Metagenome Family F063728

Overview

Basic Information

• Family ID: F063728
• Family Type: Metagenome
• Number of Sequences: 129
• Average Sequence Length: 39 residues
• Representative Sequence: VLPDSPECVALRADMKGDRLNSRFQHIHKNKSVKAHGV
• Number of Associated Samples: 65
• Number of Associated Scaffolds: 129

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 63.49 %
• % of genes near scaffold ends (potentially truncated): 93.02 %
• % of genes from short scaffolds (< 2000 bps): 96.90 %
• Associated GOLD sequencing projects: 65
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (98.450 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.574 % of family members)
• Environment Ontology (ENVO): Unclassified (94.574 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (94.574 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 46.97%
  β-sheet: 0.00%
  Coil/Unstructured: 53.03%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
All Organisms	root	All Organisms	1.55 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
cellular organisms	root	All Organisms → cellular organisms	1.55 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.55 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1.55 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.55 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	1.55 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.78 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.78 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.78 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.78 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.78 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.78 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.78 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.78 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.78 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.78 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.78 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.78 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.78 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.78 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.78 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.78 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Saccharum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum	0.78 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Saccharum officinarum complex	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex	0.78 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.45 %
Saccharum officinarum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum officinarum	0.78 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005334|Ga0068869_102109065	Not Available	506
3300005459|Ga0068867_101154001	Not Available	709
3300005718|Ga0068866_10460647	Not Available	833
3300006358|Ga0068871_102293647	Not Available	515
3300014969|Ga0157376_12549012	Not Available	551
3300014969|Ga0157376_12599020	Not Available	546
3300015267|Ga0182122_1054172	Not Available	547
3300015268|Ga0182154_1045124	Not Available	579
