| Basic Information | |
|---|---|
| Family ID | F063708 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MDLNTFIEYIKLHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEGRI |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 43.41 % |
| % of genes near scaffold ends (potentially truncated) | 18.60 % |
| % of genes from short scaffolds (< 2000 bps) | 72.09 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.73 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (46.512 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.054 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.713 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.488 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.57% β-sheet: 0.00% Coil/Unstructured: 54.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.73 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.23.1.1: HSC20 (HSCB), C-terminal oligomerisation domain | d1fpoa2 | 1fpo | 0.86793 |
| a.26.1.1: Long-chain cytokines | d1alua_ | 1alu | 0.85607 |
| a.252.1.1: CSE2-like | d1ykhb1 | 1ykh | 0.84994 |
| a.29.6.1: Plant invertase/pectin methylesterase inhibitor | d1x91a_ | 1x91 | 0.83878 |
| a.24.19.1: Flagellar export chaperone FliS | d1orja1 | 1orj | 0.83487 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 9.30 |
| PF14025 | DUF4241 | 7.75 |
| PF02467 | Whib | 6.20 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.55 |
| PF00011 | HSP20 | 0.78 |
| PF02675 | AdoMet_dc | 0.78 |
| PF04860 | Phage_portal | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.97 % |
| Unclassified | root | N/A | 24.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2200042376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 562 | Open in IMG/M |
| 3300000756|JGI12421J11937_10002511 | Not Available | 7386 | Open in IMG/M |
| 3300000756|JGI12421J11937_10014056 | All Organisms → Viruses → Predicted Viral | 3033 | Open in IMG/M |
| 3300000867|EsTDRAFT_1065701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300002161|JGI24766J26685_10013507 | All Organisms → Viruses → Predicted Viral | 2146 | Open in IMG/M |
| 3300002386|B570J29613_1007909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300002408|B570J29032_108816303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300002408|B570J29032_109156097 | Not Available | 615 | Open in IMG/M |
| 3300002835|B570J40625_100070352 | Not Available | 4650 | Open in IMG/M |
| 3300003430|JGI25921J50272_10025113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1545 | Open in IMG/M |
| 3300003430|JGI25921J50272_10091877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300003430|JGI25921J50272_10133072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300003499|JGI25930J51415_1001837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4826 | Open in IMG/M |
| 3300004112|Ga0065166_10067751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 1231 | Open in IMG/M |
| 3300004112|Ga0065166_10117859 | Not Available | 984 | Open in IMG/M |
| 3300004123|Ga0066181_10230370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300004240|Ga0007787_10623062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300005517|Ga0070374_10094108 | All Organisms → Viruses → Predicted Viral | 1561 | Open in IMG/M |
| 3300005517|Ga0070374_10100901 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
| 3300005581|Ga0049081_10078636 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
| 3300005662|Ga0078894_10043299 | All Organisms → Viruses → Predicted Viral | 3779 | Open in IMG/M |
| 3300005662|Ga0078894_10105358 | All Organisms → Viruses → Predicted Viral | 2494 | Open in IMG/M |
| 3300005662|Ga0078894_10459284 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| 3300005662|Ga0078894_10574273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300005662|Ga0078894_10958741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300005662|Ga0078894_11095124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300005662|Ga0078894_11539664 | Not Available | 551 | Open in IMG/M |
