKAVSVRDQLAAAVQAYGRVVYSNSLGAEAMVLTDIIWTH |
| Ga0105240_112463091 | 3300009093 | Corn Rhizosphere | MGELLNLELEQKAVAVRERLAAAVSEYGRVVYSSSLGAESIV |
| Ga0105245_117548212 | 3300009098 | Miscanthus Rhizosphere | MGDVLTLELEQKALATREALQSAVQQFGKVVYSNSLGAEAMVLTDIIWTHF |
| Ga0105238_102285411 | 3300009551 | Corn Rhizosphere | MGELLNLELEQKAVAVRERLAAAVAEYGRVVYSSSLGAESIVLT |
| Ga0105238_111830522 | 3300009551 | Corn Rhizosphere | MGELLNLELEQKAAAVRERLAAAVAEYGKVVYSSSLGAEAIDLTDIIWTHV |
| Ga0105857_12603851 | 3300009650 | Permafrost Soil | MGEVLSLDLENKAVAVRQFLGAALREHGRVVYASSLGAEAM |
| Ga0126308_111888571 | 3300010040 | Serpentine Soil | MGEVLTLELEQKAGAARELLASAVRQYGKVVYSNSLG |
| Ga0126378_130558062 | 3300010361 | Tropical Forest Soil | MMGESPKSGLERKAADVRVFLGNALAEHGRLVYANSLGAEAMVLTDLIWSHLPE |
| Ga0134125_111949062 | 3300010371 | Terrestrial Soil | MGELLNLELEQKAAAVRERLAAAVAEYGKVIYSSSLGAEAIVL |
| Ga0126381_1002746216 | 3300010376 | Tropical Forest Soil | MAELAVTDLEQMTAAVRALLSSALARHGRLVYSNSLGAEAMVLTDI |
| Ga0126381_1012479152 | 3300010376 | Tropical Forest Soil | MAELAALELEQKAAAVRALLGSALAQYGRLVYSNSLG |
| Ga0134126_116674291 | 3300010396 | Terrestrial Soil | MGELLNLDLEQKAVDVREQLLAAVRDHGRVVYSNSLGAEAMVLTDII |
| Ga0134126_129789721 | 3300010396 | Terrestrial Soil | MGELLTLELEQKAISVREQLAAAVQEYGRVVYSNSL |
| Ga0134124_126657781 | 3300010397 | Terrestrial Soil | MAELPIADLEQKAAAVRALLGSALEQHARLAYANSLGAE |
| Ga0137370_101705033 | 3300012285 | Vadose Zone Soil | MGELAALELEHKAAAVRAQLAGALGPHGRLVYSNSRGAEAMVLTDIIWSYLP |
| Ga0137358_107811812 | 3300012582 | Vadose Zone Soil | MAELAALELEHKATAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIWSYLPQID |
| Ga0137413_105940051 | 3300012924 | Vadose Zone Soil | MGELLNLELEQKVAAVRERLAAAVGEYGRVVYSNSLGAEAMVLTDIIWSNVPE |
| Ga0134081_103320991 | 3300014150 | Grasslands Soil | MGDLAALELEHKAAAVRTLLTGALGQHGRLVYSNSLGAEAMV |
| Ga0157380_132633702 | 3300014326 | Switchgrass Rhizosphere | MGEVLTLELEQKAIAVREMLADAVQQYGKVIYSNSL |
| Ga0182024_104570841 | 3300014501 | Permafrost | MAAVLSRELEQKAGAVRAGLAAALHQYGRLIYSNSLGAEAMVLTDII |
| Ga0137420_12267641 | 3300015054 | Vadose Zone Soil | MAELAALELEHKATAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIWSHLVVP |
| Ga0132256_1038374752 | 3300015372 | Arabidopsis Rhizosphere | MRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGA |
| Ga0182033_109582052 | 3300016319 | Soil | MPELDQKAATVRSLLGAALAQHGRLAYANSLGAEAMVLTDIIW |
