| Basic Information | |
|---|---|
| Family ID | F063728 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VLPDSPECVALRADMKGDRLNSRFQHIHKNKSVKAHGV |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 63.49 % |
| % of genes near scaffold ends (potentially truncated) | 93.02 % |
| % of genes from short scaffolds (< 2000 bps) | 96.90 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.450 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.574 % of family members) |
| Environment Ontology (ENVO) | Unclassified (94.574 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (94.574 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.45 % |
| All Organisms | root | All Organisms | 1.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 94.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068869_1021090651 | 3300005334 | Miscanthus Rhizosphere | MPVLPDSPECAALRADMRGDRLNSRFQHIQKNKSVKAYGVV* |
| Ga0068867_1011540011 | 3300005459 | Miscanthus Rhizosphere | NLPVLPDSPECAAMRADMKGDRLNSQLQHIYENRSVKAHWVA* |
| Ga0068866_104606472 | 3300005718 | Miscanthus Rhizosphere | MLPDNPECTAMRADMKGNRLNSRFQYIHENESVRAHGGV* |
| Ga0068871_1022936472 | 3300006358 | Miscanthus Rhizosphere | LPVLPDSPECVAMRADMKGDRLNSRFQHIHENKSIKAHWVV* |
| Ga0157376_125490121 | 3300014969 | Miscanthus Rhizosphere | NMPVLPDSPECAALRADMKGGRLNSRFQHIHKNKSIKALGVV* |
| Ga0157376_125990201 | 3300014969 | Miscanthus Rhizosphere | PECATLRADMRGDQLNSRFQHIDKNKSVKAYGVV* |
| Ga0182122_10541721 | 3300015267 | Miscanthus Phyllosphere | GRNMPVLLDSPECVALRVDIEGDQLNSRFQHIHKNKSIKAHGVM* |
| Ga0182154_10451241 | 3300015268 | Miscanthus Phyllosphere | VPVLPDSPEYASLRSDMKGDRLNSRFQHTHKNKSVKA |
| Ga0182113_10714161 | 3300015269 | Miscanthus Phyllosphere | MPVLPDSPECAALRADMKGDRLNSRFQHIHKNKSVKAHGVVEAKSVIIQD |
| Ga0182188_10314851 | 3300015274 | Miscanthus Phyllosphere | VLPDSSECAGLRADMRGDRLNSRFQHIHKNKSVKAYAVV* |
| Ga0182188_10353671 | 3300015274 | Miscanthus Phyllosphere | VLPDSPECAALRADMKGDRLNSRFQHIHMNKLVKARGV |
| Ga0182172_10461141 | 3300015275 | Miscanthus Phyllosphere | SNLGRNVPVLPDSPECAALRADMKGDRLNSRFQHIHKNKSVKAHGVV* |
| Ga0182170_10371331 | 3300015276 | Miscanthus Phyllosphere | MPVLPDSSECTALRADMRGNQQNSRFQHIHKNESIE |
| Ga0182170_10693621 | 3300015276 | Miscanthus Phyllosphere | VPVLPDNPECAALRADMKGDRLNSQFQHIHKNKSVKTYGVV* |
| Ga0182128_10255431 | 3300015277 | Miscanthus Phyllosphere | MLLDSPECVALRADMKGDRLNSRFQHIHKNKLVKAHGVV* |