3300015269|Ga0182113_1071416	Not Available	554
3300015274|Ga0182188_1031485	Not Available	602
3300015274|Ga0182188_1035367	Not Available	584
3300015275|Ga0182172_1046114	Not Available	585
3300015276|Ga0182170_1037133	Not Available	622
3300015276|Ga0182170_1069362	Not Available	520
3300015277|Ga0182128_1025543	Not Available	694
3300015279|Ga0182174_1085802	Not Available	501
3300015281|Ga0182160_1038760	Not Available	628
3300015282|Ga0182124_1022449	Not Available	724
3300015282|Ga0182124_1040693	Not Available	617
3300015285|Ga0182186_1029325	Not Available	680
3300015285|Ga0182186_1042185	Not Available	614
3300015285|Ga0182186_1076207	Not Available	516
3300015286|Ga0182176_1021907	Not Available	769
3300015286|Ga0182176_1069838	Not Available	537
3300015287|Ga0182171_1078764	Not Available	521
3300015287|Ga0182171_1080557	Not Available	517
3300015287|Ga0182171_1080909	Not Available	517
3300015288|Ga0182173_1036009	Not Available	647
3300015288|Ga0182173_1050235	Not Available	591
3300015288|Ga0182173_1083184	Not Available	508
3300015291|Ga0182125_1055352	Not Available	591
3300015291|Ga0182125_1058736	Not Available	581
3300015292|Ga0182141_1000076	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum officinarum	4255
3300015294|Ga0182126_1028084	Not Available	720
3300015294|Ga0182126_1091517	Not Available	510
3300015295|Ga0182175_1089423	Not Available	518
3300015298|Ga0182106_1069668	Not Available	567
3300015299|Ga0182107_1052875	Not Available	620
3300015299|Ga0182107_1103233	Not Available	504
3300015300|Ga0182108_1019506	Not Available	830
3300015300|Ga0182108_1052763	Not Available	624
3300015300|Ga0182108_1095127	Not Available	521
3300015302|Ga0182143_1031090	Not Available	720
3300015302|Ga0182143_1086199	Not Available	534
3300015302|Ga0182143_1103445	Not Available	504
3300015303|Ga0182123_1036680	Not Available	669
3300015304|Ga0182112_1072872	Not Available	564
3300015304|Ga0182112_1091283	Not Available	527
3300015307|Ga0182144_1074576	Not Available	565
3300015307|Ga0182144_1076861	Not Available	560
3300015307|Ga0182144_1081894	Not Available	549
3300015307|Ga0182144_1088234	Not Available	537
3300015308|Ga0182142_1037207	Not Available	707
3300015308|Ga0182142_1075152	Not Available	575
3300015314|Ga0182140_1028602	Not Available	764
3300015314|Ga0182140_1047056	Not Available	663
3300015314|Ga0182140_1081742	Not Available	562
3300015323|Ga0182129_1044960	Not Available	669
3300015341|Ga0182187_1071840	Not Available	724
3300015341|Ga0182187_1075407	Not Available	712
3300015341|Ga0182187_1108412	Not Available	628
3300015341|Ga0182187_1161173	Not Available	545
3300015341|Ga0182187_1195280	Not Available	507
3300015342|Ga0182109_1006127	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	1672
3300015343|Ga0182155_1059637	Not Available	807
3300015343|Ga0182155_1065382	Not Available	783
3300015343|Ga0182155_1191455	Not Available	534
3300015343|Ga0182155_1194636	Not Available	531
3300015344|Ga0182189_1184851	Not Available	546
3300015344|Ga0182189_1198529	Not Available	531
3300015345|Ga0182111_1040172	Not Available	982
3300015345|Ga0182111_1131472	Not Available	640