| Ga0182033_110833111 | 3300016319 | Soil | MAELATADLEQKAAGVSALLGHALARYGRLVYANSL |
| Ga0182039_100941004 | 3300016422 | Soil | MAELPATDLEQKAAAVRALLGRALAQHGRLVYANSLGAEAMVLTDI |
| Ga0182038_120213082 | 3300016445 | Soil | MAELPATDLEQKAAAVRALLGRALAQHGRLVYANSLGAEAMVLTDIIW |
| Ga0187847_103929421 | 3300017948 | Peatland | MAQILTLELESKAVQVRDFLTAAVQKYGRLVYANSLGAEAMVLTDIICNS |
| Ga0187779_113318711 | 3300017959 | Tropical Peatland | MGELASVDLEHKAAAVRELLAEALAEHGRLVYSNS |
| Ga0187781_100853211 | 3300017972 | Tropical Peatland | MAELRQLEQQADAVRALLADALAQHGRLVYANSLGAEAMV |
| Ga0187777_111839181 | 3300017974 | Tropical Peatland | MAELTPELERQAAALRRLLTEALARYGRLVYSNSLGAEAMV |
| Ga0187782_112176851 | 3300017975 | Tropical Peatland | MAELTKQQLEYRAAAVRSELAAALTQHGRLVYANSL |
| Ga0187766_101433701 | 3300018058 | Tropical Peatland | MAELPTADLEQKVADVRAVLGRALAQHRRLVYANSLGAEAM |
| Ga0066667_120514371 | 3300018433 | Grasslands Soil | MGELLTLELEQKAIAVREQLAAAVQEYGRVVYSNSLGAEAM |
| Ga0193751_12605341 | 3300019888 | Soil | MPIVRGTMADLPSAELETKAAAVRGLLAEALARHGRLVYANSLGAEAVVLTDIIWSHL |
| Ga0210406_100370276 | 3300021168 | Soil | MPEVEHKAAVARELLGRALAQHGELVYANSLGAEAMV |
| Ga0210408_106459751 | 3300021178 | Soil | MREPTTTGLELLASATRERLSAALARHGRLVYSNSLGAEAIVLTDIIWSH |
| Ga0210393_103532062 | 3300021401 | Soil | MAQILTLELESKAAQVREFLSAAVQRFGRVVYANSLGAEAMVLTDII |
| Ga0210385_108937412 | 3300021402 | Soil | MGEVLNLELEQKVVAVRERLAAAVQEYGRVIYSSSLGAESVVLTDIIWTHFPTID |
| Ga0210394_118303262 | 3300021420 | Soil | MAVLLSRELKHKAEAVRAGLAAALDSYGRLIYSNSLGAEAMVLTDIIWSHLPQIEI |
| Ga0210390_115683761 | 3300021474 | Soil | MRERLNLDLEQKAAGVRERLAAAVRAHGRVTYSNSLGAEAMVL |
| Ga0210410_102307871 | 3300021479 | Soil | MTIVASIMGELTAFGWAHKAANVRARLAAALARHGRLVYSNSLGAEAMV |
| Ga0126371_105975151 | 3300021560 | Tropical Forest Soil | MAELAALELEQKAAAVRALLGSALAQYGRLVYSNSLGAEAMVLTDIIW |
| Ga0126371_136916221 | 3300021560 | Tropical Forest Soil | MLAIVGPTMAELPTPELEQKAATVRTLLEGALGRHGQLVYANSLGAEAMVLTDIIWTH |
| Ga0222729_10715692 | 3300022507 | Soil | LNLELEQKAVTVRERLAAAVQEYGRVVYSSSLGAESVVLTDIIWTICRQ |
| Ga0247765_11349361 | 3300023268 | Plant Litter | MAQLSALELETKAAAVRELLTASVREHGKVVYANSLGAEAMV |
| Ga0207705_104794701 | 3300025909 | Corn Rhizosphere | MGELLNLDLDLEQKASAVREQLSAAVCQYGRVIYSNSLGAEAMVLTDII |
| Ga0207695_108746011 | 3300025913 | Corn Rhizosphere | MGELLNLELEQKAVAVRERLAAAVSEYGRVVYSSSLGAE |
| Ga0207675_1013000221 | 3300026118 | Switchgrass Rhizosphere | MGEVLTLELEQKAIAVREMLADAVQQYGKVIYSNSLGAE |
