Metagenome Family F063738

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F063738
Family Type	Metagenome
Number of Sequences	129
Average Sequence Length	47 residues
Representative Sequence	GVWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE
Number of Associated Samples	115
Number of Associated Scaffolds	129

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.55 %
% of genes near scaffold ends (potentially truncated)	93.80 %
% of genes from short scaffolds (< 2000 bps)	88.37 %
Associated GOLD sequencing projects	104
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (89.922 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.853 % of family members)
Environment Ontology (ENVO)	Unclassified (37.209 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (66.667 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 11.11% Coil/Unstructured: 88.89%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.29
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 129 Family Scaffolds
PF06537	DHOR	4.65
PF01401	Peptidase_M2	3.10
PF01476	LysM	2.33
PF03972	MmgE_PrpD	2.33
PF07452	CHRD	1.55
PF00583	Acetyltransf_1	1.55
PF00892	EamA	1.55
PF02540	NAD_synthase	1.55
PF02882	THF_DHG_CYH_C	1.55
PF05195	AMP_N	0.78
PF00591	Glycos_transf_3	0.78
PF00753	Lactamase_B	0.78
PF02518	HATPase_c	0.78
PF07690	MFS_1	0.78
PF16561	AMPK1_CBM	0.78
PF00350	Dynamin_N	0.78
PF00575	S1	0.78
PF02021	UPF0102	0.78
PF00924	MS_channel	0.78
PF04909	Amidohydro_2	0.78
PF01272	GreA_GreB	0.78
PF01565	FAD_binding_4	0.78
PF01494	FAD_binding_3	0.78
PF13570	PQQ_3	0.78
PF00903	Glyoxalase	0.78
PF13483	Lactamase_B_3	0.78
PF13523	Acetyltransf_8	0.78
PF00092	VWA	0.78
PF00106	adh_short	0.78

COG ID	Name	Functional Category	% Frequency in 129 Family Scaffolds
COG3488	Uncharacterized conserved protein with two CxxC motifs, DUF1111 family	General function prediction only [R]	4.65
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	2.33
COG0171	NH3-dependent NAD+ synthetase	Coenzyme transport and metabolism [H]	1.55
COG0190	5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase	Coenzyme transport and metabolism [H]	1.55
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.55
COG0686	Alanine dehydrogenase (includes sporulation protein SpoVN)	Amino acid transport and metabolism [E]	1.55
COG0006	Xaa-Pro aminopeptidase	Amino acid transport and metabolism [E]	0.78
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.78
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.78
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.78
COG0668	Small-conductance mechanosensitive channel	Cell wall/membrane/envelope biogenesis [M]	0.78
COG0782	Transcription elongation factor, GreA/GreB family	Transcription [K]	0.78
COG0792	Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family	Replication, recombination and repair [L]	0.78
COG3264	Small-conductance mechanosensitive channel MscK	Cell wall/membrane/envelope biogenesis [M]	0.78

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	89.92 %
Unclassified	root	N/A	10.08 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	89.92 %
Unclassified	root	N/A	10.08 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	89.92 %
Unclassified	root	N/A	10.08 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	13.18 %
Unclassified	root	N/A	10.08 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	4.65 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.33 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.08 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	6.98 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2.33 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.55 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	0.78 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.98 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	1.55 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.55 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	0.78 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.78 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	0.78 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.78 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.98 %
Gemmatimonadetes bacterium 13_1_40CM_2_60_3	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3	1.55 %
Devosiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae	0.78 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	0.78 %
Thermoleophilales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales	0.78 %
unclassified Xanthomonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales	0.78 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.78 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.98 %
Gemmatimonadetes bacterium 13_1_40CM_2_60_3	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3	1.55 %
Nocardiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae	0.78 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.78 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	0.78 %
Pseudoroseicyclus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus	0.78 %
Thermoleophilaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae	0.78 %
Devosia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia	0.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.98 %
Gemmatimonadetes bacterium 13_1_40CM_2_60_3	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3	1.55 %
unclassified Thermoleophilaceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae	0.78 %
Pseudoroseicyclus tamaricis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	0.78 %
unclassified Luteitalea	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea	0.78 %
Rhodococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus	0.78 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.78 %
Devosia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia	0.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.98 %
Gemmatimonadetes bacterium 13_1_40CM_2_60_3	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3	1.55 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	0.78 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.78 %
unclassified Rhodococcus	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus	0.78 %
Pseudoroseicyclus tamaricis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	0.78 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.78 %
Devosia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia	0.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.98 %
Gemmatimonadetes bacterium 13_1_40CM_2_60_3	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3	1.55 %
Rhodococcus sp. DK17	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. DK17	0.78 %
Thermoleophilaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	0.78 %
Luteitalea sp.	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	0.78 %
Pseudoroseicyclus tamaricis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	0.78 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.78 %
Devosia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia	0.78 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.78 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000953\|JGI11615J12901_14495220	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300001850\|RCM37_1046090	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300003324\|soilH2_10019203	All Organisms → cellular organisms → Bacteria → Proteobacteria	7751	Open in IMG/M
3300004479\|Ga0062595_100866919	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300005093\|Ga0062594_100824410	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300005172\|Ga0066683_10296482	All Organisms → cellular organisms → Bacteria	1005	Open in IMG/M
3300005218\|Ga0068996_10146396	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300005290\|Ga0065712_10157452	Not Available	1317	Open in IMG/M
3300005354\|Ga0070675_100078101	All Organisms → cellular organisms → Bacteria	2756	Open in IMG/M
3300005354\|Ga0070675_100118956	All Organisms → cellular organisms → Bacteria	2243	Open in IMG/M
3300005364\|Ga0070673_100524130	All Organisms → cellular organisms → Bacteria	1074	Open in IMG/M
3300005364\|Ga0070673_100812677	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300005406\|Ga0070703_10381981	All Organisms → cellular organisms → Bacteria	609	Open in IMG/M
3300005437\|Ga0070710_11407934	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300005440\|Ga0070705_100215963	All Organisms → cellular organisms → Bacteria	1325	Open in IMG/M
3300005444\|Ga0070694_100359767	All Organisms → cellular organisms → Bacteria	1130	Open in IMG/M
3300005444\|Ga0070694_100428266	All Organisms → cellular organisms → Bacteria	1041	Open in IMG/M
3300005458\|Ga0070681_10157707	All Organisms → cellular organisms → Bacteria	2194	Open in IMG/M
3300005547\|Ga0070693_101423356	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300005549\|Ga0070704_100398211	All Organisms → cellular organisms → Bacteria	1174	Open in IMG/M
3300005598\|Ga0066706_10107892	All Organisms → cellular organisms → Bacteria	2034	Open in IMG/M
3300005614\|Ga0068856_102057766	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300005615\|Ga0070702_101312473	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300005617\|Ga0068859_101183123	All Organisms → cellular organisms → Bacteria	842	Open in IMG/M
3300005617\|Ga0068859_101936236	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300005618\|Ga0068864_100522772	All Organisms → cellular organisms → Bacteria → Acidobacteria	1144	Open in IMG/M
3300005719\|Ga0068861_100168257	All Organisms → cellular organisms → Bacteria	1814	Open in IMG/M