3300015346|Ga0182139_1077278	Not Available	779
3300015346|Ga0182139_1104199	Not Available	698
3300015346|Ga0182139_1134295	Not Available	635
3300015346|Ga0182139_1156824	Not Available	599
3300015346|Ga0182139_1197600	Not Available	547
3300015347|Ga0182177_1035942	Not Available	1027
3300015347|Ga0182177_1080395	Not Available	771
3300015347|Ga0182177_1215198	Not Available	532
3300015351|Ga0182161_1269787	Not Available	500
3300015355|Ga0182159_1047784	Not Available	1143
3300015355|Ga0182159_1184504	Not Available	665
3300015355|Ga0182159_1202251	Not Available	640
3300015355|Ga0182159_1301712	Not Available	537
3300015355|Ga0182159_1337312	Not Available	511
3300015361|Ga0182145_1128394	Not Available	578
3300017404|Ga0182203_1058271	Not Available	702
3300017404|Ga0182203_1077368	Not Available	642
3300017407|Ga0182220_1060700	Not Available	593
3300017409|Ga0182204_1080930	Not Available	568
3300017409|Ga0182204_1083518	Not Available	563
3300017410|Ga0182207_1144842	Not Available	538
3300017410|Ga0182207_1173631	Not Available	505
3300017410|Ga0182207_1177464	Not Available	501
3300017411|Ga0182208_1074129	Not Available	599
3300017411|Ga0182208_1086414	Not Available	572
3300017411|Ga0182208_1119143	Not Available	516
3300017413|Ga0182222_1092634	Not Available	524
3300017415|Ga0182202_1088887	Not Available	582
3300017415|Ga0182202_1093163	Not Available	573
3300017417|Ga0182230_1049942	Not Available	735
3300017417|Ga0182230_1084794	Not Available	575
3300017420|Ga0182228_1113468	Not Available	527
3300017424|Ga0182219_1016121	Not Available	995
3300017424|Ga0182219_1101165	Not Available	558
3300017424|Ga0182219_1112582	Not Available	539
3300017424|Ga0182219_1124798	Not Available	522
3300017425|Ga0182224_1040088	Not Available	784
3300017427|Ga0182190_1046962	Not Available	769
3300017427|Ga0182190_1139772	Not Available	532
3300017430|Ga0182192_1148751	Not Available	530
3300017433|Ga0182206_1033665	Not Available	818
3300017433|Ga0182206_1095694	Not Available	592
3300017433|Ga0182206_1151774	Not Available	510
3300017442|Ga0182221_1086915	Not Available	620
3300017442|Ga0182221_1160257	Not Available	512
3300017680|Ga0182233_1117342	Not Available	500
3300017682|Ga0182229_1077956	Not Available	574
3300017682|Ga0182229_1083731	Not Available	556
3300017685|Ga0182227_1085499	Not Available	599
3300017685|Ga0182227_1126708	Not Available	516
3300017686|Ga0182205_1082846	Not Available	643
3300017686|Ga0182205_1124578	Not Available	561
3300017690|Ga0182223_1119862	Not Available	508
3300025934|Ga0207686_11456987	Not Available	564

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	94.57%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.33%
Roots	Host-Associated → Plants → Roots	0.78%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	94.57%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.33%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.78%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	94.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.33%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.78%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	94.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.33%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.78%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1021090651	3300005334	Miscanthus Rhizosphere	MPVLPDSPECAALRADMRGDRLNSRFQHIQKNKSVKAYGVV*
