NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063704

Metagenome / Metatranscriptome Family F063704

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063704
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 41 residues
Representative Sequence MIITKYRMITENGYIETLNEQEAIEWGNYEVVTEEVPDEEN
Number of Associated Samples 92
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 7.75 %
% of genes from short scaffolds (< 2000 bps) 60.47 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (53.488 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(13.954 % of family members)
Environment Ontology (ENVO) Unclassified
(44.186 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(53.488 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.14%    β-sheet: 30.43%    Coil/Unstructured: 59.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF04883HK97-gp10_like 10.85
PF14550Peptidase_S78_2 6.98
PF08291Peptidase_M15_3 2.33
PF13385Laminin_G_3 1.55
PF04860Phage_portal 1.55
PF11443DUF2828 0.78
PF00149Metallophos 0.78
PF03237Terminase_6N 0.78
PF08774VRR_NUC 0.78
PF02954HTH_8 0.78
PF00166Cpn10 0.78
PF02195ParBc 0.78
PF08282Hydrolase_3 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.78
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.78
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.78
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.78
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.78
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.50 %
UnclassifiedrootN/A15.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000882|FwDRAFT_10205403All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1874Open in IMG/M
3300000882|FwDRAFT_10254715Not Available622Open in IMG/M
3300002470|metazooDRAFT_1369951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. 1021084Open in IMG/M
3300002476|metazooDRAFT_10911727All Organisms → cellular organisms → Bacteria3030Open in IMG/M
3300002835|B570J40625_100060716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5182Open in IMG/M
3300003277|JGI25908J49247_10049617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1102Open in IMG/M
3300003277|JGI25908J49247_10107460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300003393|JGI25909J50240_1034358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1100Open in IMG/M
3300004448|Ga0065861_1010500All Organisms → cellular organisms → Bacteria16198Open in IMG/M
3300006484|Ga0070744_10004302All Organisms → Viruses → Predicted Viral4281Open in IMG/M
3300006484|Ga0070744_10042843All Organisms → Viruses → Predicted Viral1331Open in IMG/M
3300006805|Ga0075464_10006591All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5564Open in IMG/M
3300007559|Ga0102828_1182541All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300007861|Ga0105736_1140285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300007973|Ga0105746_1242427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage620Open in IMG/M
3300007974|Ga0105747_1189120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. 102676Open in IMG/M
3300008108|Ga0114341_10016635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5348Open in IMG/M
3300008261|Ga0114336_1016336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4454Open in IMG/M
3300008266|Ga0114363_1000617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage26227Open in IMG/M