| Ga0182174_10858021 | 3300015279 | Miscanthus Phyllosphere | LPDSPECVAMRADMKGDRLNSRFQHIRENRSVKAHWVT* |
| Ga0182160_10387601 | 3300015281 | Miscanthus Phyllosphere | MSNLGRNVPVLPDSAECAALRANMKGDRLNSRLQHIHKNKSVKAHGVV* |
| Ga0182124_10224491 | 3300015282 | Miscanthus Phyllosphere | MLVLPDSPECAALRADMKGDRLNSRFQHIRKNKSVKA |
| Ga0182124_10406931 | 3300015282 | Miscanthus Phyllosphere | MPVLPDSPECVALRANVEENRLNSRFQHTHKNKSVKAHGVVKEKS |
| Ga0182186_10293251 | 3300015285 | Miscanthus Phyllosphere | MSVLPDSPECAALRADMRDRLNSQFQHIHMNKSIKAHGV |
| Ga0182186_10421851 | 3300015285 | Miscanthus Phyllosphere | MLPNSTECVALRADMKGDRLNSRFQYIHKNKSVKARGV |
| Ga0182186_10762071 | 3300015285 | Miscanthus Phyllosphere | VLPDSLECAALRADMRGDRLNSQSQHIHKNESIKA |
| Ga0182176_10219072 | 3300015286 | Miscanthus Phyllosphere | WNVPVLPDSPECAALRADMRGDRLNSRSQHIYKNESVKAHGVV* |
| Ga0182176_10698381 | 3300015286 | Miscanthus Phyllosphere | VLPDSPECAAPRADMRGDRLNSRFQHIHKNKLIKAHGV |
| Ga0182171_10787641 | 3300015287 | Miscanthus Phyllosphere | PDSPECAALRADMKGDRLNSRFQHIHKNKSVKTHVVV* |
| Ga0182171_10805571 | 3300015287 | Miscanthus Phyllosphere | QNVPVLPDSPECAALRADMKGDRLNSRFLHIHKNKSVKAHGVV* |
| Ga0182171_10809091 | 3300015287 | Miscanthus Phyllosphere | VPVLPDNPECAALRADMKGDRLNSRFQHIHENKSVK |
| Ga0182173_10360091 | 3300015288 | Miscanthus Phyllosphere | VLLDSPECAALRADMKGDRLNSRFQHIHKNKSVKAHRVV* |
| Ga0182173_10502351 | 3300015288 | Miscanthus Phyllosphere | PDSPECTAVRADMKGNRLNSRFQYIHENKSVRAHGVV* |
| Ga0182173_10831841 | 3300015288 | Miscanthus Phyllosphere | NVPVLPDSPECVALRADMKGDRLNNRFWRIHKNKSIKAYRVV* |
| Ga0182125_10553521 | 3300015291 | Miscanthus Phyllosphere | MPVLLDSPECAALRADMKGDRLNSRFQHIRKNKSVKAH |
| Ga0182125_10587361 | 3300015291 | Miscanthus Phyllosphere | VLPDSPECAALRADMKGDRLNSRFQHIHKNNRFKLMGL |
| Ga0182141_10000767 | 3300015292 | Miscanthus Phyllosphere | VPVLLDSPECTALRADMKGDRLNSRFQHIHKNESIKAHGVM |
| Ga0182126_10280841 | 3300015294 | Miscanthus Phyllosphere | VLPDSPKYAAMRADMKGDRLNSRFQHIHENKSVKAHWV |
| Ga0182126_10915171 | 3300015294 | Miscanthus Phyllosphere | MPVLPDSPECAALRADMEGDRLNSQFQHIHKNKSVKALEV |
| Ga0182175_10894231 | 3300015295 | Miscanthus Phyllosphere | MPVLPDSPECAALRADMERDRLNSRFQHTHKNKSVKTHGVMEE |
| Ga0182106_10696681 | 3300015298 | Miscanthus Phyllosphere | MPVLPDSSECAALRADMEGDRLNSRFQHIHKNKSIKAHRVVEEKN |
| Ga0182107_10528751 | 3300015299 | Miscanthus Phyllosphere | VLLDSPECVALRANVEGNRLNSRFQHTHKNKSVKAHGVVKE |