3300005764\|Ga0066903_107377574	Not Available	568	Open in IMG/M
3300005843\|Ga0068860_100756161	All Organisms → cellular organisms → Bacteria	984	Open in IMG/M
3300006031\|Ga0066651_10810924	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300006046\|Ga0066652_102057610	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300006049\|Ga0075417_10036590	All Organisms → cellular organisms → Bacteria	2062	Open in IMG/M
3300006358\|Ga0068871_100468736	All Organisms → cellular organisms → Bacteria	1131	Open in IMG/M
3300006844\|Ga0075428_101788916	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300006844\|Ga0075428_102656653	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300006852\|Ga0075433_10570098	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	994	Open in IMG/M
3300006871\|Ga0075434_100144481	All Organisms → cellular organisms → Bacteria	2399	Open in IMG/M
3300006880\|Ga0075429_101651228	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300006904\|Ga0075424_101959051	All Organisms → cellular organisms → Bacteria	618	Open in IMG/M
3300009098\|Ga0105245_10772187	All Organisms → cellular organisms → Bacteria	998	Open in IMG/M
3300009100\|Ga0075418_12219339	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300009101\|Ga0105247_10171519	All Organisms → cellular organisms → Bacteria	1443	Open in IMG/M
3300009147\|Ga0114129_10004958	All Organisms → cellular organisms → Bacteria	18771	Open in IMG/M
3300009147\|Ga0114129_10801028	All Organisms → cellular organisms → Bacteria	1202	Open in IMG/M
3300009148\|Ga0105243_11128372	All Organisms → cellular organisms → Bacteria → Acidobacteria	794	Open in IMG/M
3300009162\|Ga0075423_10166742	All Organisms → cellular organisms → Bacteria	2313	Open in IMG/M
3300009162\|Ga0075423_11059767	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300009162\|Ga0075423_12941858	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300009176\|Ga0105242_11845509	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	644	Open in IMG/M
3300009177\|Ga0105248_11117354	All Organisms → cellular organisms → Bacteria	891	Open in IMG/M
3300009678\|Ga0105252_10068540	All Organisms → cellular organisms → Bacteria	1375	Open in IMG/M
3300009813\|Ga0105057_1072611	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300010047\|Ga0126382_10370408	All Organisms → cellular organisms → Bacteria	1106	Open in IMG/M
3300010159\|Ga0099796_10366904	Not Available	624	Open in IMG/M
3300010359\|Ga0126376_12269251	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300010399\|Ga0134127_13632487	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300010400\|Ga0134122_13045879	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300010403\|Ga0134123_10371931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis	1299	Open in IMG/M
3300011119\|Ga0105246_10723845	All Organisms → cellular organisms → Bacteria	875	Open in IMG/M
3300012207\|Ga0137381_10346957	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1294	Open in IMG/M
3300012212\|Ga0150985_105822866	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	524	Open in IMG/M
3300012350\|Ga0137372_10354653	All Organisms → cellular organisms → Bacteria → Acidobacteria	1122	Open in IMG/M
3300012469\|Ga0150984_100284061	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1044	Open in IMG/M
3300012469\|Ga0150984_110291706	All Organisms → cellular organisms → Bacteria → Acidobacteria	1214	Open in IMG/M
3300012508\|Ga0157315_1041670	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300012509\|Ga0157334_1068830	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300012685\|Ga0137397_10617992	Not Available	806	Open in IMG/M
3300012891\|Ga0157305_10159315	Not Available	615	Open in IMG/M
3300012902\|Ga0157291_10344594	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300012924\|Ga0137413_10545597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia	860	Open in IMG/M
3300013102\|Ga0157371_11003348	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300013306\|Ga0163162_10018801	All Organisms → cellular organisms → Bacteria	6774	Open in IMG/M
3300014166\|Ga0134079_10061220	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1350	Open in IMG/M
3300014325\|Ga0163163_13089102	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300014745\|Ga0157377_10064182	All Organisms → cellular organisms → Bacteria → Proteobacteria	2106	Open in IMG/M
3300014745\|Ga0157377_10534748	Not Available	825	Open in IMG/M
3300014745\|Ga0157377_10612246	All Organisms → cellular organisms → Bacteria	778	Open in IMG/M
3300014968\|Ga0157379_10779120	All Organisms → cellular organisms → Bacteria → Proteobacteria	902	Open in IMG/M
3300014969\|Ga0157376_10842606	All Organisms → cellular organisms → Bacteria	932	Open in IMG/M