3300008266|Ga0114363_1103696Not Available1018Open in IMG/M
3300008267|Ga0114364_1089406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage987Open in IMG/M
3300008267|Ga0114364_1111942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage828Open in IMG/M
3300008267|Ga0114364_1118993Not Available789Open in IMG/M
3300008448|Ga0114876_1004226All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.9410Open in IMG/M
3300008448|Ga0114876_1129135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage956Open in IMG/M
3300008450|Ga0114880_1053795All Organisms → Viruses → Predicted Viral1690Open in IMG/M
3300009009|Ga0105105_11043892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium510Open in IMG/M
3300009026|Ga0102829_1012946All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2318Open in IMG/M
3300009152|Ga0114980_10019778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4219Open in IMG/M
3300009169|Ga0105097_10000748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15125Open in IMG/M
3300009181|Ga0114969_10280138All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage991Open in IMG/M
3300009183|Ga0114974_10032247All Organisms → Viruses → Predicted Viral3612Open in IMG/M
3300009183|Ga0114974_10605695All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300009194|Ga0114983_1135941All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. 102529Open in IMG/M
3300010885|Ga0133913_10133304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6650Open in IMG/M
3300011009|Ga0129318_10258662Not Available578Open in IMG/M
3300011010|Ga0139557_1016075All Organisms → Viruses → Predicted Viral1408Open in IMG/M
3300011268|Ga0151620_1001020Not Available10800Open in IMG/M
3300011334|Ga0153697_1086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage30669Open in IMG/M
3300011334|Ga0153697_1095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage29647Open in IMG/M
3300011334|Ga0153697_1135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage26026Open in IMG/M
3300011335|Ga0153698_1180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage30608Open in IMG/M
3300011337|Ga0153702_1179All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage23575Open in IMG/M
3300011339|Ga0153700_10330All Organisms → cellular organisms → Bacteria24871Open in IMG/M
3300011339|Ga0153700_11054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12604Open in IMG/M
3300012012|Ga0153799_1003628All Organisms → Viruses → Predicted Viral3981Open in IMG/M
3300012013|Ga0153805_1033198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage876Open in IMG/M
3300012017|Ga0153801_1019520All Organisms → Viruses → Predicted Viral1207Open in IMG/M
3300012345|Ga0157139_1000031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5359Open in IMG/M
3300012345|Ga0157139_1011648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300012665|Ga0157210_1004642All Organisms → Viruses → Predicted Viral2899Open in IMG/M
3300012666|Ga0157498_1010852All Organisms → Viruses → Predicted Viral1454Open in IMG/M
3300012666|Ga0157498_1011989All Organisms → Viruses → Predicted Viral1377Open in IMG/M
3300012666|Ga0157498_1057198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300012666|Ga0157498_1060788All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300012687|Ga0157543_1131631All Organisms → Viruses → Predicted Viral1117Open in IMG/M