| 3300005662|Ga0078894_11706535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300005805|Ga0079957_1088394 | All Organisms → Viruses → Predicted Viral | 1726 | Open in IMG/M |
| 3300005941|Ga0070743_10002734 | Not Available | 6586 | Open in IMG/M |
| 3300005941|Ga0070743_10007349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3920 | Open in IMG/M |
| 3300005941|Ga0070743_10046178 | All Organisms → Viruses → Predicted Viral | 1488 | Open in IMG/M |
| 3300006030|Ga0075470_10246035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300006484|Ga0070744_10002018 | Not Available | 6135 | Open in IMG/M |
| 3300006484|Ga0070744_10084572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300006641|Ga0075471_10204794 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300006641|Ga0075471_10245923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300006875|Ga0075473_10228165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300007541|Ga0099848_1142065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300007546|Ga0102874_1095089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300007549|Ga0102879_1217250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300007554|Ga0102820_1155167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300007562|Ga0102915_1305822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300007593|Ga0102918_1205019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300007603|Ga0102921_1016155 | All Organisms → Viruses → Predicted Viral | 2760 | Open in IMG/M |
| 3300007603|Ga0102921_1260687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300007647|Ga0102855_1213152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300007681|Ga0102824_1113120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300007708|Ga0102859_1156415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300008108|Ga0114341_10172796 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300008113|Ga0114346_1003531 | Not Available | 10039 | Open in IMG/M |
| 3300008113|Ga0114346_1296998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300008116|Ga0114350_1160044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300008262|Ga0114337_1026549 | Not Available | 5847 | Open in IMG/M |
| 3300009068|Ga0114973_10009842 | Not Available | 6236 | Open in IMG/M |
| 3300009158|Ga0114977_10026249 | All Organisms → Viruses → Predicted Viral | 3650 | Open in IMG/M |
| 3300009160|Ga0114981_10521590 | Not Available | 634 | Open in IMG/M |
| 3300009180|Ga0114979_10395495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300009419|Ga0114982_1229821 | Not Available | 576 | Open in IMG/M |
| 3300010354|Ga0129333_10069570 | All Organisms → Viruses → Predicted Viral | 3270 | Open in IMG/M |
| 3300010354|Ga0129333_11028001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300010370|Ga0129336_10064154 | Not Available | 2181 | Open in IMG/M |
| 3300010388|Ga0136551_1000378 | Not Available | 12855 | Open in IMG/M |
| 3300010970|Ga0137575_10059085 | Not Available | 606 | Open in IMG/M |
| 3300012667|Ga0157208_10002900 | All Organisms → Viruses → Predicted Viral | 3179 | Open in IMG/M |
| 3300013004|Ga0164293_10146978 | Not Available | 1756 | Open in IMG/M |
| 3300013004|Ga0164293_10157961 | All Organisms → Viruses → Predicted Viral | 1678 | Open in IMG/M |
| 3300013004|Ga0164293_10760781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 617 | Open in IMG/M |
| 3300013006|Ga0164294_10388084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300020048|Ga0207193_1802706 | Not Available | 591 | Open in IMG/M |
| 3300020048|Ga0207193_1854811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300020141|Ga0211732_1541161 | Not Available | 3821 | Open in IMG/M |
| 3300020151|Ga0211736_10478877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4010 | Open in IMG/M |
| 3300020159|Ga0211734_10471619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300020161|Ga0211726_10456080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300020172|Ga0211729_10238317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300020494|Ga0208326_100010 | Not Available | 10298 | Open in IMG/M |