| Ga0182107_11032331 | 3300015299 | Miscanthus Phyllosphere | PECAALRADMKGNRLNSRFQHIHKNKSVKAHGVM* |
| Ga0182108_10195061 | 3300015300 | Miscanthus Phyllosphere | MPVLPDSSEYMALRADMRGDRLNSRAQHIYKNESVKAHGV |
| Ga0182108_10527631 | 3300015300 | Miscanthus Phyllosphere | MPVLPDSPECVALRADMKGDQLNSRFQHIHKNKSVKTRGVV |
| Ga0182108_10951271 | 3300015300 | Miscanthus Phyllosphere | NVPVLPDSPECVALRANVRGDRLNSRFEHIHKNKSVKAHEVM* |
| Ga0182143_10310901 | 3300015302 | Miscanthus Phyllosphere | DNPEYAALRADMKGDRLNSRFRYIHKNKSVKALGVV* |
| Ga0182143_10861991 | 3300015302 | Miscanthus Phyllosphere | MPVLPDSPEYAAPKADMKGDRLNSRFQHIHKNKSVKAHGVVKEESV |
| Ga0182143_11034451 | 3300015302 | Miscanthus Phyllosphere | VPVLPDSPEYEALRADMKGDRLNSRFRHIHKNELVKAHGVV* |
| Ga0182123_10366801 | 3300015303 | Miscanthus Phyllosphere | NVPVLPDSPECAALRADMKGDRLNSRFQHIHKNESIKAHGVM* |
| Ga0182112_10728721 | 3300015304 | Miscanthus Phyllosphere | VLLDSPECVALRADMKGDRLNSRFQHIHENKSVKAHWV |
| Ga0182112_10912831 | 3300015304 | Miscanthus Phyllosphere | VPVLPDSLECVALRADIRENLLNSRSQHVHKNKSIKAHR |
| Ga0182144_10745761 | 3300015307 | Miscanthus Phyllosphere | VLLDSPECAALRADIKGDRLNSRFQHIHENKSVKAH |
| Ga0182144_10768611 | 3300015307 | Miscanthus Phyllosphere | SPECVALRADMKGDQLNSRFHHIRENKSVRTHWVV* |
| Ga0182144_10818941 | 3300015307 | Miscanthus Phyllosphere | PDSPECVALRADMKGDRLNIRFQHIHKNKLVKVHGIV* |
| Ga0182144_10882341 | 3300015307 | Miscanthus Phyllosphere | MPVLPDSPECVALRADMRGDQLNSQFQHIHKNKSIK |
| Ga0182142_10372071 | 3300015308 | Miscanthus Phyllosphere | VSVLPDSPECAALRADMRGDRLNSRFEHIPKNKSIKTHGV |
| Ga0182142_10751521 | 3300015308 | Miscanthus Phyllosphere | PVLPDSPECAALRADMRGDRLNSRFQHIHENKSDKAHWVV* |
| Ga0182140_10286021 | 3300015314 | Miscanthus Phyllosphere | LPVLLDSPECAALKADMKGDRLNSRFQHIHENKSVKAH* |
| Ga0182140_10470561 | 3300015314 | Miscanthus Phyllosphere | GWNLPVLPDSPECAAMRADMKGDRLNSRFQYIHENKSIKAHGVV* |
| Ga0182140_10817421 | 3300015314 | Miscanthus Phyllosphere | GRNLPVLPDSPECAAMRADMQRDRLNSRFLYIHEDESVKAHGVV* |
| Ga0182129_10449601 | 3300015323 | Miscanthus Phyllosphere | VLPDSPECAALRADVEGDRLNSQFQHTHKNKSVKAHGV |
| Ga0182187_10718402 | 3300015341 | Miscanthus Phyllosphere | VLPDSPECAALRDDMKGDRLNSRFQHIHKNKSVKAH |
| Ga0182187_10754071 | 3300015341 | Miscanthus Phyllosphere | VLPDSPECAALRADMKGDRLNSRFQHIRENKSVKAHWVV* |