(restricted) 3300013132|Ga0172372_10060444All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3531Open in IMG/M
3300013372|Ga0177922_11010034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300014811|Ga0119960_1000364All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. 1021363Open in IMG/M
3300017707|Ga0181363_1001111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6643Open in IMG/M
3300017736|Ga0181365_1039880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1181Open in IMG/M
3300017747|Ga0181352_1008349All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → Candidatus Saccharimonas → Candidatus Saccharimonas aalborgensis3401Open in IMG/M
3300017747|Ga0181352_1028948All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → Candidatus Saccharimonas → Candidatus Saccharimonas aalborgensis1679Open in IMG/M
3300017777|Ga0181357_1252386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300017777|Ga0181357_1283197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300017784|Ga0181348_1120841All Organisms → Viruses → Predicted Viral1006Open in IMG/M
3300017784|Ga0181348_1204416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage706Open in IMG/M
3300020160|Ga0211733_11221061Not Available989Open in IMG/M
3300020205|Ga0211731_10182464Not Available12237Open in IMG/M
3300020205|Ga0211731_10277232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9281Open in IMG/M
3300020205|Ga0211731_10710390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. 1021410Open in IMG/M
3300020513|Ga0208090_1052525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300020532|Ga0208601_1034563All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300021328|Ga0210298_1253690All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. 102630Open in IMG/M
3300021961|Ga0222714_10425894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage696Open in IMG/M
3300021962|Ga0222713_10200206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1337Open in IMG/M
3300021962|Ga0222713_10570153Not Available665Open in IMG/M
3300021962|Ga0222713_10575779Not Available661Open in IMG/M
3300021963|Ga0222712_10001447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage29265Open in IMG/M
3300021963|Ga0222712_10142472All Organisms → Viruses → Predicted Viral1627Open in IMG/M
3300021963|Ga0222712_10181724All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1392Open in IMG/M
3300021963|Ga0222712_10635595All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300022179|Ga0181353_1154209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300024346|Ga0244775_10049147All Organisms → Viruses → Predicted Viral3678Open in IMG/M
3300024348|Ga0244776_10041573All Organisms → Viruses → Predicted Viral3641Open in IMG/M
3300025091|Ga0209616_1005647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1494Open in IMG/M
3300025896|Ga0208916_10016426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2904Open in IMG/M
3300027721|Ga0209492_1000931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9038Open in IMG/M
3300027754|Ga0209596_1158291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1001Open in IMG/M
3300027759|Ga0209296_1036669All Organisms → Viruses → Predicted Viral2656Open in IMG/M