Ga0068867_1011540011	3300005459	Miscanthus Rhizosphere	NLPVLPDSPECAAMRADMKGDRLNSQLQHIYENRSVKAHWVA*
Ga0068866_104606472	3300005718	Miscanthus Rhizosphere	MLPDNPECTAMRADMKGNRLNSRFQYIHENESVRAHGGV*
Ga0068871_1022936472	3300006358	Miscanthus Rhizosphere	LPVLPDSPECVAMRADMKGDRLNSRFQHIHENKSIKAHWVV*
Ga0157376_125490121	3300014969	Miscanthus Rhizosphere	NMPVLPDSPECAALRADMKGGRLNSRFQHIHKNKSIKALGVV*
Ga0157376_125990201	3300014969	Miscanthus Rhizosphere	PECATLRADMRGDQLNSRFQHIDKNKSVKAYGVV*
Ga0182122_10541721	3300015267	Miscanthus Phyllosphere	GRNMPVLLDSPECVALRVDIEGDQLNSRFQHIHKNKSIKAHGVM*
Ga0182154_10451241	3300015268	Miscanthus Phyllosphere	VPVLPDSPEYASLRSDMKGDRLNSRFQHTHKNKSVKA
Ga0182113_10714161	3300015269	Miscanthus Phyllosphere	MPVLPDSPECAALRADMKGDRLNSRFQHIHKNKSVKAHGVVEAKSVIIQD
Ga0182188_10314851	3300015274	Miscanthus Phyllosphere	VLPDSSECAGLRADMRGDRLNSRFQHIHKNKSVKAYAVV*
Ga0182188_10353671	3300015274	Miscanthus Phyllosphere	VLPDSPECAALRADMKGDRLNSRFQHIHMNKLVKARGV
Ga0182172_10461141	3300015275	Miscanthus Phyllosphere	SNLGRNVPVLPDSPECAALRADMKGDRLNSRFQHIHKNKSVKAHGVV*
Ga0182170_10371331	3300015276	Miscanthus Phyllosphere	MPVLPDSSECTALRADMRGNQQNSRFQHIHKNESIE
Ga0182170_10693621	3300015276	Miscanthus Phyllosphere	VPVLPDNPECAALRADMKGDRLNSQFQHIHKNKSVKTYGVV*
Ga0182128_10255431	3300015277	Miscanthus Phyllosphere	MLLDSPECVALRADMKGDRLNSRFQHIHKNKLVKAHGVV*
Ga0182174_10858021	3300015279	Miscanthus Phyllosphere	LPDSPECVAMRADMKGDRLNSRFQHIRENRSVKAHWVT*
Ga0182160_10387601	3300015281	Miscanthus Phyllosphere	MSNLGRNVPVLPDSAECAALRANMKGDRLNSRLQHIHKNKSVKAHGVV*
Ga0182124_10224491	3300015282	Miscanthus Phyllosphere	MLVLPDSPECAALRADMKGDRLNSRFQHIRKNKSVKA
Ga0182124_10406931	3300015282	Miscanthus Phyllosphere	MPVLPDSPECVALRANVEENRLNSRFQHTHKNKSVKAHGVVKEKS
Ga0182186_10293251	3300015285	Miscanthus Phyllosphere	MSVLPDSPECAALRADMRDRLNSQFQHIHMNKSIKAHGV
Ga0182186_10421851	3300015285	Miscanthus Phyllosphere	MLPNSTECVALRADMKGDRLNSRFQYIHKNKSVKARGV
Ga0182186_10762071	3300015285	Miscanthus Phyllosphere	VLPDSLECAALRADMRGDRLNSQSQHIHKNESIKA
Ga0182176_10219072	3300015286	Miscanthus Phyllosphere	WNVPVLPDSPECAALRADMRGDRLNSRSQHIYKNESVKAHGVV*
Ga0182176_10698381	3300015286	Miscanthus Phyllosphere	VLPDSPECAAPRADMRGDRLNSRFQHIHKNKLIKAHGV
Ga0182171_10787641	3300015287	Miscanthus Phyllosphere	PDSPECAALRADMKGDRLNSRFQHIHKNKSVKTHVVV*
Ga0182171_10805571	3300015287	Miscanthus Phyllosphere	QNVPVLPDSPECAALRADMKGDRLNSRFLHIHKNKSVKAHGVV*
Ga0182171_10809091	3300015287	Miscanthus Phyllosphere	VPVLPDNPECAALRADMKGDRLNSRFQHIHENKSVK
Ga0182173_10360091	3300015288	Miscanthus Phyllosphere	VLLDSPECAALRADMKGDRLNSRFQHIHKNKSVKAHRVV*
Ga0182173_10502351	3300015288	Miscanthus Phyllosphere	PDSPECTAVRADMKGNRLNSRFQYIHENKSVRAHGVV*
Ga0182173_10831841	3300015288	Miscanthus Phyllosphere	NVPVLPDSPECVALRADMKGDRLNNRFWRIHKNKSIKAYRVV*
Ga0182125_10553521	3300015291	Miscanthus Phyllosphere	MPVLLDSPECAALRADMKGDRLNSRFQHIRKNKSVKAH