| Ga0182187_11084121 | 3300015341 | Miscanthus Phyllosphere | DSPECVALRADMKGDRLNSRFQHIRKNKLVKAHGVV* |
| Ga0182187_11611731 | 3300015341 | Miscanthus Phyllosphere | MLPDSSECAALEADMKGDRLNSRFQHIHENKSVKAHWVV |
| Ga0182187_11952801 | 3300015341 | Miscanthus Phyllosphere | MPVLPDSPECVALRADMRGDRLNSRFQHIHKNKSVKAHE |
| Ga0182109_10061271 | 3300015342 | Miscanthus Phyllosphere | MPVLPDSPECAALGADMEGDRLNSRFQHIHKNKSVKARG |
| Ga0182155_10596371 | 3300015343 | Miscanthus Phyllosphere | MPVLPDSPECVALRADIKGDRLNSRFQHIHKNKSVKARG |
| Ga0182155_10653821 | 3300015343 | Miscanthus Phyllosphere | VLPNSPECAALRADMKGDRLNSRFQHIHKNKSVKA |
| Ga0182155_11914551 | 3300015343 | Miscanthus Phyllosphere | MPVLLDSPECVALRADMKGDRLNSRFQHIHKNKSVKA |
| Ga0182155_11946361 | 3300015343 | Miscanthus Phyllosphere | VPVLPEKPEYAALRADMRGDRLNSRFQHIHKNKSVKA |
| Ga0182189_11848512 | 3300015344 | Miscanthus Phyllosphere | MSVLPDSSECAALKAYMRGDRLNSRFQHIHKNKSVKA |
| Ga0182189_11985291 | 3300015344 | Miscanthus Phyllosphere | DSPECAALRADMKGDRLNSRFQHIRKNKSVKAHGVV* |
| Ga0182111_10401721 | 3300015345 | Miscanthus Phyllosphere | MPVLPDSPKCAALRDDMEGNRLNSRFQHTHKNKSIKDHGIM |
| Ga0182111_11314721 | 3300015345 | Miscanthus Phyllosphere | MPVLLDSPECAALRADMERDWLNSRFQHTHKNKSVKAHGFV |
| Ga0182139_10772781 | 3300015346 | Miscanthus Phyllosphere | MLPDSPEYAALKADMKGDRLNSQFQHIHENKLVKA |
| Ga0182139_11041991 | 3300015346 | Miscanthus Phyllosphere | MLVLPDSPECVALRADMKENRLNSRFQHTHKNKSIKAY |
| Ga0182139_11342951 | 3300015346 | Miscanthus Phyllosphere | VPVLPDSPECAALRADMRGNRLNSQSQHIHTNESIKAHGV |
| Ga0182139_11568241 | 3300015346 | Miscanthus Phyllosphere | MPVLLDSPECAALRADMKRARLKSRFQHTHKNKSIKAHGIMEGK |
| Ga0182139_11976001 | 3300015346 | Miscanthus Phyllosphere | VLVLLDSPECAALRADMRGDRLNSRFQHIHKNKSVKAHGVV |
| Ga0182177_10359421 | 3300015347 | Miscanthus Phyllosphere | MPVLPDSSECAALRADMKGDRLNSRFQHIHKNKSVKAHGV |
| Ga0182177_10803951 | 3300015347 | Miscanthus Phyllosphere | VLPDSPECVAMRADMKGDRLNSRFQHIHENKSIKAHW |
| Ga0182177_12151981 | 3300015347 | Miscanthus Phyllosphere | SPECVALRADMKGDRLNSRFQNIHKNKSVKAHEVV* |
| Ga0182161_12697871 | 3300015351 | Miscanthus Phyllosphere | MLVLLDSPECVALRADVKGDRLNSRFQHTHKNKSVKAH |
| Ga0182159_10477842 | 3300015355 | Miscanthus Phyllosphere | MPVLPGSPEYAALRADMKGDRLNSRFQHIHKNKSVK |
| Ga0182159_11845042 | 3300015355 | Miscanthus Phyllosphere | VLPDSPECAALRADVERNRLNSRFQHTHKNKSVKAHGVVE |