3300027763|Ga0209088_10416690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300027764|Ga0209134_10144552All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300027769|Ga0209770_10208939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage768Open in IMG/M
3300027785|Ga0209246_10035711All Organisms → Viruses → Predicted Viral1898Open in IMG/M
3300027785|Ga0209246_10055001Not Available1536Open in IMG/M
3300027785|Ga0209246_10337326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300027804|Ga0209358_10405529Not Available642Open in IMG/M
3300027899|Ga0209668_10148065All Organisms → Viruses → Predicted Viral1421Open in IMG/M
3300027973|Ga0209298_10013961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4171Open in IMG/M
3300028025|Ga0247723_1009267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3954Open in IMG/M
3300031707|Ga0315291_10018247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8409Open in IMG/M
3300031746|Ga0315293_10239725All Organisms → Viruses → Predicted Viral1476Open in IMG/M
3300031758|Ga0315907_10108643Not Available2374Open in IMG/M
3300031758|Ga0315907_11306092Not Available501Open in IMG/M
3300031784|Ga0315899_10071387All Organisms → Viruses → Predicted Viral3599Open in IMG/M
3300031784|Ga0315899_11564161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300031857|Ga0315909_10001636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage30151Open in IMG/M
3300031857|Ga0315909_10005156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15124Open in IMG/M
3300031857|Ga0315909_10152726Not Available1898Open in IMG/M
3300031857|Ga0315909_10948447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300031885|Ga0315285_10099696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2536Open in IMG/M
3300031951|Ga0315904_10059574All Organisms → cellular organisms → Bacteria4206Open in IMG/M
3300031951|Ga0315904_11068029Not Available633Open in IMG/M
3300031952|Ga0315294_10123887All Organisms → Viruses → Predicted Viral2651Open in IMG/M
3300031952|Ga0315294_10237050All Organisms → Viruses → Predicted Viral1789Open in IMG/M
3300032050|Ga0315906_11342021Not Available507Open in IMG/M
3300032053|Ga0315284_10745207All Organisms → Viruses → Predicted Viral1143Open in IMG/M
3300032092|Ga0315905_10002522All Organisms → cellular organisms → Bacteria19241Open in IMG/M
3300032092|Ga0315905_10148142All Organisms → Viruses → Predicted Viral2341Open in IMG/M
3300032092|Ga0315905_10253173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1708Open in IMG/M
3300032156|Ga0315295_11748411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300033993|Ga0334994_0581058Not Available506Open in IMG/M
3300034021|Ga0335004_0293538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage965Open in IMG/M
3300034064|Ga0335001_0699101All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300034093|Ga0335012_0000949Not Available18979Open in IMG/M
3300034104|Ga0335031_0008439Not Available7614Open in IMG/M
3300034104|Ga0335031_0058759All Organisms → Viruses → Predicted Viral2761Open in IMG/M