3300015371\|Ga0132258_12329749	All Organisms → cellular organisms → Bacteria	1342	Open in IMG/M
3300015371\|Ga0132258_13666653	All Organisms → cellular organisms → Bacteria	1049	Open in IMG/M
3300015372\|Ga0132256_103092384	Not Available	559	Open in IMG/M
3300015373\|Ga0132257_102201711	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300015374\|Ga0132255_103695837	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300018028\|Ga0184608_10273204	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	743	Open in IMG/M
3300018058\|Ga0187766_11214630	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300018060\|Ga0187765_11237956	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300018079\|Ga0184627_10033608	All Organisms → cellular organisms → Bacteria	2599	Open in IMG/M
3300018084\|Ga0184629_10572207	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.	579	Open in IMG/M
3300018468\|Ga0066662_10687513	All Organisms → cellular organisms → Bacteria	974	Open in IMG/M
3300018482\|Ga0066669_11082834	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300021081\|Ga0210379_10246103	All Organisms → cellular organisms → Bacteria → Acidobacteria	776	Open in IMG/M
3300021082\|Ga0210380_10335075	Not Available	690	Open in IMG/M
3300021445\|Ga0182009_10215079	All Organisms → cellular organisms → Bacteria	941	Open in IMG/M
3300021477\|Ga0210398_11511367	Not Available	522	Open in IMG/M
3300022563\|Ga0212128_10634700	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
(restricted) 3300023208\|Ga0233424_10249151	Not Available	699	Open in IMG/M
3300025885\|Ga0207653_10117468	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	955	Open in IMG/M
3300025893\|Ga0207682_10186215	All Organisms → cellular organisms → Bacteria	950	Open in IMG/M
3300025898\|Ga0207692_11108154	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300025900\|Ga0207710_10375789	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3	727	Open in IMG/M
3300025903\|Ga0207680_10180384	Not Available	1427	Open in IMG/M
3300025910\|Ga0207684_10176738	All Organisms → cellular organisms → Bacteria	1840	Open in IMG/M
3300025912\|Ga0207707_11018436	All Organisms → cellular organisms → Bacteria	679	Open in IMG/M
3300025918\|Ga0207662_10498149	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300025920\|Ga0207649_10079030	All Organisms → cellular organisms → Bacteria	2124	Open in IMG/M
3300025923\|Ga0207681_10841102	All Organisms → cellular organisms → Bacteria	767	Open in IMG/M
3300025923\|Ga0207681_11821489	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300025932\|Ga0207690_11432619	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300025934\|Ga0207686_11306139	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	596	Open in IMG/M
3300025936\|Ga0207670_10430375	All Organisms → cellular organisms → Bacteria	1060	Open in IMG/M
3300025938\|Ga0207704_10863490	Not Available	759	Open in IMG/M
3300025960\|Ga0207651_10972493	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300025960\|Ga0207651_11236638	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium	671	Open in IMG/M
3300026078\|Ga0207702_12328040	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300026095\|Ga0207676_10071534	All Organisms → cellular organisms → Bacteria	2785	Open in IMG/M
3300026121\|Ga0207683_11160488	Not Available	716	Open in IMG/M
3300026315\|Ga0209686_1067887	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1272	Open in IMG/M
3300027669\|Ga0208981_1029624	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. DK17	1399	Open in IMG/M
3300027873\|Ga0209814_10035527	All Organisms → cellular organisms → Bacteria	2063	Open in IMG/M
3300028381\|Ga0268264_10384343	All Organisms → cellular organisms → Bacteria	1345	Open in IMG/M
3300028884\|Ga0307308_10593877	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3	531	Open in IMG/M
3300031547\|Ga0310887_11025355	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300031720\|Ga0307469_10638003	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	958	Open in IMG/M
3300031731\|Ga0307405_12151957	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300032000\|Ga0310903_10552936	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300032075\|Ga0310890_11103428	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	642	Open in IMG/M
3300032091\|Ga0318577_10536022	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300034149\|Ga0364929_0051670	All Organisms → cellular organisms → Bacteria → Acidobacteria	1247	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	50.39%
Environmental	Environmental	49.61%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	50.39%
Terrestrial	Environmental → Terrestrial	41.86%
Aquatic	Environmental → Aquatic	7.75%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	41.09%