| 3300020498|Ga0208050_1000924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 4274 | Open in IMG/M |
| 3300020519|Ga0208223_1019245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
| 3300020569|Ga0208229_1024258 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300021961|Ga0222714_10045488 | All Organisms → Viruses → Predicted Viral | 3094 | Open in IMG/M |
| 3300021962|Ga0222713_10106316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2002 | Open in IMG/M |
| 3300021962|Ga0222713_10214527 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
| 3300021962|Ga0222713_10527541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300023174|Ga0214921_10000213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 115201 | Open in IMG/M |
| 3300023174|Ga0214921_10000295 | Not Available | 98310 | Open in IMG/M |
| 3300023174|Ga0214921_10010827 | Not Available | 11208 | Open in IMG/M |
| 3300024346|Ga0244775_10021564 | Not Available | 5856 | Open in IMG/M |
| 3300024346|Ga0244775_10155770 | All Organisms → Viruses → Predicted Viral | 1927 | Open in IMG/M |
| 3300024348|Ga0244776_10825588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300025585|Ga0208546_1039825 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300025732|Ga0208784_1033052 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
| 3300025848|Ga0208005_1089152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300025848|Ga0208005_1108635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300027571|Ga0208897_1054029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1064 | Open in IMG/M |
| 3300027644|Ga0209356_1057466 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300027689|Ga0209551_1110385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300027720|Ga0209617_10150783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 915 | Open in IMG/M |
| 3300027733|Ga0209297_1039596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2165 | Open in IMG/M |
| 3300027769|Ga0209770_10369123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300027797|Ga0209107_10279154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300027805|Ga0209229_10253333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300027805|Ga0209229_10270949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300027892|Ga0209550_10143193 | Not Available | 1714 | Open in IMG/M |
| 3300027963|Ga0209400_1016899 | All Organisms → Viruses → Predicted Viral | 4390 | Open in IMG/M |
| 3300027973|Ga0209298_10003749 | Not Available | 8999 | Open in IMG/M |
| 3300027973|Ga0209298_10302498 | Not Available | 624 | Open in IMG/M |
| 3300027974|Ga0209299_1249026 | Not Available | 634 | Open in IMG/M |
| 3300031758|Ga0315907_10279747 | All Organisms → Viruses → Predicted Viral | 1375 | Open in IMG/M |
| 3300031857|Ga0315909_10078917 | All Organisms → Viruses → Predicted Viral | 2912 | Open in IMG/M |
| 3300031857|Ga0315909_10442608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| 3300031857|Ga0315909_10935611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300031951|Ga0315904_10515874 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
| 3300032092|Ga0315905_10019795 | Not Available | 6815 | Open in IMG/M |
| 3300033816|Ga0334980_0377717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300033996|Ga0334979_0417180 | Not Available | 739 | Open in IMG/M |
| 3300034013|Ga0334991_0071103 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300034061|Ga0334987_0002910 | Not Available | 16528 | Open in IMG/M |
| 3300034061|Ga0334987_0085476 | All Organisms → Viruses → Predicted Viral | 2473 | Open in IMG/M |
| 3300034092|Ga0335010_0309282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300034093|Ga0335012_0300832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300034102|Ga0335029_0412117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 812 | Open in IMG/M |
| 3300034109|Ga0335051_0282420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300034109|Ga0335051_0289827 | Not Available | 796 | Open in IMG/M |
| 3300034111|Ga0335063_0108737 | All Organisms → Viruses → Predicted Viral | 1665 | Open in IMG/M |