3300034110|Ga0335055_0418232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300034116|Ga0335068_0501931Not Available561Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake13.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater10.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater7.75%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.98%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water6.20%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton5.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.43%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.43%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice3.10%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.10%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.33%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.33%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.33%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.33%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.33%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake1.55%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine1.55%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.55%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.78%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.78%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.78%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.78%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.78%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300002470Freshwater microbial communities from San Paulo Zoo lake, Brazil - FEB 2013EnvironmentalOpen in IMG/M
3300002476Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300011334Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - DaesungEnvironmentalOpen in IMG/M
3300011335Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - GumanEnvironmentalOpen in IMG/M
3300011337Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - IlsanEnvironmentalOpen in IMG/M
3300011339Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - HannamEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012345Freshwater microbial communities from Burnt River, Ontario, Canada - S22EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300012687Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES032 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020532Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021328Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R877 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025091Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
FwDRAFT_1020540363300000882Freshwater And MarineMIITKYRMITENGYIETLNEQEAIEWGNYETVTEEVSDENTQTQIS*
FwDRAFT_1025471523300000882Freshwater And MarineMTIIKYRMFTENGYIETLNKQEAHLWQGTFEIVTEEIPEEA*
metazooDRAFT_136995123300002470LakeMLLTKYRMIIENGYIETLNEQEAIEWGNYEVVTEEIIENKEI*
metazooDRAFT_1091172723300002476LakeMKYRMITKNGYIETLDEQEAIAYGNYTIVEEEIIEEEVINTINF*
B570J40625_10006071643300002835FreshwaterMIIIKYRMFTENGYIETLDKKEAAKWGNYEMITEEVPDDNG*
JGI25908J49247_1004961723300003277Freshwater LakeMTLTKYRMITDNGYIETLNEQEAIEWGNYEVVTEEVPDEETNG*
JGI25908J49247_1010746023300003277Freshwater LakeMIITXYRMITENGYIETLDKKEAVKYGNYEVVTEEVPDDNG*
JGI25909J50240_103435823300003393Freshwater LakeMIITKYRMITENGYIETLDKKEAVKYGNYEVVTEEVPDDNG*
Ga0065861_101050023300004448MarineMILTKYRMITENGYIETLDEQEAIIFGDYIVVQEEIPDENL*
Ga0070744_1000430243300006484EstuarineMIITKYRMITENGYIETLNRQEAHLWQGTIEIVTEEIPDEEPE*
Ga0070744_1004284313300006484EstuarineMTITKYRMITENGYIETLNEQEAIEWGNYTTVTEEVPDNA*
Ga0075464_1000659183300006805AqueousMIITKYRMLTDSGYIETLNEQEAIEWGNYTTVTEEVPDEVTNG*