Rhizosphere	Host-Associated → Plants → Rhizosphere	34.11%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.73%
Freshwater	Environmental → Aquatic → Freshwater	3.10%
Sediment	Environmental → Aquatic → Sediment	3.10%
Roots	Host-Associated → Plants → Roots	1.55%
Marine	Environmental → Aquatic → Marine	0.78%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.78%
Floodplain	Environmental → Terrestrial → Floodplain	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	24.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	22.48%
Loam	Environmental → Terrestrial → Soil → Loam	13.95%
Soil	Host-Associated → Plants → Rhizosphere → Soil	11.63%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.30%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.10%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.55%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.55%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.55%
Lake	Environmental → Aquatic → Freshwater → Lake	0.78%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.78%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.78%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.78%
Sand	Environmental → Terrestrial → Soil → Sand	0.78%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.78%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	22.48%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	12.40%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.63%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	11.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.30%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.43%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.10%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.33%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.33%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.33%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.55%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.55%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.55%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.55%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.78%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.78%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.78%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.78%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.78%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.78%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.78%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	10.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	8.53%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.43%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.43%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.10%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.10%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.10%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.88%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.33%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.33%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.33%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.55%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.55%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.55%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.55%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.55%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.55%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.55%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.78%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.78%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.78%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	0.78%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.78%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.78%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.78%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.78%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.78%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.78%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.78%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.78%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.78%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.78%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.78%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.78%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300001850	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a	Environmental	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005218	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009813	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012508	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510	Host-Associated	Open in IMG/M