| Ga0207698_124766412 | 3300026142 | Corn Rhizosphere | MRDPTSAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMVLTDIIWTHFPA |
| Ga0209622_10903811 | 3300027502 | Forest Soil | MAELPTPELEQKAATVRALLEGALERHGHLVYANSLG |
| Ga0209076_11140941 | 3300027643 | Vadose Zone Soil | MAELAALELEHKAAAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIW |
| Ga0209068_103125862 | 3300027894 | Watersheds | MGKLATLELEDRTAQVRAQLAAALEQHGRLIYSNSLGAES |
| Ga0311370_116717172 | 3300030503 | Palsa | MAQILTLELEAKAAQVREFLAGMVQQYGRVVYANSLGAEAMVLTDII |
| Ga0311372_112831002 | 3300030520 | Palsa | MGELLNLELEQKAIAVRERLAAAVENYGRVVYSSSLGAESVVLTDI |
| Ga0302314_108390991 | 3300030906 | Palsa | MGELLNLELEQKAIAVRERLAAAVENYGRVVYSSSLGAESV |
| Ga0318516_101084311 | 3300031543 | Soil | MAQLPIADLEQKAAAVRALLGRALEQHGRLAYANSLGAEAMVLTDIIWRDLPK |
| Ga0318534_103730771 | 3300031544 | Soil | MAQLPIADLEHKAAAVRALLGRALEQHGRLAYANSLGA |
| Ga0318541_104261751 | 3300031545 | Soil | MAELVTPDLELQRKAADVRGLLAGALDRHGRLVYANSLGAEAIVLTDIIWTHLP |
| Ga0318541_105575842 | 3300031545 | Soil | MPDLSTPELENKAAAVGALLRRALAQYGRLVYANSLG |
| Ga0307508_106347131 | 3300031616 | Ectomycorrhiza | MGELLTLELEQKAVAVREQLAAAVQEFGRVVYSNSLGAEAMVLTDIIWPHVP |
| Ga0318542_105749742 | 3300031668 | Soil | MAEVPTADLEQKAAGVTALLGLALGSYGRLVYANSLGAEAMVLTDIIWTHL |
| Ga0310686_1016143432 | 3300031708 | Soil | MAAVLSRELEQKAGAVRAGLAAALHQYGRLIYSNSLGAEAMVLTDIIW |
| Ga0306918_104822051 | 3300031744 | Soil | MAELPTVELERKAAGVRSLLEDALARHGRLVYSNSLGAEAMVLTDII |
| Ga0318502_102076211 | 3300031747 | Soil | MPELEKKAAAVRSLLAAASSQHGRLVYANSLGAEAMVLTDIIW |
| Ga0318509_101364282 | 3300031768 | Soil | MAELPTVELEEKAAGVRALLGDALARHGRLVYANSL |
| Ga0318526_101363201 | 3300031769 | Soil | MGELPTPGLEQKAAAVRDLLERALARHGRLVYANSLGAEAMAL |
| Ga0318543_101978761 | 3300031777 | Soil | MPELEQKAAAVRSLLAAASSQHGRLVYANSLGAEA |
| Ga0318498_101569781 | 3300031778 | Soil | MPELEQKAAAVRSLLAAASSQHGRLVYANSLGAEAMVLTDII |
| Ga0318566_105452262 | 3300031779 | Soil | MGELPTPGLEQKAAAVRDLLERALARHGRLVYANSLGAEAMALTDII |
| Ga0318508_12242052 | 3300031780 | Soil | MQELEQKAAAVRTLLEAALAQHGRLVYANSLGAEAMV |
| Ga0318548_100312813 | 3300031793 | Soil | MPELEQKATAARLLLHRALGEHGRLVYSNSLGAEAMA |
| Ga0318550_102939742 | 3300031797 | Soil | MGELPTPGLEQKAAAVRDLLERALALHGRLVYANSLGAEAMAL |
| Ga0318567_101564471 | 3300031821 | Soil | MQELEQKAAAVRTLLEAALAQHGRLVYANSLGAEAMVLTDIIWTDLP |