| 3300034120|Ga0335056_0307806 | Not Available | 877 | Open in IMG/M |
| 3300034272|Ga0335049_0571499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300034279|Ga0335052_0151242 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
| 3300034283|Ga0335007_0283211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.05% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.98% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 6.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.65% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.10% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.88% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.33% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.33% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.33% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.55% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.55% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.55% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.78% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.78% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.78% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine | 0.78% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000867 | Estuary microbial communities from the Columbia River - metatranscriptome 5 PSU | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002386 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200258559 | 2199352005 | Freshwater | MDLNTFIEYMKLHLISLEQDLEENPASIHVVDIEGQIFATQHLLSVAEGRI |
| JGI12421J11937_100025119 | 3300000756 | Freshwater And Sediment | MDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNER* |
| JGI12421J11937_100140561 | 3300000756 | Freshwater And Sediment | MDLNTFKEYLNLHLXSLEQDLEENPASIHVVDIEGQIYAVKHMIEVI |
| EsTDRAFT_10657011 | 3300000867 | Freshwater And Marine | MDLNTFKQYLNLHLISLEQDLEENPCSMNVVDIEGQIYATKHLM |
| JGI24766J26685_100135074 | 3300002161 | Freshwater And Sediment | MDLNTFIEYIKIHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEGRI* |
| B570J29613_10079091 | 3300002386 | Freshwater | MLTRSSHFLEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATKHLLSVAT |
| B570J29032_1088163032 | 3300002408 | Freshwater | MNQFIEYMKIHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEGMIKE* |
| B570J29032_1091560972 | 3300002408 | Freshwater | MDLNTFKEYINIHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNER* |
| B570J40625_1000703522 | 3300002835 | Freshwater | MDLNTFIEYMKLHLISLEQDLEENPASIHVVDIEGQIFATQHLLSVAEGRI* |
| JGI25921J50272_100251136 | 3300003430 | Freshwater Lake | MDLETFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYATKHLIEVINER* |
| JGI25921J50272_100918771 | 3300003430 | Freshwater Lake | MDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNEQ* |
| JGI25921J50272_101330722 | 3300003430 | Freshwater Lake | MDLNTFKQYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLIEVLNG* |
| JGI25930J51415_10018374 | 3300003499 | Freshwater Lake | MPNKLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA* |
| Ga0065166_100677515 | 3300004112 | Freshwater Lake | MKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA* |
| Ga0065166_101178594 | 3300004112 | Freshwater Lake | MDLNTFKEYLNIHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER* |
| Ga0066181_102303701 | 3300004123 | Freshwater Lake | MDLETFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNG* |
| Ga0007787_106230621 | 3300004240 | Freshwater Lake | MNLDTFKEYLNIHLISLEQDLEENPTSDNVIDIEGQIHATKHFMEVLDER* |
| Ga0070374_100941084 | 3300005517 | Freshwater Lake | MDLETFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINE* |
| Ga0070374_101009014 | 3300005517 | Freshwater Lake | MDLNTFIEYIKLHLISLEQDLEENPASIHVVDIEGQIYATQHLLSVAEGRI* |
| Ga0049081_100786362 | 3300005581 | Freshwater Lentic | MDLNTFKEYLNLHLISLEQDLEENPASIHVVDIEGQIYAVKHMIEVINER* |
| Ga0078894_1004329911 | 3300005662 | Freshwater Lake | MDLNTFKEYLNLHLISLEQDLEENPASIHVVDIEGQIYATKHLIEVINER* |
| Ga0078894_101053586 | 3300005662 | Freshwater Lake | MDLETFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER* |