3300012509	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012891	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2	Environmental	Open in IMG/M
3300012902	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300021477	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O	Environmental	Open in IMG/M
3300022563	OV2_combined assembly	Environmental	Open in IMG/M
3300023208 (restricted)	Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026315	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)	Environmental	Open in IMG/M
3300027669	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI11615J12901_144952202	3300000953	Soil	PAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFSPFINVVPQLTIVAE*
RCM37_10460902	3300001850	Marine Plankton	WEVPADAPIGAWSYTVTATDRFGRTATFNPFPNHLSQLTIVE*
soilH2_100192034	3300003324	Sugarcane Root And Bulk Soil	VGGFPAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0062595_1008669192	3300004479	Soil	GGFPAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTASDRFGRTATFSPFINVVPQLTIVE*
Ga0062594_1008244102	3300005093	Soil	VPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0066683_102964821	3300005172	Soil	AEYSRQPSEMWTGVWVVPADAQPAVLSYTVTATDRFGRTAAFSPFINEVSQIAIVE*
Ga0068996_101463961	3300005218	Natural And Restored Wetlands	GGFPAAEYPRQPSEMWTGVWVVPADAQPAVLSYTVTATDRFGRTATFSPFINLVSQIAIVE*
Ga0065712_101574521	3300005290	Miscanthus Rhizosphere	VPADAQPATLSYTVTATDRFGRTATFSPFINLVSQITIVE*
Ga0070675_1000781011	3300005354	Miscanthus Rhizosphere	AEYPRQPSEMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0070675_1001189561	3300005354	Miscanthus Rhizosphere	VVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQITIVE*
Ga0070673_1005241301	3300005364	Switchgrass Rhizosphere	EMWTGVWIVPMDAQPARLSYTVTATDKFGRTASFSPFINVVPQLTIVAE*
Ga0070673_1008126772	3300005364	Switchgrass Rhizosphere	SEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTASFSPFINVVPQLTIVAE*
Ga0070703_103819812	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	AEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0070710_114079341	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	GVWVVPADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVEN*
Ga0070705_1002159633	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	EYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVAE*
Ga0070694_1003597673	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	PMDAQSGRLSYTVTATDRFGRTATFSPFINVVPQLTIVAE*
Ga0070694_1004282662	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	AAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFSPFINVVPQLTIVE*
Ga0070681_101577074	3300005458	Corn Rhizosphere	PRQPSEMWTGVWVVPMDAQPARLSYTVTATDNFGRTATFSPFVNVVPQLTIVE*
Ga0070693_1014233561	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	VPMDAQPGKLSYTVTATDQFGRSATFSPFINVVPQLTIVAE*
Ga0070704_1003982113	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	YPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVIPQLTIVE*
Ga0066706_101078921	3300005598	Soil	GGFPAAEYSRQPSEMWTGVWVVPADAQPAVLSYTVTATDRFGRTAAFSPFINEVSQIAIVE*
Ga0068856_1020577662	3300005614	Corn Rhizosphere	QPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0070702_1013124732	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	VVPMDAQPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVAE*
Ga0068859_1011831232	3300005617	Switchgrass Rhizosphere	SEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVAE*
Ga0068859_1019362361	3300005617	Switchgrass Rhizosphere	VPADAPIGTISYTVTATDRFGRTATFSPFINHVSQFTIVEQ*
Ga0068864_1005227721	3300005618	Switchgrass Rhizosphere	SEMWTGVWIVPMDAQPARLSYTVTATDKFGRTASFSPFINVVPQLTIVAE*
Ga0068861_1001682571	3300005719	Switchgrass Rhizosphere	QPATLSYTVTATDRFGRTATFSPFINLAAQITIVE*
Ga0066903_1073775742	3300005764	Tropical Forest Soil	PMDAPPGVLKYTVTATDRFNRAASFSPFINTVSQLSIVE*
Ga0068860_1007561612	3300005843	Switchgrass Rhizosphere	DQMWTGAWNVPADAPIGTIVYTVTATDRFGRTATFSPFINVLSQFTIVDQ*
Ga0066651_108109241	3300006031	Soil	WVVPMDAAPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE*
Ga0066652_1020576102	3300006046	Soil	GFPAEEYPRQPSEMWTGVWIVPMDAQPGRLSYTVTATDQFGRSATFSPFINVVPQLTVVAE*
Ga0075417_100365903	3300006049	Populus Rhizosphere	VWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE*
Ga0068871_1004687362	3300006358	Miscanthus Rhizosphere	QMWTGAWNVPADAPIGAIVYTVTATDRFGRTATFSPFINLVSQFTIVE*
Ga0075428_1017889162	3300006844	Populus Rhizosphere	MDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0075428_1026566532	3300006844	Populus Rhizosphere	PMDATPATLSYTVTATDRFGRTANFLPFSYENSQLTIVQ*
Ga0075433_105700983	3300006852	Populus Rhizosphere	EYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0075434_1001444811	3300006871	Populus Rhizosphere	PGRLSYTVTATDRFGRTATFSPFINVVPQLTIVAE*