Ga0182125_10587361	3300015291	Miscanthus Phyllosphere	VLPDSPECAALRADMKGDRLNSRFQHIHKNNRFKLMGL
Ga0182141_10000767	3300015292	Miscanthus Phyllosphere	VPVLLDSPECTALRADMKGDRLNSRFQHIHKNESIKAHGVM
Ga0182126_10280841	3300015294	Miscanthus Phyllosphere	VLPDSPKYAAMRADMKGDRLNSRFQHIHENKSVKAHWV
Ga0182126_10915171	3300015294	Miscanthus Phyllosphere	MPVLPDSPECAALRADMEGDRLNSQFQHIHKNKSVKALEV
Ga0182175_10894231	3300015295	Miscanthus Phyllosphere	MPVLPDSPECAALRADMERDRLNSRFQHTHKNKSVKTHGVMEE
Ga0182106_10696681	3300015298	Miscanthus Phyllosphere	MPVLPDSSECAALRADMEGDRLNSRFQHIHKNKSIKAHRVVEEKN
Ga0182107_10528751	3300015299	Miscanthus Phyllosphere	VLLDSPECVALRANVEGNRLNSRFQHTHKNKSVKAHGVVKE
Ga0182107_11032331	3300015299	Miscanthus Phyllosphere	PECAALRADMKGNRLNSRFQHIHKNKSVKAHGVM*
Ga0182108_10195061	3300015300	Miscanthus Phyllosphere	MPVLPDSSEYMALRADMRGDRLNSRAQHIYKNESVKAHGV
Ga0182108_10527631	3300015300	Miscanthus Phyllosphere	MPVLPDSPECVALRADMKGDQLNSRFQHIHKNKSVKTRGVV
Ga0182108_10951271	3300015300	Miscanthus Phyllosphere	NVPVLPDSPECVALRANVRGDRLNSRFEHIHKNKSVKAHEVM*
Ga0182143_10310901	3300015302	Miscanthus Phyllosphere	DNPEYAALRADMKGDRLNSRFRYIHKNKSVKALGVV*
Ga0182143_10861991	3300015302	Miscanthus Phyllosphere	MPVLPDSPEYAAPKADMKGDRLNSRFQHIHKNKSVKAHGVVKEESV
Ga0182143_11034451	3300015302	Miscanthus Phyllosphere	VPVLPDSPEYEALRADMKGDRLNSRFRHIHKNELVKAHGVV*
Ga0182123_10366801	3300015303	Miscanthus Phyllosphere	NVPVLPDSPECAALRADMKGDRLNSRFQHIHKNESIKAHGVM*
Ga0182112_10728721	3300015304	Miscanthus Phyllosphere	VLLDSPECVALRADMKGDRLNSRFQHIHENKSVKAHWV
Ga0182112_10912831	3300015304	Miscanthus Phyllosphere	VPVLPDSLECVALRADIRENLLNSRSQHVHKNKSIKAHR
Ga0182144_10745761	3300015307	Miscanthus Phyllosphere	VLLDSPECAALRADIKGDRLNSRFQHIHENKSVKAH
Ga0182144_10768611	3300015307	Miscanthus Phyllosphere	SPECVALRADMKGDQLNSRFHHIRENKSVRTHWVV*
Ga0182144_10818941	3300015307	Miscanthus Phyllosphere	PDSPECVALRADMKGDRLNIRFQHIHKNKLVKVHGIV*
Ga0182144_10882341	3300015307	Miscanthus Phyllosphere	MPVLPDSPECVALRADMRGDQLNSQFQHIHKNKSIK
Ga0182142_10372071	3300015308	Miscanthus Phyllosphere	VSVLPDSPECAALRADMRGDRLNSRFEHIPKNKSIKTHGV
Ga0182142_10751521	3300015308	Miscanthus Phyllosphere	PVLPDSPECAALRADMRGDRLNSRFQHIHENKSDKAHWVV*
Ga0182140_10286021	3300015314	Miscanthus Phyllosphere	LPVLLDSPECAALKADMKGDRLNSRFQHIHENKSVKAH*
Ga0182140_10470561	3300015314	Miscanthus Phyllosphere	GWNLPVLPDSPECAAMRADMKGDRLNSRFQYIHENKSIKAHGVV*
Ga0182140_10817421	3300015314	Miscanthus Phyllosphere	GRNLPVLPDSPECAAMRADMQRDRLNSRFLYIHEDESVKAHGVV*
Ga0182129_10449601	3300015323	Miscanthus Phyllosphere	VLPDSPECAALRADVEGDRLNSQFQHTHKNKSVKAHGV
Ga0182187_10718402	3300015341	Miscanthus Phyllosphere	VLPDSPECAALRDDMKGDRLNSRFQHIHKNKSVKAH
Ga0182187_10754071	3300015341	Miscanthus Phyllosphere	VLPDSPECAALRADMKGDRLNSRFQHIRENKSVKAHWVV*
Ga0182187_11084121	3300015341	Miscanthus Phyllosphere	DSPECVALRADMKGDRLNSRFQHIRKNKLVKAHGVV*
Ga0182187_11611731	3300015341	Miscanthus Phyllosphere	MLPDSSECAALEADMKGDRLNSRFQHIHENKSVKAHWVV
Ga0182187_11952801	3300015341	Miscanthus Phyllosphere	MPVLPDSPECVALRADMRGDRLNSRFQHIHKNKSVKAHE