| Ga0182159_12022511 | 3300015355 | Miscanthus Phyllosphere | MPVLQESPECAALRADMEGNRLNSRFQHTQKNTLIKAYGIMEGKLVIT* |
| Ga0182159_12673391 | 3300015355 | Miscanthus Phyllosphere | MPVLPDSPECAAPRADMKGNSRFQHTDKNKSVKTHGIVEENWLS |
| Ga0182159_13017121 | 3300015355 | Miscanthus Phyllosphere | MLPDSPECAVMRADMKGDRLNSRFQHIHENKSVKAH |
| Ga0182159_13373121 | 3300015355 | Miscanthus Phyllosphere | VLTDSPECAALRADMKGDRLNSRFQHIIENKSVKAH |
| Ga0182145_11283941 | 3300015361 | Miscanthus Phyllosphere | LPVLPDSPECVAMRADMKGDRLNSRFQYIHENKSVKAHRVM* |
| Ga0182203_10582711 | 3300017404 | Miscanthus Phyllosphere | MPVLLDSPECAALRADMKGDRLNGRFQHIHKNESVIAHG |
| Ga0182203_10773681 | 3300017404 | Miscanthus Phyllosphere | DSPECTALRADVEGDRLNSQFQHSHKNKLVKAHEVMEERISYHSG |
| Ga0182220_10607001 | 3300017407 | Miscanthus Phyllosphere | VPVLLDNPECAALKADMKGDRLNSRFQHIHKNKSIKLMGL |
| Ga0182204_10809301 | 3300017409 | Miscanthus Phyllosphere | SPECAALRADMKGDRLNSRFQHIHKNKLVKAHEVV |
| Ga0182204_10835181 | 3300017409 | Miscanthus Phyllosphere | VLPDSPECAALRADMKGDRLNSRFQYIHKNKSIKAHGIV |
| Ga0182207_11448421 | 3300017410 | Miscanthus Phyllosphere | MLVLPDSPECAALRADMKGDRLNSRFQHIRKNKSVKAHGV |
| Ga0182207_11736311 | 3300017410 | Miscanthus Phyllosphere | MPVLPDSSECAGLRADMRGDRLNSRFQHIHKNKSI |
| Ga0182207_11774641 | 3300017410 | Miscanthus Phyllosphere | NVPVLPDSPECAALRADMKGDRLNSRFQHIHKNKSVKAHGVV |
| Ga0182208_10741292 | 3300017411 | Miscanthus Phyllosphere | MPVLPDSSECVALRADMKGDRLNNRFHYIHKDKSVK |
| Ga0182208_10864141 | 3300017411 | Miscanthus Phyllosphere | PVLPDSPECVALRADMREKRLNSQSQHVHKNESIKAHGVV |
| Ga0182208_11191431 | 3300017411 | Miscanthus Phyllosphere | VLPDSPECAALEADMKGDRLNSRFQHISKDESVKAHWVV |
| Ga0182222_10226821 | 3300017413 | Miscanthus Phyllosphere | VPVLSDSPECAALRHDMKGDRLNSRFQHIHKNKSFKARGV |
| Ga0182222_10926342 | 3300017413 | Miscanthus Phyllosphere | MPVLPDSPECVALRADMEGDRLNSQFQHTHKNKSIKA |
| Ga0182202_10888871 | 3300017415 | Miscanthus Phyllosphere | MPVLPNSSECAALRADMKGDRLNSRFQHTHKNKSIKAHGIMEGKSVI |
| Ga0182202_10931631 | 3300017415 | Miscanthus Phyllosphere | LPDSPECAALRADMKGDRLNSRFQHIHKNKSVRAHGVV |
| Ga0182230_10499421 | 3300017417 | Miscanthus Phyllosphere | MPVLPDSPKCAALRADMKGDRLNSRFQHIHKNKSVKAHGIV |
| Ga0182230_10847941 | 3300017417 | Miscanthus Phyllosphere | VLPDSPECVALRADVKGDRLNSRFQHTHKNKSVKAHGVMEEK |
| Ga0182228_11134681 | 3300017420 | Miscanthus Phyllosphere | VPVLPDSPEYAALRADLKGDRLNSQFQHIHKNKSIKA |