| Ga0078894_104592842 | 3300005662 | Freshwater Lake | MNQFIEYMKIHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEGMLE* |
| Ga0078894_105742731 | 3300005662 | Freshwater Lake | MSNKLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA* |
| Ga0078894_109587411 | 3300005662 | Freshwater Lake | FIEYMKLHLLSLEQDLEENPASIHVVDIEGQIYATRHLLSVALDIMEESERN* |
| Ga0078894_110951243 | 3300005662 | Freshwater Lake | MDLNTFIEYIKLHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEGRI* |
| Ga0078894_115396642 | 3300005662 | Freshwater Lake | LNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLIEVLNG* |
| Ga0078894_117065352 | 3300005662 | Freshwater Lake | MDLNTFIEYIKLHLISLEQDLEENPASIHVVDIEGQIYATQHLLSVAEGMIE* |
| Ga0079957_10883944 | 3300005805 | Lake | MSNQLIEYIKLHLISLNQDLEINPESINVVDIPGQIYATEHLLSVAEDIMG* |
| Ga0070743_1000273413 | 3300005941 | Estuarine | MDLNTFKEYINLHLISLEQDLEENPCSMNVVDIEGQIYATKHLMEVLNG* |
| Ga0070743_100073496 | 3300005941 | Estuarine | MSNQLIEYMKLHLISLEQDLEENPASIHVVDIEGQIYATRHLLSVAEDIMAQ* |
| Ga0070743_100461781 | 3300005941 | Estuarine | YMDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNER* |
| Ga0075470_102460353 | 3300006030 | Aqueous | MKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA*I |
| Ga0070744_1000201815 | 3300006484 | Estuarine | MDLETFKQYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNEH* |
| Ga0070744_100845725 | 3300006484 | Estuarine | MDLNTLREYLNIHLISLEQDLEANPESTNVVDIEGQIYAIKHVIGVINE* |
| Ga0075471_102047943 | 3300006641 | Aqueous | MTNKLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA* |
| Ga0075471_102459232 | 3300006641 | Aqueous | MPNNLIEYMRLHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEEMYNEAV* |
| Ga0075473_102281651 | 3300006875 | Aqueous | NKLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEV* |
| Ga0099848_11420654 | 3300007541 | Aqueous | MSNSLIEYMKLHIISLEQDLEKNPESINVIDIPGQIEATRHLLSVAEDILK* |
| Ga0102874_10950891 | 3300007546 | Estuarine | MDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER* |
| Ga0102879_12172502 | 3300007549 | Estuarine | MDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEGRI* |
| Ga0102820_11551671 | 3300007554 | Estuarine | MDLNTFKEYINLHLISLEQDLEENPCSMNVVDIEGQIYATKHLIEVLNG* |
| Ga0102915_13058222 | 3300007562 | Estuarine | MDLNTFKQYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEGRI* |
| Ga0102918_12050193 | 3300007593 | Estuarine | YMDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNG* |
| Ga0102921_101615510 | 3300007603 | Estuarine | MLNQFIEYMKIHLISLNQDLEMNPESINVIDIPGQIEATRHLLSVATDILNED |
| Ga0102921_12606872 | 3300007603 | Estuarine | MDLNTFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER* |
| Ga0102855_12131521 | 3300007647 | Estuarine | MTKSSKFLEYMKLHLISLEQDLEENPCSLHVVDIEGQIYATKHLLSV |
| Ga0102824_11131201 | 3300007681 | Estuarine | FKEYINLHLISLEQDLEENPCSMNVVDIEGQIYATKHLMEVLNG* |
| Ga0102859_11564151 | 3300007708 | Estuarine | MTQFIEYMKIHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEGMIE* |
| Ga0114341_101727962 | 3300008108 | Freshwater, Plankton | MSNQLIEYMKLHLISLKQDLEMNPESINVVDIPGQIYATEHLLSVAEDIMG* |
| Ga0114346_100353119 | 3300008113 | Freshwater, Plankton | MDLNTLIEYMKLHLISLEQDLEENPCSIHVVDIEGQIYATKHLLSVAEGMIE* |
| Ga0114346_12969982 | 3300008113 | Freshwater, Plankton | MKKLIEYIKIHLISLEQDLEANPESINVVDIEGQIYATRHLLSVAEGMIE* |
| Ga0114350_11600442 | 3300008116 | Freshwater, Plankton | MESAYIIRTGQLKEYIKLHLISLNQDMEKDLNVESKINIQGQIMATEHLMSVVEDIMG* |
| Ga0114337_102654915 | 3300008262 | Freshwater, Plankton | MDLNTFIEYIKLHLISLEQDLEENPASIHVVDNEGQIYATKHLLSVAEGRI* |
| Ga0114973_100098427 | 3300009068 | Freshwater Lake | MDLNTFKEYLNLHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER* |
| Ga0114977_100262498 | 3300009158 | Freshwater Lake | MDLNTFKEYIKLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNG* |
| Ga0114981_105215902 | 3300009160 | Freshwater Lake | MDLNTFKEYINIHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER* |
| Ga0114979_103954953 | 3300009180 | Freshwater Lake | KEYLNIHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNG* |