Ga0182109_10061271	3300015342	Miscanthus Phyllosphere	MPVLPDSPECAALGADMEGDRLNSRFQHIHKNKSVKARG
Ga0182155_10596371	3300015343	Miscanthus Phyllosphere	MPVLPDSPECVALRADIKGDRLNSRFQHIHKNKSVKARG
Ga0182155_10653821	3300015343	Miscanthus Phyllosphere	VLPNSPECAALRADMKGDRLNSRFQHIHKNKSVKA
Ga0182155_11914551	3300015343	Miscanthus Phyllosphere	MPVLLDSPECVALRADMKGDRLNSRFQHIHKNKSVKA
Ga0182155_11946361	3300015343	Miscanthus Phyllosphere	VPVLPEKPEYAALRADMRGDRLNSRFQHIHKNKSVKA
Ga0182189_11848512	3300015344	Miscanthus Phyllosphere	MSVLPDSSECAALKAYMRGDRLNSRFQHIHKNKSVKA
Ga0182189_11985291	3300015344	Miscanthus Phyllosphere	DSPECAALRADMKGDRLNSRFQHIRKNKSVKAHGVV*
Ga0182111_10401721	3300015345	Miscanthus Phyllosphere	MPVLPDSPKCAALRDDMEGNRLNSRFQHTHKNKSIKDHGIM
Ga0182111_11314721	3300015345	Miscanthus Phyllosphere	MPVLLDSPECAALRADMERDWLNSRFQHTHKNKSVKAHGFV
Ga0182139_10772781	3300015346	Miscanthus Phyllosphere	MLPDSPEYAALKADMKGDRLNSQFQHIHENKLVKA
Ga0182139_11041991	3300015346	Miscanthus Phyllosphere	MLVLPDSPECVALRADMKENRLNSRFQHTHKNKSIKAY
Ga0182139_11342951	3300015346	Miscanthus Phyllosphere	VPVLPDSPECAALRADMRGNRLNSQSQHIHTNESIKAHGV
Ga0182139_11568241	3300015346	Miscanthus Phyllosphere	MPVLLDSPECAALRADMKRARLKSRFQHTHKNKSIKAHGIMEGK
Ga0182139_11976001	3300015346	Miscanthus Phyllosphere	VLVLLDSPECAALRADMRGDRLNSRFQHIHKNKSVKAHGVV
Ga0182177_10359421	3300015347	Miscanthus Phyllosphere	MPVLPDSSECAALRADMKGDRLNSRFQHIHKNKSVKAHGV
Ga0182177_10803951	3300015347	Miscanthus Phyllosphere	VLPDSPECVAMRADMKGDRLNSRFQHIHENKSIKAHW
Ga0182177_12151981	3300015347	Miscanthus Phyllosphere	SPECVALRADMKGDRLNSRFQNIHKNKSVKAHEVV*
Ga0182161_12697871	3300015351	Miscanthus Phyllosphere	MLVLLDSPECVALRADVKGDRLNSRFQHTHKNKSVKAH
Ga0182159_10477842	3300015355	Miscanthus Phyllosphere	MPVLPGSPEYAALRADMKGDRLNSRFQHIHKNKSVK
Ga0182159_11845042	3300015355	Miscanthus Phyllosphere	VLPDSPECAALRADVERNRLNSRFQHTHKNKSVKAHGVVE
Ga0182159_12022511	3300015355	Miscanthus Phyllosphere	MPVLQESPECAALRADMEGNRLNSRFQHTQKNTLIKAYGIMEGKLVIT*
Ga0182159_12673391	3300015355	Miscanthus Phyllosphere	MPVLPDSPECAAPRADMKGNSRFQHTDKNKSVKTHGIVEENWLS
Ga0182159_13017121	3300015355	Miscanthus Phyllosphere	MLPDSPECAVMRADMKGDRLNSRFQHIHENKSVKAH
Ga0182159_13373121	3300015355	Miscanthus Phyllosphere	VLTDSPECAALRADMKGDRLNSRFQHIIENKSVKAH
Ga0182145_11283941	3300015361	Miscanthus Phyllosphere	LPVLPDSPECVAMRADMKGDRLNSRFQYIHENKSVKAHRVM*
Ga0182203_10582711	3300017404	Miscanthus Phyllosphere	MPVLLDSPECAALRADMKGDRLNGRFQHIHKNESVIAHG
Ga0182203_10773681	3300017404	Miscanthus Phyllosphere	DSPECTALRADVEGDRLNSQFQHSHKNKLVKAHEVMEERISYHSG
Ga0182220_10607001	3300017407	Miscanthus Phyllosphere	VPVLLDNPECAALKADMKGDRLNSRFQHIHKNKSIKLMGL
Ga0182204_10809301	3300017409	Miscanthus Phyllosphere	SPECAALRADMKGDRLNSRFQHIHKNKLVKAHEVV
Ga0182204_10835181	3300017409	Miscanthus Phyllosphere	VLPDSPECAALRADMKGDRLNSRFQYIHKNKSIKAHGIV
Ga0182207_11448421	3300017410	Miscanthus Phyllosphere	MLVLPDSPECAALRADMKGDRLNSRFQHIRKNKSVKAHGV
Ga0182207_11736311	3300017410	Miscanthus Phyllosphere	MPVLPDSSECAGLRADMRGDRLNSRFQHIHKNKSI
Ga0182207_11774641	3300017410	Miscanthus Phyllosphere	NVPVLPDSPECAALRADMKGDRLNSRFQHIHKNKSVKAHGVV