Ga0102828_118254123300007559EstuarineMTITKYRMITENGYIETLDKKEAVKWGNYEVVTEEVPDDNA*
Ga0105736_114028523300007861Estuary WaterNNTSHMIITKYRMITEQGYIETLDKKEAVKYGNYEVITEEVPDDNA*
Ga0105746_124242733300007973Estuary WaterMIITKYRMITENGYIETLDKKEAAKWGNYEIITEEVPDDNG*
Ga0105747_118912023300007974Estuary WaterMTITKYRMITDTGYIETLNEQEAIEWGNYEVITEEIPDEV*
Ga0114341_1001663523300008108Freshwater, PlanktonMILTKYRMIVGEGYIETLDEQQAIEYGNYIVVNEEFPDGMLTDEQ*
Ga0114336_101633633300008261Freshwater, PlanktonMTIIKYRMFTENGYIETLDKKEAAKWGNYEMITEEVPDDNG*
Ga0114363_1000617113300008266Freshwater, PlanktonMILTKYRMITDNGYIETLDMAEAEAYGNYIIVTEEVADGE*
Ga0114363_110369623300008266Freshwater, PlanktonMILIKYRMVHPNGYIETLDEQEAIAYGNYIVVEEEVIEETI*
Ga0114364_108940623300008267Freshwater, PlanktonMILTKYRMLLPNGYIETLDIVEAEAFGNYITVTEEIPDEII*
Ga0114364_111194223300008267Freshwater, PlanktonMILTKYRMFFENGYIETLDEQEAISYGNYIVVEEEVIEETI*
Ga0114364_111899323300008267Freshwater, PlanktonMILTKYRMINESGYIETLNEQEAIEWGNYIVVEEEIIEDIT*
Ga0114876_100422683300008448Freshwater LakeMILTKYRMLLPNGYIETLDIAEAETFGNYITITEEVPDPV*
Ga0114876_112913513300008448Freshwater LakeLNNSTMTIIKYRMFTENGYIETLDKKEAAKWGNYEMITEEVPDDNG*
Ga0114880_105379523300008450Freshwater LakeMILTKYRMITENGYIETLDMAEAEAYGNYIIVTEEVADGE*
Ga0105105_1104389223300009009Freshwater SedimentMIITKYRMLTKNGCIETLDEQEAINHGNYIVVEEEVSEEKIVIIDSE*
Ga0102829_101294623300009026EstuarineMTIKKYRMITDNGYIETLSEQEAVEWGNYTTVIEEIAEEA*
Ga0114980_1001977823300009152Freshwater LakeMILTKYRMITENGYIETLNKQEATEWGNYTTVTEEIPEEA*
Ga0105097_10000748313300009169Freshwater SedimentMIITKYRMLFENGYIETLNEQEAIEWGNYETITEEVPDEETNG*
Ga0114969_1028013823300009181Freshwater LakeMTIIKYRMFTENGYIETLNEQEAIEWGNYEVVTEEIPEEEPA*
Ga0114974_1003224733300009183Freshwater LakeMIITKYRMITENGYIETLNKQEAIEWGNYEVVTEEVPDDNA*
Ga0114974_1060569523300009183Freshwater LakeMIITKYRMITENGYIETLDKQEAVEWGKYETITEEVPSDNG*
Ga0114983_113594123300009194Deep SubsurfaceMILTKYRMITENGYIETLNEQEAIEWGNYTTVTEEVPEEE*
Ga0133913_1013330473300010885Freshwater LakeMKLTKYRMITETGYIETLSEQEAIEYGNYEIITEEVPDENG*
Ga0129318_1025866223300011009Freshwater To Marine Saline GradientMTIIKYRMFTENGYIETLDKKEAVKWGNYEMITEEIPEEA*
Ga0139557_101607523300011010FreshwaterMIITKYRMITDNGYIETLNKQEATEWGNYEVVTEEVPDDNA*
Ga0151620_100102093300011268FreshwaterMTITKYRMITKNGYIETLDKQEAIEWGNYEIVTEEVPDEEKAND*
Ga0153697_1086473300011334FreshwaterMTITKYRMITENGYIETLDKQEAVEWGNYTTVTEEVPDDNG*
Ga0153697_1095383300011334FreshwaterMIITKYRMITDSGYIETLNEKEAIEWRKYEVVTEEVPEEE*
Ga0153697_1135173300011334FreshwaterMITENGYIETLNEQEAIEWGNYTIVTEEVTDQVTDEVING*
Ga0153698_118043300011335FreshwaterMTLTKYRMITENGYIETLNEQEAIEWGKYTTVTEEVPDDNG*
Ga0153702_117923300011337FreshwaterMTITKYRMITENGYIETLNEQEAIEWGNYATVTEEVPDENG*
Ga0153700_10330533300011339FreshwaterMILTKYRMIVGQGYIETLDEQEAIEYGNYIVVTEEFPDGMLTDEQ*
Ga0153700_1105473300011339FreshwaterMIITKYRMITDSGYIETLNEAEAIEWGNYTTVTEEVPDEATNG*
Ga0153799_100362843300012012FreshwaterMIITKYRMITENGYIETLDKKEAVKYGNYELVTEEIEEPA*
Ga0153805_103319823300012013Surface IceMIITKYRMITENGYIETLDKKEAVKYGNYEMITEEIEEPA*
Ga0153801_101952033300012017FreshwaterMIITKYRMITENGYIETLNEQEAIEWGNYKTITEEVPDDNG*
Ga0157139_100003123300012345FreshwaterMIITKYRMITENGYIETLNEQEAIEWGNYTTVTEEVPDDNA*
Ga0157139_101164823300012345FreshwaterMIITKYRMITENGYIETLSEQEAIEWGNYETVTEEIPEA*
Ga0157210_100464233300012665FreshwaterMTITKYRMITENGYIETLDKQEAVEWGNYTTVTEEVPD