Ga0075429_1016512282	3300006880	Populus Rhizosphere	YPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0075424_1019590511	3300006904	Populus Rhizosphere	VWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVAE*
Ga0105245_107721873	3300009098	Miscanthus Rhizosphere	GGCPASEYPRQPSEMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0075418_122193391	3300009100	Populus Rhizosphere	PMDAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE*
Ga0105247_101715191	3300009101	Switchgrass Rhizosphere	ADAPIGTITYTVTATDRFGRTASFSPFINHVSQFTIVEQ*
Ga0114129_1000495813	3300009147	Populus Rhizosphere	MWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE*
Ga0114129_108010283	3300009147	Populus Rhizosphere	PTDAQPGRLSYTVTATDRFGRMATFSPFINVVPQLTIVE*
Ga0105243_111283722	3300009148	Miscanthus Rhizosphere	NFPASEYSRQPSEMWTGAWNVPPDAPIGTISYTVTATDRFGRTATFSPFINHVSQFTIVEQ*
Ga0075423_101667421	3300009162	Populus Rhizosphere	MWTGVWVVPMDAQPGRLSYTVTATDQFGRTATFNPFPNIVPQLTIVE*
Ga0075423_110597672	3300009162	Populus Rhizosphere	GFPAAEYPRQPSEMWTGVWIVPMDAQPGRLSYTVTATDKFGRMATFSPFINVIPQLTIVAE*
Ga0075423_129418581	3300009162	Populus Rhizosphere	QPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE*
Ga0105242_118455092	3300009176	Miscanthus Rhizosphere	VPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE*
Ga0105248_111173542	3300009177	Switchgrass Rhizosphere	ARLSYTVTATDKFGRTASFSPFINVVPQLTIVAE*
Ga0105252_100685401	3300009678	Soil	GGFPAAEYPRQPSEMWTGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE*
Ga0105057_10726111	3300009813	Groundwater Sand	APPGALSYTVTATDRFNRTASFSPFINVVSQLTIVE*
Ga0126382_103704083	3300010047	Tropical Forest Soil	QPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE*
Ga0099796_103669042	3300010159	Vadose Zone Soil	AADTPIGTINYTVTATDRFGRSATFSPFINSASQLTIVEQ*
Ga0126376_122692511	3300010359	Tropical Forest Soil	ADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVE*
Ga0134127_136324872	3300010399	Terrestrial Soil	YPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVAE*
Ga0134122_130458791	3300010400	Terrestrial Soil	AMPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE*
Ga0134123_103719311	3300010403	Terrestrial Soil	PTGTLSYTVTATAKFGRNASFTQFSADASQIVIVQ*
Ga0105246_107238453	3300011119	Miscanthus Rhizosphere	FPAAEYPRQPSEMWTGVWVVPADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE*
Ga0137381_103469571	3300012207	Vadose Zone Soil	EMWTGVWVVPTDAAPGRLSYTVTATDRFGRTASFSPFINVVPQLTIVE*
Ga0150985_1058228662	3300012212	Avena Fatua Rhizosphere	GAWVVPADAPIGAIAYTVTATDAFGRNATFSPFINVLSQFTIVEQ*
Ga0137372_103546531	3300012350	Vadose Zone Soil	AWVIPMDAPVGTIKYTVTATDRFNRTASFSPFPNVVSQFTIVE*
Ga0150984_1002840611	3300012469	Avena Fatua Rhizosphere	MDAQIGKLSYTVTATDRFGRTATFSPFINEVSQIEIVE*
Ga0150984_1102917062	3300012469	Avena Fatua Rhizosphere	SEYPRQPSEMWTGAWVVPADAPLGVIKYTVTATDRFGRTASFSPFINVVSQFTIVE*
Ga0157315_10416701	3300012508	Arabidopsis Rhizosphere	MDAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE*
Ga0157334_10688302	3300012509	Soil	QPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFSPFINVVPQLTIVE*
Ga0137397_106179922	3300012685	Vadose Zone Soil	SEMWTGVWTVPADAAAGRLSYTVTATDRFGRTASFTPFINLVPQLTIVE*
Ga0157305_101593151	3300012891	Soil	TGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE*
Ga0157291_103445942	3300012902	Soil	FPAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVE*
Ga0137413_105455971	3300012924	Vadose Zone Soil	VVPADAQPAVLSYTVTATDRFGRTATFSPFINLVSQIAIVE*
Ga0157371_110033481	3300013102	Corn Rhizosphere	QPSEMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0163162_100188016	3300013306	Switchgrass Rhizosphere	DAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE*
Ga0134079_100612201	3300014166	Grasslands Soil	AAEYPRQPSEMWTGVWVVPMDAAPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE*
Ga0163163_130891021	3300014325	Switchgrass Rhizosphere	GITIRYTVTATDRFRRTATFTPFPAVPSQLTIVE*
Ga0157377_100641823	3300014745	Miscanthus Rhizosphere	MDAQPATLSYTVTATDRFGRTATCSPFINLAAQITIVE*
Ga0157377_105347482	3300014745	Miscanthus Rhizosphere	MWTGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE*
Ga0157377_106122461	3300014745	Miscanthus Rhizosphere	PRQPSEMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0157379_107791201	3300014968	Switchgrass Rhizosphere	SEYPRQPSEMWTGAWVVPADAPIGVISYTVTATDRFNRTATFSPFINLVSQFTIVE*
Ga0157376_108426063	3300014969	Miscanthus Rhizosphere	VWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0132258_123297493	3300015371	Arabidopsis Rhizosphere	GRTPGPADAQPGALSYTVTATDRFGRTASFSPFINLVSQITVVE*
Ga0132258_136666533	3300015371	Arabidopsis Rhizosphere	FPAAEYPRQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0132256_1030923842	3300015372	Arabidopsis Rhizosphere	AEYPRQPSEMWTGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE*