Ga0182208_10741292	3300017411	Miscanthus Phyllosphere	MPVLPDSSECVALRADMKGDRLNNRFHYIHKDKSVK
Ga0182208_10864141	3300017411	Miscanthus Phyllosphere	PVLPDSPECVALRADMREKRLNSQSQHVHKNESIKAHGVV
Ga0182208_11191431	3300017411	Miscanthus Phyllosphere	VLPDSPECAALEADMKGDRLNSRFQHISKDESVKAHWVV
Ga0182222_10226821	3300017413	Miscanthus Phyllosphere	VPVLSDSPECAALRHDMKGDRLNSRFQHIHKNKSFKARGV
Ga0182222_10926342	3300017413	Miscanthus Phyllosphere	MPVLPDSPECVALRADMEGDRLNSQFQHTHKNKSIKA
Ga0182202_10888871	3300017415	Miscanthus Phyllosphere	MPVLPNSSECAALRADMKGDRLNSRFQHTHKNKSIKAHGIMEGKSVI
Ga0182202_10931631	3300017415	Miscanthus Phyllosphere	LPDSPECAALRADMKGDRLNSRFQHIHKNKSVRAHGVV
Ga0182230_10499421	3300017417	Miscanthus Phyllosphere	MPVLPDSPKCAALRADMKGDRLNSRFQHIHKNKSVKAHGIV
Ga0182230_10847941	3300017417	Miscanthus Phyllosphere	VLPDSPECVALRADVKGDRLNSRFQHTHKNKSVKAHGVMEEK
Ga0182228_11134681	3300017420	Miscanthus Phyllosphere	VPVLPDSPEYAALRADLKGDRLNSQFQHIHKNKSIKA
Ga0182219_10161211	3300017424	Miscanthus Phyllosphere	VLPDSSKCAALRADMRGDRLNSRFQHIHKNKSVKAYGVV
Ga0182219_11011651	3300017424	Miscanthus Phyllosphere	LPVLPDSPECAAMRADMIGNRLNSRFQYIHENELVRAHGGV
Ga0182219_11125821	3300017424	Miscanthus Phyllosphere	MPVLPDNSKCAALRADVEGDRLNSQFQHTQKNKSVKAHGIME
Ga0182219_11247981	3300017424	Miscanthus Phyllosphere	VLPDSPKCVALRADVEENRLNSRFQHTHKNKSVKARG
Ga0182224_10400881	3300017425	Miscanthus Phyllosphere	NLPVLPDSPECAAMRADMKGDRLNSRFQHFHENKSVKAHGIM
Ga0182190_10469621	3300017427	Miscanthus Phyllosphere	MPVLLDSPECAALRANMRGDRLNSRFQHIQKNKSVKAY
Ga0182190_11397721	3300017427	Miscanthus Phyllosphere	MLVLPDSPECVALRADVKGDRLNSQFQHTHKNKSIKA
Ga0182192_11487512	3300017430	Miscanthus Phyllosphere	MMVLPDSPECVALRADMERNRLNSRFQHTHKNKSVKAHGAVKEESIIIQ
Ga0182206_10336651	3300017433	Miscanthus Phyllosphere	DNPEYAALRADIKGDRLNSRFQHIHKNKSVKAHGVV
Ga0182206_10956941	3300017433	Miscanthus Phyllosphere	MPVLPDSPKCAALRDDMEGNRLNSRFQHTHKNKSIKD
Ga0182206_11517741	3300017433	Miscanthus Phyllosphere	VPVLPNSPECAALKADMKGDRLQHIQKNKSFKARGV
Ga0182221_10869151	3300017442	Miscanthus Phyllosphere	MPALPDSPECAALRADVEGNQLNSRFQHTHKNKSVKAHGVVEGK
Ga0182221_11602571	3300017442	Miscanthus Phyllosphere	SNLGWNMPVLLDSPECVALRADTKGDRLNSRFQHIHKNKSVKAHGVV
Ga0182233_11173421	3300017680	Miscanthus Phyllosphere	SPEYVALRANMKGDRLNSRLQHIRKNKLVKAHGVV
Ga0182229_10779561	3300017682	Miscanthus Phyllosphere	VLPDSPECVALRADMKGDRLNSRFQHIHKNKSVKAHG
Ga0182229_10837311	3300017682	Miscanthus Phyllosphere	VLPDSPECVALRADMKGDRLNSRFQHIHKNKSVKAHGV
Ga0182218_10827281	3300017683	Miscanthus Phyllosphere	MLLLPDSFDCTALRADVKGDRLNSRFQHTHKNKSVKAHGIM
Ga0182227_10854991	3300017685	Miscanthus Phyllosphere	VLPDSPECTAMRADMKGDRLNSRFQHIHENKSVKAHW
Ga0182227_11267081	3300017685	Miscanthus Phyllosphere	PDSPECAALRADMRGDRLNSRFQHIHKNKSVKAHGVV
Ga0182205_10828461	3300017686	Miscanthus Phyllosphere	MSVLLDCPECVALRADMKGDRLNSRFQHIHKNKLVKTHGVV
Ga0182205_11245781	3300017686	Miscanthus Phyllosphere	PVLPDSPECAAMRADMKGDRLNSRFQHIHENKSVKAHGAV
Ga0182223_11198621	3300017690	Miscanthus Phyllosphere	MPVLPDSTECAALRADMKGDRLNSRFQHIRENKSVKAHWV
Ga0207686_114569871	3300025934	Miscanthus Rhizosphere	SPEYTSLRADMKGDRPNSQFQHIHKNKSVKAHGVV