Ga0157498_101085223300012666Freshwater, Surface IceMTLTKYRMITDSGYIETLNEQEAIEWGNYTTVTEEVPDEETNA*
Ga0157498_101198923300012666Freshwater, Surface IceMIITKYRMITENGYIETLDKQEAVEWGNYGVVTEEIPEEA*
Ga0157498_105719823300012666Freshwater, Surface IceMIITKYRMITDNGYIETLNEQEAIEWGNYVVVTEEIPEEA*
Ga0157498_106078823300012666Freshwater, Surface IceMIIIKYRMITENGYIETLNEQEAIEWGNYEVVTEEVPNNG*
Ga0157543_113163123300012687FreshwaterMILTKYRMITDNGYIETLNKQEATEWGNYEVVTEEVPDDNA*
(restricted) Ga0172372_1006044433300013132FreshwaterMILIKYRMLYPNGYIETLNLEEAQTYGNYITVTEEVPDEIPDEIV*
Ga0177922_1101003423300013372FreshwaterMTIIKYRMFTENGYIETLDKKEAVKYGNYEMITEEIEEPA*
Ga0119960_100036423300014811AquaticMTLTKYRMITDNGYIETLNEQEAIEWGNYEVVTEEIATEE*
Ga0181363_100111143300017707Freshwater LakeMTLTKYRMITDSGYIETLNEQEAIEWGNYTTVTEEVPDDNA
Ga0181365_103988023300017736Freshwater LakeMTLTKYRMITDNGYIETLNEQEAIEWGNYTTVTEEVPDEETNG
Ga0181352_100834943300017747Freshwater LakeMILIKYRMLTEDGCIETLNEQEAIEWGNYIVVEEEVNEKTINQTI
Ga0181352_102894843300017747Freshwater LakeMILIKYRMLTEDGCIETLNEQEAIEWGNYIVVEEEVTEKTINQTI
Ga0181357_125238623300017777Freshwater LakeMIITKYRMITDNGYIETLDKKEAVKYGNYEVVTEEIEEPA
Ga0181357_128319723300017777Freshwater LakeMIITKYRMITENGYIETLNEAEAVKWGKYEVVTEEVPDEATNG
Ga0181348_112084123300017784Freshwater LakeMIITKYRMITENGYIETLDKKEAAKWGNYEMITEEVLDDNG
Ga0181348_120441623300017784Freshwater LakeMMTLTKYRMITDNGYIETLNEQEAIEWGNYEVVTEEVPDEETNG
Ga0211733_1122106123300020160FreshwaterMILTKYRMLFENGYIETLNEAEAIEWGNYTTVTEEVLDEETNG
Ga0211731_10182464143300020205FreshwaterMILTKYRMIYENGYAETLDETEAIAYGNYIIVEEEFHETY
Ga0211731_1027723283300020205FreshwaterMTLTKYRMITENGYIETLNEQEAIEWGNYTTVTEEVPDEVTNG
Ga0211731_1071039013300020205FreshwaterMIITKYRMITENGYIETLNEQEAIEWGKYEVITEEIPEEE
Ga0208090_105252513300020513FreshwaterMIIIKYRMFTENGYIETLDKKEAAKWGNYEMITEEVPDDNG
Ga0208601_103456323300020532FreshwaterMIITKYRMFTENGYIETLNEQEAIEWGNYEVVTEEVPDEEN
Ga0210298_125369023300021328EstuarineMILTKFRMITENGYIETLNEQEAVEWGNYTTVTEEVPDEANNG
Ga0222714_1042589423300021961Estuarine WaterMTITKYRMITENGYIETLNEQEAIEWGNYEIVTEEVPDEETNA
Ga0222713_1020020623300021962Estuarine WaterMTITKYRMITENGYIETLDKKEAAKWGNYEVVTEEVPDDNG
Ga0222713_1057015313300021962Estuarine WaterMIIIKYRMFTENGYIETLDKKEATKWGNYEMITEEIPEEA
Ga0222713_1057577923300021962Estuarine WaterNNFKIMIITKYRMITDSGYIETLDKQEAIEWGKYEVVTEEIPDEEPA
Ga0222712_10001447413300021963Estuarine WaterMITDSGYIETLDKQEAIEWGKYEVVTEEIPDEEPA
Ga0222712_1014247223300021963Estuarine WaterMIITKYRMITESGYIETLDKKEAVKHGKYEVVTEEIEEPA
Ga0222712_1018172423300021963Estuarine WaterMIITKYRMITESGYIETLDKKEAIKYGNYELITEEVPEEETNG
Ga0222712_1063559513300021963Estuarine WaterMIITKYRMITENGYIETINEKEAVKYGNYEVVTEEVPDDNA
Ga0181353_115420923300022179Freshwater LakeMIIIKYRMFTENGYVETLDKKEAAKWGNYEMITEEI
Ga0244775_1004914723300024346EstuarineMITENGYIETLNRQEAHLWQGTIEIVTEEIPDEEPE
Ga0244776_1004157333300024348EstuarineMTITKYRMITENGYIETLDKKEAVKWGNYEVVTEEVPDDNA
Ga0209616_100564723300025091FreshwaterMIITKYRMITENGYIETLNEQEAIEWGNYTTVTEEVPDEETNG
Ga0208916_1001642623300025896AqueousMIITKYRMLTDSGYIETLNEQEAIEWGNYTTVTEEVPDEVTNG
Ga0209492_1000931123300027721Freshwater SedimentMIITKYRMLFENGYIETLNEQEAIEWGNYETITEEVPDEETNG
Ga0209596_115829123300027754Freshwater LakeMTIIKYRMFTENGYIETLNEQEAIEWGNYEVVTEEIPEEEPA
Ga0209296_103666923300027759Freshwater LakeMIITKYRMITENGYIETLNKQEAIEWGNYEVVTEEVPDDNA