| Ga0114982_12298213 | 3300009419 | Deep Subsurface | MDIKTLKEYLNIHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER* |
| Ga0129333_100695704 | 3300010354 | Freshwater To Marine Saline Gradient | MNQLIEYMKLHLISLEQDLESNPESINVIDIPGQIHATKHLLSVANDILAKTKEN* |
| Ga0129333_110280014 | 3300010354 | Freshwater To Marine Saline Gradient | MSNQLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA |
| Ga0129336_100641545 | 3300010370 | Freshwater To Marine Saline Gradient | MSNQLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA* |
| Ga0136551_100037812 | 3300010388 | Pond Fresh Water | MSNQLIEYLKLHLISLNQDLESHDNPETKIHLDGQIVATRHLLSVAEDIL* |
| Ga0137575_100590851 | 3300010970 | Pond Fresh Water | MDLNTFIEYMKLHLISLEQDLEENPASIHVVDIEGQIYATQHLLSVAEGKL* |
| Ga0157208_100029005 | 3300012667 | Freshwater | MDLETFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVING* |
| Ga0164293_101469785 | 3300013004 | Freshwater | MNQFIEYMKIHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEGMIEE* |
| Ga0164293_101579616 | 3300013004 | Freshwater | MDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLIEVLNG* |
| Ga0164293_107607812 | 3300013004 | Freshwater | MDLNTFKEYLNLHLISLEQDLEENPASIHVVDIEGQIYAV |
| Ga0164294_103880842 | 3300013006 | Freshwater | MTNLIEYMKLHLISLEQDLEMNPESINVIDIPGQIYATKHLLSVANDMMSS* |
| Ga0207193_18027063 | 3300020048 | Freshwater Lake Sediment | MDLNTFKEYLNLHLISLEQDLEENPMSLHVVDIEGQIYAVKHMIEVINER |
| Ga0207193_18548113 | 3300020048 | Freshwater Lake Sediment | MTQFIEYMKIHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEGMIEEXITYN |
| Ga0211732_15411613 | 3300020141 | Freshwater | MDINTLKEYMKIHLISLEQDLEENPTSDNVIDIEGQIYATRHLLSVAEGMIE |
| Ga0211736_1047887711 | 3300020151 | Freshwater | MKTHSTDNMIEYMKLHLISLEQDLEMNPESINVVDIPGQIYAVRHLLEVANESN |
| Ga0211734_104716192 | 3300020159 | Freshwater | MSEFNKLVEYMKIHLISLEQDLEDNPESINVVDIPGQIYAVRHLLEVADEYNR |
| Ga0211726_104560802 | 3300020161 | Freshwater | LKNTRYIMSNQLVEYMKIHLISLEQDLEDNTESINVVDIPGQIYAVSHLLEVANEF |
| Ga0211729_102383173 | 3300020172 | Freshwater | EYMKLHLISLEQDLEMNPESINVVDIPGQIYAVRHLLEVANESN |
| Ga0208326_10001013 | 3300020494 | Freshwater | MDLNTFIEYIKLHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEGRI |
| Ga0208050_100092410 | 3300020498 | Freshwater | MDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNG |
| Ga0208223_10192453 | 3300020519 | Freshwater | MNQFIEYMKIHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEGMIKE |
| Ga0208229_10242584 | 3300020569 | Freshwater | MNQFIEYMKIHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEGMIEE |
| Ga0222714_100454888 | 3300021961 | Estuarine Water | MSNQLIEYIKLHLISLNQDLEINPESINVVDIPGQIYATEHLLSVAEDIMG |
| Ga0222713_101063163 | 3300021962 | Estuarine Water | MKTHSTDKLIEYMKIHLISLNQDLQDNPESINVVDIPGQIYAVKHLLEVADEFN |
| Ga0222713_102145273 | 3300021962 | Estuarine Water | MPNNLIEYMRLHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEEMYNEAV |
| Ga0222713_105275412 | 3300021962 | Estuarine Water | MSNQLIEYIKLHLISLNQDLEINPESINVVDIPGQIYATEHLLSVVEDIMG |
| Ga0214921_1000021313 | 3300023174 | Freshwater | MDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLIEVLNG |
| Ga0214921_10000295139 | 3300023174 | Freshwater | MDLETFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINE |
| Ga0214921_1001082711 | 3300023174 | Freshwater | MDLNTFKEYLNIHLTSLEQDLEENPASIHVVDIEGQIYAVKHMIEVINER |
| Ga0244775_1002156413 | 3300024346 | Estuarine | MDLETFKQYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNEH |
| Ga0244775_101557704 | 3300024346 | Estuarine | MDLNTLREYLNIHLISLEQDLEANPESTNVVDIEGQIYAIKHVIGVINE |
| Ga0244776_108255882 | 3300024348 | Estuarine | MTQFIEYMKIHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEGMIE |
| Ga0208546_10398254 | 3300025585 | Aqueous | MPNKLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA |
| Ga0208784_10330525 | 3300025732 | Aqueous | MPNKLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAQDILEV |
| Ga0208005_10891525 | 3300025848 | Aqueous | MPNKLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLL |
| Ga0208005_11086354 | 3300025848 | Aqueous | MTNKLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA |
| Ga0208897_10540291 | 3300027571 | Estuarine | MSNQLIEYMKLHLISLEQDLEENPASIHVVDIEGQIYATRHLLSVAEDIMAQ |
| Ga0209356_10574662 | 3300027644 | Freshwater Lake | MSNKLIEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA |
| Ga0209551_11103854 | 3300027689 | Freshwater Lake | MDLNTFIEYIKLHLISLEQDLEENPASIHVVDIEGQIYATKHLLS |
| Ga0209617_101507831 | 3300027720 | Freshwater And Sediment | MDLNTFKEYINIHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNEQ |
| Ga0209297_10395963 | 3300027733 | Freshwater Lake | MDLNTFKEYIKLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNG |
| Ga0209770_103691231 | 3300027769 | Freshwater Lake | MDLNTFIEYIKLHLISLEQDLEENPASIHVVDIEGQIYATQHLLSVAEGRI |
| Ga0209107_102791541 | 3300027797 | Freshwater And Sediment | MDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNEQ |
| Ga0209229_102533331 | 3300027805 | Freshwater And Sediment | MTKSSHFLEYMKLHLISLEQDLEENPMSLHVVDIEGQIYATKHLL |
| Ga0209229_102709492 | 3300027805 | Freshwater And Sediment | MDLNTFIQYMKLHLISLEQDLEENPCSIHVVDIEGQIFATQHLLSVAEGKI |
| Ga0209550_101431935 | 3300027892 | Freshwater Lake | MDLNTFKQYINLHLISLEQDLEENPASIHVVDIEGQIYATKHLIEVLNG |
| Ga0209400_101689910 | 3300027963 | Freshwater Lake | MDLNTFKEYLNLHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER |
| Ga0209298_100037496 | 3300027973 | Freshwater Lake | MDLNTFKEYINLHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER |
| Ga0209298_103024982 | 3300027973 | Freshwater Lake | MDLNTFKEYLNIHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER |
| Ga0209299_12490262 | 3300027974 | Freshwater Lake | MDLNTFKEYINIHLISLEQDLEENPASIHVVDIEGQIYAVKHLIEVINER |
| Ga0315907_102797474 | 3300031758 | Freshwater | MESAYIIRTGQLKEYIKLHLISLNQDMEKDLNVESKINIQGQIMATEHLMSVVEDIMG |
| Ga0315909_100789173 | 3300031857 | Freshwater | MKKLIEYIKIHLISLEQDLEANPESINVVDIEGQIYATRHLLSVAEGMIE |
| Ga0315909_104426081 | 3300031857 | Freshwater | KAYGQKDILTMSNQLIEYMKLHLISLKQDLEMNPESINVVDIPGQIYATEHLLSVAEDIM |
| Ga0315909_109356112 | 3300031857 | Freshwater | MKLHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDMIEA |
| Ga0315904_105158743 | 3300031951 | Freshwater | MSNQLIEYMKLHLISLKQDLEMNPESINVVDIPGQIYATEHLLSVAEDIMG |
| Ga0315905_1001979510 | 3300032092 | Freshwater | MDLNTLIEYMKLHLISLEQDLEENPCSIHVVDIEGQIYATKHLLSVAEGMIE |
| Ga0334980_0377717_159_311 | 3300033816 | Freshwater | MNQLIEYMKIHLISLEQDLEMNPESINVVDIEGQIYATKHLLSVAEGMIE |
| Ga0334979_0417180_361_510 | 3300033996 | Freshwater | MDLETFKQYLNLHLISLEQDLEANPASIHVVDIEGQIYAVKHLIEVINE |
| Ga0334991_0071103_1301_1456 | 3300034013 | Freshwater | MNQFIEYMKIHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEDILNK |
| Ga0334987_0002910_12947_13102 | 3300034061 | Freshwater | MNQLIEYMKIHLISLEQDLESNPESINVVDIEGQIYATRHLLSVAEGMIEQ |
| Ga0334987_0085476_378_530 | 3300034061 | Freshwater | MDLETFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNGE |
| Ga0335010_0309282_745_903 | 3300034092 | Freshwater | YMDLNTFIEYIKLHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEGRI |
| Ga0335012_0300832_249_404 | 3300034093 | Freshwater | MDLNTFIEYIKLHLISLEQDLEENPASIPVVDIEGQIYATKHLLSVAEGRI |
| Ga0335029_0412117_3_140 | 3300034102 | Freshwater | MTQFIEYMKIHLISLEQDLEMNPESINVVDIEGQIYATRHLLSVAE |
| Ga0335051_0282420_209_364 | 3300034109 | Freshwater | MDLETFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYATKHLLSVAEGRI |
| Ga0335051_0289827_279_431 | 3300034109 | Freshwater | MDLNTFKEYLNLHLLSLEQDLEENPMSLHVVDIEGQIYAIKHMIEVINER |
| Ga0335063_0108737_1204_1359 | 3300034111 | Freshwater | MNQFIGYMKIHLISLEQDLEENPMSLHVVDIEGQIYATRHLLSVAEGMIEE |
| Ga0335056_0307806_266_415 | 3300034120 | Freshwater | MDLNTFIEYIKLHLISLEQDLEENPASIHVVDIEGQIYATKHLIEVLNG |
| Ga0335049_0571499_561_704 | 3300034272 | Freshwater | ETFKQYLNLHLISLEQDLEENPASIHVVDIEGQIYATKHLMEVLNGE |
| Ga0335052_0151242_40_189 | 3300034279 | Freshwater | MDLNTFKEYLNLHLISLEQDLEENPASIHVVDIEGQIYAVKHMIEVINE |
| Ga0335007_0283211_134_286 | 3300034283 | Freshwater | MDLNTFKEYIKLHLISLEQDLEENPASIHVVDIEGQIYATKHLMGVLNEQ |
| ⦗Top⦘ |