| Ga0182219_10161211 | 3300017424 | Miscanthus Phyllosphere | VLPDSSKCAALRADMRGDRLNSRFQHIHKNKSVKAYGVV |
| Ga0182219_11011651 | 3300017424 | Miscanthus Phyllosphere | LPVLPDSPECAAMRADMIGNRLNSRFQYIHENELVRAHGGV |
| Ga0182219_11125821 | 3300017424 | Miscanthus Phyllosphere | MPVLPDNSKCAALRADVEGDRLNSQFQHTQKNKSVKAHGIME |
| Ga0182219_11247981 | 3300017424 | Miscanthus Phyllosphere | VLPDSPKCVALRADVEENRLNSRFQHTHKNKSVKARG |
| Ga0182224_10400881 | 3300017425 | Miscanthus Phyllosphere | NLPVLPDSPECAAMRADMKGDRLNSRFQHFHENKSVKAHGIM |
| Ga0182190_10469621 | 3300017427 | Miscanthus Phyllosphere | MPVLLDSPECAALRANMRGDRLNSRFQHIQKNKSVKAY |
| Ga0182190_11397721 | 3300017427 | Miscanthus Phyllosphere | MLVLPDSPECVALRADVKGDRLNSQFQHTHKNKSIKA |
| Ga0182192_11487512 | 3300017430 | Miscanthus Phyllosphere | MMVLPDSPECVALRADMERNRLNSRFQHTHKNKSVKAHGAVKEESIIIQ |
| Ga0182206_10336651 | 3300017433 | Miscanthus Phyllosphere | DNPEYAALRADIKGDRLNSRFQHIHKNKSVKAHGVV |
| Ga0182206_10956941 | 3300017433 | Miscanthus Phyllosphere | MPVLPDSPKCAALRDDMEGNRLNSRFQHTHKNKSIKD |
| Ga0182206_11517741 | 3300017433 | Miscanthus Phyllosphere | VPVLPNSPECAALKADMKGDRLQHIQKNKSFKARGV |
| Ga0182221_10869151 | 3300017442 | Miscanthus Phyllosphere | MPALPDSPECAALRADVEGNQLNSRFQHTHKNKSVKAHGVVEGK |
| Ga0182221_11602571 | 3300017442 | Miscanthus Phyllosphere | SNLGWNMPVLLDSPECVALRADTKGDRLNSRFQHIHKNKSVKAHGVV |
| Ga0182233_11173421 | 3300017680 | Miscanthus Phyllosphere | SPEYVALRANMKGDRLNSRLQHIRKNKLVKAHGVV |
| Ga0182229_10779561 | 3300017682 | Miscanthus Phyllosphere | VLPDSPECVALRADMKGDRLNSRFQHIHKNKSVKAHG |
| Ga0182229_10837311 | 3300017682 | Miscanthus Phyllosphere | VLPDSPECVALRADMKGDRLNSRFQHIHKNKSVKAHGV |
| Ga0182218_10827281 | 3300017683 | Miscanthus Phyllosphere | MLLLPDSFDCTALRADVKGDRLNSRFQHTHKNKSVKAHGIM |
| Ga0182227_10854991 | 3300017685 | Miscanthus Phyllosphere | VLPDSPECTAMRADMKGDRLNSRFQHIHENKSVKAHW |
| Ga0182227_11267081 | 3300017685 | Miscanthus Phyllosphere | PDSPECAALRADMRGDRLNSRFQHIHKNKSVKAHGVV |
| Ga0182205_10828461 | 3300017686 | Miscanthus Phyllosphere | MSVLLDCPECVALRADMKGDRLNSRFQHIHKNKLVKTHGVV |
| Ga0182205_11245781 | 3300017686 | Miscanthus Phyllosphere | PVLPDSPECAAMRADMKGDRLNSRFQHIHENKSVKAHGAV |
| Ga0182223_11198621 | 3300017690 | Miscanthus Phyllosphere | MPVLPDSTECAALRADMKGDRLNSRFQHIRENKSVKAHWV |
| Ga0207686_114569871 | 3300025934 | Miscanthus Rhizosphere | SPEYTSLRADMKGDRPNSQFQHIHKNKSVKAHGVV |
| ⦗Top⦘ |