Ga0209088_1041669023300027763Freshwater LakeMKLTKYRMITETGYIETLSEQEAIEYGNYEIITEEVPDENG
Ga0209134_1014455223300027764Freshwater LakeMIITKYRMITENGYIETLDKKEAVKYGNYEVVTEEIEEPA
Ga0209770_1020893923300027769Freshwater LakeMIIIKYRMFTENGYVETLDKKEAAKWGNYEMITEEIPEEA
Ga0209246_1003571113300027785Freshwater LakeMIITKYRMITENGYIETLDKKEAVKYGNYEVVTEEVPDDNG
Ga0209246_1005500123300027785Freshwater LakeMIITKYRMITENGYIETLDKQEAIEWGNYIVVQEEINESNQ
Ga0209246_1033732623300027785Freshwater LakeMTLTKYRMITDNGYIETLNEQEAIEWGNYEVVTEEVPDEETNG
Ga0209358_1040552933300027804Freshwater LakeKIYNTKMILIKYRMLTEDGCIETLNEQEAIEWGNYIVVEEEVTEKTINQTI
Ga0209668_1014806523300027899Freshwater Lake SedimentMIITKYRMITENGYIETLNEQEAIEWGNYTTVTEEVPEEE
Ga0209298_1001396153300027973Freshwater LakeMILTKYRMITENGYIETLNKQEATEWGNYTTVTEEIPEEA
Ga0247723_100926743300028025Deep Subsurface SedimentMILTKYRMITENGYIETLNEQEAIEWGNYTTVTEEVPEEE
Ga0315291_1001824743300031707SedimentMIITKYRMITEQGYIETLDKKEAVKYGNYEVVTEEIEEPA
Ga0315293_1023972513300031746SedimentMTIIKYRMFTENGYIETLDKKEAAKWGNYELITEEVPDDNG
Ga0315907_1010864323300031758FreshwaterMILIKYRMVHPNGYIETLDEQEAIAYGNYIVVEEEVIEETI
Ga0315907_1130609223300031758FreshwaterMIVGEGYIETLDEQQAIEYGNYIVVNEEFPDGMLTDEQ
Ga0315899_1007138723300031784FreshwaterMTIIKYRMFTENGYIETLDKKEAAKWGNYEMITEEVPDDNG
Ga0315899_1156416123300031784FreshwaterMIIIKYRMFTENGYIETLDKKEAAKWGNYEMITEEIPEEA
Ga0315909_1000163693300031857FreshwaterMILTKYRMITDNGYIETLDMAEAEAYGNYIIVTEEVADGE
Ga0315909_1000515693300031857FreshwaterMILTKYRMITENGYIETLDMAEAEAYGNYIIVTEEVADGE
Ga0315909_1015272623300031857FreshwaterMILTKYRMINESGYIETLNEQEAIEWGNYIVVEEEIIEDIT
Ga0315909_1094844713300031857FreshwaterMTIIKYRMFTENGYIETLDKKEAAKWGNYEMITEEIPEEA
Ga0315285_1009969623300031885SedimentMIITKYRMITEQGYIETLDKKEAVKYGNYEVVTEEIEEPE
Ga0315904_1005957443300031951FreshwaterMTITKYRMITENGYIETLDEQEAIIFGDYITVIEEIPDENL
Ga0315904_1106802923300031951FreshwaterMILIKYRMVHPNGYIETLDEQEAIAYGNYIIVEEEVIEETI
Ga0315294_1012388723300031952SedimentMIITKYRMITEQGYIETLDKKEAVKYGNYEVITEEVPDEATNG
Ga0315294_1023705033300031952SedimentMIITKYRMITDNGYIETLDKQEAHLWQGTFEIVTEEIPEEA
Ga0315906_1134202123300032050FreshwaterMILTKYRMIVGEGYIETLDEQQAIEYGNYIVVNEEFPDGMLTDEQ
Ga0315284_1074520723300032053SedimentMTITKYRMITDNGYIETLNEQEAIEWGNYEVVTEEIPDEA
Ga0315905_10002522253300032092FreshwaterMILTKYRMLLPNGYIETLDIVEAENFGNYVIVTEEIEDTI
Ga0315905_1014814243300032092FreshwaterMIITKYRMLYENGYIETLDEQEAIEYGNYIVVTEEFPDLEVETNEQV
Ga0315905_1025317323300032092FreshwaterMLYENGYIETSNEQEAIEYGNYIVLTEEIPDEPIDETT
Ga0315295_1174841123300032156SedimentMIITKYRMITEQGYIETLDKKEAVKYGNYEVITEEVPD
Ga0334994_0581058_270_3923300033993FreshwaterMLMQNGCVETLDEQEAVAHGNYIVVEEEVSEEKIVIIDSE
Ga0335004_0293538_709_8343300034021FreshwaterMILTKYRMLLPNGYIETLDITEAEAFGNYTTVTEEIPDEII
Ga0335001_0699101_293_4243300034064FreshwaterMILIKYRMLIENGCIETLNEQEAIEWGNYIVVEEEVTEKTIEL
Ga0335012_0000949_13766_139123300034093FreshwaterMILTKYRMITDNGYIETLDIQEAEAYGNYIIVTEEVDDSLPIQQADEF
Ga0335031_0008439_6198_63353300034104FreshwaterMILIKYRMLTEDGCIETLNEQEAIEWGNYIVVEEEVTEKIINQTI
Ga0335031_0058759_921_10313300034104FreshwaterMLTDNGYIETLNEAEAIEWGKYEIVTEEVPEEETNG
Ga0335055_0418232_329_4543300034110FreshwaterMIITKYRMITENGYIETLNEQEAIEWGNYEVVTEEVPDEEN
Ga0335068_0501931_293_4153300034116FreshwaterMIITKYKMITENGYIETLDKKEAVKYGNYEVVTEEIEETE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.