| Ga0310917_101773243 | 3300031833 | Soil | MAELPTVELEEKAAGVRALLGDALARHGRLVYANSLGAEAMVLTDL |
| Ga0318495_102133431 | 3300031860 | Soil | MPELEQKAADVRALLGRTLAEHGRLVYANSLGAEAMVLT |
| Ga0318522_100947332 | 3300031894 | Soil | MAELPATDLEQKAAAVRALLGRALAQHGRLVYANSLGAEAMVLTDIDC |
| Ga0306921_113483692 | 3300031912 | Soil | MAELPTAELEEKAAGVRALLGYALARHGRLVYANSLGAEAMVLTDI |
| Ga0310910_114935931 | 3300031946 | Soil | MAVLPMPELEPKATAARLLLRRALGEHGRLVYSNSLGAEAMVLTDII |
| Ga0307479_109490122 | 3300031962 | Hardwood Forest Soil | MGELLTLELEQKATAVREQLAAAVQEYGRVVYSNSL |
| Ga0318562_103658391 | 3300032008 | Soil | MQELEQKAAAVRTLLEAALAQHGRLVYANSLGAEAMVLTDIIW |
| Ga0318569_101427292 | 3300032010 | Soil | MPELEQKAAAVRSLLAAASSQHGRLVYANSLGAEAMVLTDI |
| Ga0318559_105759241 | 3300032039 | Soil | MPELEQKATAARLLLRRALGEHGRLVYSNSLGAEAMVLTDIIW |
| Ga0318545_100720891 | 3300032042 | Soil | MPELEPKATAARLLLRRALGEHGRLVYSNSLGAEAMVLTDIIWT |
| Ga0318545_101310642 | 3300032042 | Soil | MAQLPIADLEHKAAAVRALLGRALEQHGRLAYANSLGAEAMVLTDINWR |
| Ga0318558_100397531 | 3300032044 | Soil | MPELDQKAATVRSLLGAALAQHGRLAYANSLGAEAM |
| Ga0318570_100463961 | 3300032054 | Soil | MQELEQKAAAVRTLLEAALAQHGRLVYANSLGAEAMVLTDII |
| Ga0318533_103748812 | 3300032059 | Soil | MPELEPKATAARLLLRRALGEHGRLVYSNSLGAEAMVLTD |
| Ga0318510_102305761 | 3300032064 | Soil | MAELPATDLEQKAAAVRALLGRALAQHGRLVYANSLGAE |
| Ga0318525_101051881 | 3300032089 | Soil | MAELPTVELERKAAGVRSLLEDALARHGRLVYSNSLGAEAMVLTD |
| Ga0307471_1026469681 | 3300032180 | Hardwood Forest Soil | MGDLAALELEDKAAAVRTQLADALAHHGRLVYSNSLGAEAMVLTDIIWSHLPQ |
| Ga0306920_1003079534 | 3300032261 | Soil | MAVLPMPELEQKATAARLLLRRALGEHGRLVYSNSLGAEAMVL |
| Ga0306920_1031880161 | 3300032261 | Soil | MAELAALGLEQRAAAVRELLGSALARFGRLVYSNSLGAEAMVLTDII |
| Ga0335069_100456699 | 3300032893 | Soil | MGAVLTLELEQRAAAVREQLKAALREHGRVVYSNSLGAEAMVLTDIIWTG |
| Ga0335072_113457461 | 3300032898 | Soil | MGDLLNLDLEQKAHGVRERLAAAVREHGRVTYSNSLGAEAMV |
| Ga0335073_108728482 | 3300033134 | Soil | VGQVLTLDLESKAAAARELLMAAAREYGRVVYANSLGLEAMVLTDIIGSHL |
| Ga0335077_113887111 | 3300033158 | Soil | MGELASAELEQKAASVRELLAEALAEYGRLVYSNSLGAEAM |
| Ga0310914_110012751 | 3300033289 | Soil | MAELVTPDLELQRKAADVRGLLAGALDRHGRLVYANSLGAEAIVLTDIIWTHLPQI |
| Ga0318519_107416652 | 3300033290 | Soil | MAELATPDLELQRKAADVRELLAGALGRHGRLVYANSLGAEAIVLTDII |
| Ga0372946_0140002_1039_1152 | 3300034384 | Soil | MGELLTLELEQKAVAVREQLAAAVQEYGRVVYSNSLGA |
| ⦗Top⦘ |