Ga0132257_1022017112	3300015373	Arabidopsis Rhizosphere	EMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0132255_1036958372	3300015374	Arabidopsis Rhizosphere	RQPSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE*
Ga0184608_102732041	3300018028	Groundwater Sediment	PSEMWTGAWNVPADAPIGTITYTVTATDRFGRTATFSPFINHVSQFTIVEQ
Ga0187766_112146302	3300018058	Tropical Peatland	MWTGVWVVPADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVEQ
Ga0187765_112379561	3300018060	Tropical Peatland	ADAPPAALSYTVTATDRFGRTATFSPFINLVSQIAIVEQ
Ga0184627_100336084	3300018079	Groundwater Sediment	DAPIGRLSYTVTATDRFGRTAAFTPFPNLESQLAIVE
Ga0184629_105722072	3300018084	Groundwater Sediment	EMWTGVWTVPADAPIGRLSYTVTATDRFGRAASFTPFPNLEAQLTIVE
Ga0066662_106875131	3300018468	Grasslands Soil	PSEMWTGVWLVPADAQPAVLSYTVTATDRFGRAATFSPFINLASQIAIVE
Ga0066669_110828341	3300018482	Grasslands Soil	APGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE
Ga0210379_102461032	3300021081	Groundwater Sediment	VPADTPIGVINYTVTATDRFGRTATFTPFINLVSQLTIVE
Ga0210380_103350751	3300021082	Groundwater Sediment	DAQPAALSYTVTATDRFGRTATFSPFINLVSQIAIVE
Ga0182009_102150793	3300021445	Soil	EYPRQPSEMWTGVWVVPADAQPAVLSYTVTATDRFGRTATFTPFINEVSHITIVEQ
Ga0210398_115113672	3300021477	Soil	VPADAQPGGLSYTVTATDRFGRTATFSPFVNVVSQIAIVE
Ga0212128_106347001	3300022563	Thermal Springs	DAPTATFSYTVTAKDQFGRTATFEPFSYNTSQLTIVE
(restricted) Ga0233424_102491512	3300023208	Freshwater	DDAPIGSLSYTVTATDRFGRTASFTPFPNVMSQLAIVEN
Ga0207653_101174682	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	MDAQPGRLSYTVTATDRFGRTATFNPFINVVPQLTIVAE
Ga0207682_101862152	3300025893	Miscanthus Rhizosphere	ADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE
Ga0207692_111081542	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	TGVWVVPADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVEN
Ga0207710_103757891	3300025900	Switchgrass Rhizosphere	QPSEMWTGVWTVPADTPIGVINYTVTAVDRFGRTASFSPFINSVSQLAIVE
Ga0207680_101803844	3300025903	Switchgrass Rhizosphere	TGVWVVPADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE
Ga0207684_101767381	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	PSEMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVIPQLTIVE
Ga0207707_110184362	3300025912	Corn Rhizosphere	MWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIV
Ga0207662_104981492	3300025918	Switchgrass Rhizosphere	MWTGVWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVE
Ga0207649_100790301	3300025920	Corn Rhizosphere	VPMDAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE
Ga0207681_108411022	3300025923	Switchgrass Rhizosphere	PMDAQPATLSYTVTATDRFGRTATFSPFINLAAQITIVE
Ga0207681_118214892	3300025923	Switchgrass Rhizosphere	WNVPPDAPIGTISYTVTATDRFGRTATFSPFINHVSQFTIVEQ
Ga0207690_114326191	3300025932	Corn Rhizosphere	WVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVAE
Ga0207686_113061392	3300025934	Miscanthus Rhizosphere	TPIGPIVYTVTATDRFGRTASFSPFINLVSQFTIVEQ
Ga0207670_104303753	3300025936	Switchgrass Rhizosphere	EMWTGVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE
Ga0207704_108634901	3300025938	Miscanthus Rhizosphere	GVWVVPADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE
Ga0207651_109724931	3300025960	Switchgrass Rhizosphere	EMWTGVWIVPMDAQPARLSYTVTATDKFGRTASFSPFINVVPQLTIVAE
Ga0207651_112366382	3300025960	Switchgrass Rhizosphere	LWTGVWIVPMDAQPARLSYTVTATDKFGRTASFSPFINVVPQ
Ga0207702_123280401	3300026078	Corn Rhizosphere	GVWVVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE
Ga0207676_100715341	3300026095	Switchgrass Rhizosphere	VWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE
Ga0207683_111604882	3300026121	Miscanthus Rhizosphere	WTGVWVVPADAPPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE
Ga0209686_10678873	3300026315	Soil	PSEMWTGVWVVPMDAQPGKLSYTVTATDQFGRSATFTPFINVVPQPTIVE
Ga0208981_10296241	3300027669	Forest Soil	PSEMWTGVWVVAADTPIGTINYTVTATDRFGRSATFSPFINSASQLAIVEQ
Ga0209814_100355271	3300027873	Populus Rhizosphere	VWVVPMDAQPGRLSYTVTATDRFGRMATFTPFINVVPQLTIVAE
Ga0268264_103843431	3300028381	Switchgrass Rhizosphere	EMWTGVWIVPMDAQPGRLSYTVTATDRFGRTATFTPFINVVPQLTIVE
Ga0307308_105938772	3300028884	Soil	GVWNVPPDAPIGTINYTVTATDRFGRTASFSPFINVVSQLAVVE
Ga0310887_110253552	3300031547	Soil	VRDVDGSMVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE
Ga0307469_106380031	3300031720	Hardwood Forest Soil	GVWVVPMDAQPGRLSYTVTATDRFGRTATFSPFINVVPQLTIVE
Ga0307405_121519572	3300031731	Rhizosphere	MDAPTGTLSYTVTATDRFGRTASFVPFSYETSQLTIVP
Ga0310903_105529362	3300032000	Soil	GGFPAAEYPRQPSEMWTGVWVVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIV
Ga0310890_111034282	3300032075	Soil	VVPADAQPATLSYTVTATDRFGRTATFSPFINLVSQIAIVE
Ga0318577_105360222	3300032091	Soil	PSEMWTGVWVVPADAQPGALSYTVTATDRFGRTATFSPFINVVSQIAIVE
Ga0364929_0051670_1_117	3300034149	Sediment	ADTPIGVINYTVTATDRFGRTATFTPFINLVSQLTIVE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters