| Basic Information | |
|---|---|
| Family ID | F063674 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TQEAAEIAGVGQAAFKSRLHQARLRVRAAIGDEALVTSGG |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.78 % |
| % of genes near scaffold ends (potentially truncated) | 96.90 % |
| % of genes from short scaffolds (< 2000 bps) | 94.57 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.194 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.760 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.961 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 7.75 |
| PF06736 | TMEM175 | 6.20 |
| PF00498 | FHA | 3.10 |
| PF00106 | adh_short | 2.33 |
| PF00440 | TetR_N | 2.33 |
| PF08327 | AHSA1 | 2.33 |
| PF01641 | SelR | 1.55 |
| PF02922 | CBM_48 | 1.55 |
| PF04229 | GrpB | 1.55 |
| PF03352 | Adenine_glyco | 1.55 |
| PF01726 | LexA_DNA_bind | 1.55 |
| PF12697 | Abhydrolase_6 | 1.55 |
| PF01408 | GFO_IDH_MocA | 0.78 |
| PF01625 | PMSR | 0.78 |
| PF12840 | HTH_20 | 0.78 |
| PF09594 | GT87 | 0.78 |
| PF00487 | FA_desaturase | 0.78 |
| PF07883 | Cupin_2 | 0.78 |
| PF08386 | Abhydrolase_4 | 0.78 |
| PF08734 | GYD | 0.78 |
| PF13193 | AMP-binding_C | 0.78 |
| PF03625 | DUF302 | 0.78 |
| PF13490 | zf-HC2 | 0.78 |
| PF00561 | Abhydrolase_1 | 0.78 |
| PF00067 | p450 | 0.78 |
| PF03992 | ABM | 0.78 |
| PF00378 | ECH_1 | 0.78 |
| PF05015 | HigB-like_toxin | 0.78 |
| PF13602 | ADH_zinc_N_2 | 0.78 |
| PF00578 | AhpC-TSA | 0.78 |
| PF08281 | Sigma70_r4_2 | 0.78 |
| PF00583 | Acetyltransf_1 | 0.78 |
| PF00581 | Rhodanese | 0.78 |
| PF00023 | Ank | 0.78 |
| PF00196 | GerE | 0.78 |
| PF13561 | adh_short_C2 | 0.78 |
| PF04248 | NTP_transf_9 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 6.20 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.55 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 1.55 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 1.55 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.78 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.78 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.78 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.78 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.78 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.78 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.19 % |
| Unclassified | root | N/A | 24.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101884051 | Not Available | 500 | Open in IMG/M |
| 3300004080|Ga0062385_10788551 | Not Available | 621 | Open in IMG/M |
| 3300004479|Ga0062595_100923698 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005610|Ga0070763_10031901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2415 | Open in IMG/M |
| 3300005616|Ga0068852_100517039 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005764|Ga0066903_107606257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora | 558 | Open in IMG/M |
| 3300005764|Ga0066903_107970359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
| 3300005921|Ga0070766_10232788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora → unclassified Catellatospora → Catellatospora sp. TT07R-123 | 1163 | Open in IMG/M |
| 3300006028|Ga0070717_10635622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 969 | Open in IMG/M |
| 3300006575|Ga0074053_11541233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300006854|Ga0075425_100405553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1571 | Open in IMG/M |
| 3300006893|Ga0073928_11151687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300009137|Ga0066709_101296376 | Not Available | 1068 | Open in IMG/M |
| 3300009174|Ga0105241_12001020 | Not Available | 570 | Open in IMG/M |
| 3300009553|Ga0105249_11785480 | Not Available | 688 | Open in IMG/M |
| 3300010043|Ga0126380_10132786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1561 | Open in IMG/M |
| 3300010043|Ga0126380_10141413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1525 | Open in IMG/M |
| 3300010043|Ga0126380_10595357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 869 | Open in IMG/M |
| 3300010047|Ga0126382_10847959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 784 | Open in IMG/M |
| 3300010048|Ga0126373_11139022 | Not Available | 846 | Open in IMG/M |
| 3300010361|Ga0126378_12238158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
| 3300010361|Ga0126378_12673824 | Not Available | 570 | Open in IMG/M |
| 3300010366|Ga0126379_13859918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia stercoris | 502 | Open in IMG/M |
| 3300010376|Ga0126381_101170148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1111 | Open in IMG/M |
| 3300010396|Ga0134126_11164328 | Not Available | 858 | Open in IMG/M |
| 3300010864|Ga0126357_1153896 | Not Available | 647 | Open in IMG/M |
| 3300012200|Ga0137382_10738370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 706 | Open in IMG/M |
| 3300012200|Ga0137382_11238934 | Not Available | 529 | Open in IMG/M |
| 3300012208|Ga0137376_11380073 | Not Available | 595 | Open in IMG/M |
| 3300012349|Ga0137387_10874490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300012351|Ga0137386_10348290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Quadrisphaera → unclassified Quadrisphaera → Quadrisphaera sp. INWT6 | 1066 | Open in IMG/M |
| 3300012948|Ga0126375_11975209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300012957|Ga0164303_11400748 | Not Available | 523 | Open in IMG/M |
| 3300012977|Ga0134087_10658239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
| 3300013296|Ga0157374_11869089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2571 | 626 | Open in IMG/M |
| 3300014654|Ga0181525_10134151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea maritima | 1360 | Open in IMG/M |
| 3300014745|Ga0157377_10351265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 989 | Open in IMG/M |
| 3300016319|Ga0182033_10734033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
| 3300016357|Ga0182032_10787956 | Not Available | 803 | Open in IMG/M |
| 3300016371|Ga0182034_11302963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 634 | Open in IMG/M |
| 3300016387|Ga0182040_11696724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300016404|Ga0182037_10286220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1319 | Open in IMG/M |
| 3300016404|Ga0182037_10413373 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300016422|Ga0182039_10274485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1385 | Open in IMG/M |
| 3300016422|Ga0182039_11222896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 679 | Open in IMG/M |
| 3300017928|Ga0187806_1126149 | Not Available | 832 | Open in IMG/M |
| 3300018060|Ga0187765_10877363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 605 | Open in IMG/M |
| 3300020582|Ga0210395_10207714 | Not Available | 1469 | Open in IMG/M |
| 3300021088|Ga0210404_10912754 | Not Available | 502 | Open in IMG/M |
| 3300021171|Ga0210405_11192257 | Not Available | 564 | Open in IMG/M |
| 3300021377|Ga0213874_10376892 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021402|Ga0210385_10175716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1546 | Open in IMG/M |
| 3300021403|Ga0210397_10816980 | Not Available | 720 | Open in IMG/M |
| 3300021432|Ga0210384_10122036 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
| 3300021474|Ga0210390_10382578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1190 | Open in IMG/M |
| 3300021479|Ga0210410_10942645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
| 3300021560|Ga0126371_10732961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
| 3300025905|Ga0207685_10137647 | Not Available | 1091 | Open in IMG/M |
| 3300025910|Ga0207684_10454786 | Not Available | 1099 | Open in IMG/M |
| 3300025916|Ga0207663_10105644 | Not Available | 1901 | Open in IMG/M |
| 3300025939|Ga0207665_11286171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300025986|Ga0207658_12126521 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 510 | Open in IMG/M |
| 3300026095|Ga0207676_12463064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300027787|Ga0209074_10126308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300027795|Ga0209139_10058226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1356 | Open in IMG/M |
| 3300027874|Ga0209465_10690151 | Not Available | 501 | Open in IMG/M |
| 3300028715|Ga0307313_10173219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 668 | Open in IMG/M |
| 3300028781|Ga0302223_10064987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1222 | Open in IMG/M |
| 3300028807|Ga0307305_10018144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3148 | Open in IMG/M |
| 3300030007|Ga0311338_10440729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica | 1385 | Open in IMG/M |
| 3300030007|Ga0311338_11036770 | Not Available | 793 | Open in IMG/M |
| 3300030053|Ga0302177_10103180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium → Cryptosporangium arvum | 1649 | Open in IMG/M |
| 3300030618|Ga0311354_10224225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 1992 | Open in IMG/M |
| 3300030706|Ga0310039_10235054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 711 | Open in IMG/M |
| 3300031231|Ga0170824_111087877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4484_190.3 | 595 | Open in IMG/M |
| 3300031233|Ga0302307_10215299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
| 3300031234|Ga0302325_10741636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1402 | Open in IMG/M |
| 3300031564|Ga0318573_10368677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 771 | Open in IMG/M |
| 3300031564|Ga0318573_10780711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
| 3300031679|Ga0318561_10108986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1462 | Open in IMG/M |
| 3300031679|Ga0318561_10413177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 742 | Open in IMG/M |
| 3300031708|Ga0310686_113899582 | Not Available | 1026 | Open in IMG/M |
| 3300031708|Ga0310686_119164918 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031719|Ga0306917_10668177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 817 | Open in IMG/M |
| 3300031744|Ga0306918_11370563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia stercoris | 543 | Open in IMG/M |
| 3300031748|Ga0318492_10255082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 906 | Open in IMG/M |
| 3300031764|Ga0318535_10016223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2783 | Open in IMG/M |
| 3300031764|Ga0318535_10113883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1191 | Open in IMG/M |
| 3300031765|Ga0318554_10171357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
| 3300031765|Ga0318554_10261155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 986 | Open in IMG/M |
| 3300031765|Ga0318554_10365455 | Not Available | 820 | Open in IMG/M |
| 3300031769|Ga0318526_10297596 | Not Available | 660 | Open in IMG/M |
| 3300031770|Ga0318521_10801481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 574 | Open in IMG/M |
| 3300031778|Ga0318498_10336136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 675 | Open in IMG/M |
| 3300031779|Ga0318566_10453645 | Not Available | 629 | Open in IMG/M |
| 3300031795|Ga0318557_10259513 | Not Available | 796 | Open in IMG/M |
| 3300031799|Ga0318565_10048725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1961 | Open in IMG/M |
| 3300031799|Ga0318565_10206978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 954 | Open in IMG/M |
| 3300031823|Ga0307478_10223152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1523 | Open in IMG/M |
| 3300031835|Ga0318517_10429114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 597 | Open in IMG/M |
| 3300031859|Ga0318527_10522649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis → unclassified Asticcacaulis → Asticcacaulis sp. AC402 | 506 | Open in IMG/M |
| 3300031860|Ga0318495_10104443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1275 | Open in IMG/M |
| 3300031890|Ga0306925_10428492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1415 | Open in IMG/M |
| 3300031893|Ga0318536_10140523 | Not Available | 1225 | Open in IMG/M |
| 3300031893|Ga0318536_10595214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300031896|Ga0318551_10127681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium | 1375 | Open in IMG/M |
| 3300031897|Ga0318520_10161773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 1304 | Open in IMG/M |
| 3300031897|Ga0318520_10374404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
| 3300031912|Ga0306921_11252274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 823 | Open in IMG/M |
| 3300031941|Ga0310912_10632564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 832 | Open in IMG/M |
| 3300031945|Ga0310913_10577257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 798 | Open in IMG/M |
| 3300031954|Ga0306926_10738662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1191 | Open in IMG/M |
| 3300032001|Ga0306922_10972426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 878 | Open in IMG/M |
| 3300032039|Ga0318559_10130664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1132 | Open in IMG/M |
| 3300032039|Ga0318559_10204895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 907 | Open in IMG/M |
| 3300032041|Ga0318549_10278492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 753 | Open in IMG/M |
| 3300032043|Ga0318556_10546474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 605 | Open in IMG/M |
| 3300032044|Ga0318558_10579659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
| 3300032064|Ga0318510_10076569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1236 | Open in IMG/M |
| 3300032065|Ga0318513_10531990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300032067|Ga0318524_10014550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3408 | Open in IMG/M |
| 3300032180|Ga0307471_102729860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300032180|Ga0307471_103646047 | Not Available | 545 | Open in IMG/M |
| 3300032261|Ga0306920_103628947 | Not Available | 568 | Open in IMG/M |
| 3300032770|Ga0335085_10593790 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300032828|Ga0335080_10308283 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300032892|Ga0335081_10264245 | Not Available | 2310 | Open in IMG/M |
| 3300032895|Ga0335074_10819783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 864 | Open in IMG/M |
| 3300032896|Ga0335075_10062391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5110 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.53% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.78% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1018840511 | 3300002245 | Forest Soil | AAEIAGVSQAAFKSRLHQARLQVRAAIGDDALATAGG* |
| Ga0062385_107885511 | 3300004080 | Bog Forest Soil | AAKISGVGEAAFKSRLHHARFKLRASLGDAALTGAAGLR* |
| Ga0062595_1009236981 | 3300004479 | Soil | EDAAEIAGLGQAAFKSRLHKARLRMREAIGDDALLASGG* |
| Ga0070763_100319011 | 3300005610 | Soil | VEGLSTQQAAEIVGVGGAAFKSRLHQARLRVRAAIGDGALIDAGR* |
| Ga0068852_1005170391 | 3300005616 | Corn Rhizosphere | REAAEITGVSEAAFKSRLHQARLKVRAAVGDAALLGIT* |
| Ga0066903_1076062571 | 3300005764 | Tropical Forest Soil | EIAGVSQAAFKSRLHQARLRVRAAIGDETLVTTGG* |
| Ga0066903_1079703592 | 3300005764 | Tropical Forest Soil | AAEIAGVSQAAFKSRLHQARLRVRAAIGDEALVTAGG* |
| Ga0070766_102327881 | 3300005921 | Soil | IAGVGQAAFKSRLHQARLRVRAAIGDQVLATAGG* |
| Ga0070717_106356221 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TQEAAEIAGVGQAAFKSRLHQARLRVRAVIGDEVLAASGG* |
| Ga0074053_115412331 | 3300006575 | Soil | LSTQEAAEIAGVSQAAFKSRLHQARLRVRAAIGDEALVTAGG* |
| Ga0075425_1004055531 | 3300006854 | Populus Rhizosphere | EAAEITGVSQAAFKSRLHQARLKVRAAVGDAALLGAG* |
| Ga0073928_111516871 | 3300006893 | Iron-Sulfur Acid Spring | AEIVGVGEAAFKSRLHQARLRVRAAIGDEALIDAGR* |
| Ga0066709_1012963761 | 3300009137 | Grasslands Soil | AEIAGVGQAAFKSRLHQARLRVRAAIGDDALVTAGG* |
| Ga0105241_120010201 | 3300009174 | Corn Rhizosphere | EIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG* |
| Ga0105249_117854801 | 3300009553 | Switchgrass Rhizosphere | EAAEIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG* |
| Ga0126380_101327861 | 3300010043 | Tropical Forest Soil | AAEIAGVSKAAFKSRLHQARLSVRAAVGDEALVTSSG* |
| Ga0126380_101414134 | 3300010043 | Tropical Forest Soil | EAAEIAGVGQAAFKSRLHQARLRVRAAIGDDALLASGG* |
| Ga0126380_105953571 | 3300010043 | Tropical Forest Soil | IVGISQAAFKTRLHQARLRARAAIGDQALVTAGG* |
| Ga0126382_108479592 | 3300010047 | Tropical Forest Soil | IAGVSKAAFKSRLHQARLSVRAAVGDEALVTSSG* |
| Ga0126373_111390223 | 3300010048 | Tropical Forest Soil | LSTQEAAGIAGISHAAFKSRLHQARLRVRVVIGDQALVTAGG* |
| Ga0126378_122381582 | 3300010361 | Tropical Forest Soil | AAEIAGISQAAFKTRLHQARLRVRAAIGDEALVSAGA* |
| Ga0126378_126738241 | 3300010361 | Tropical Forest Soil | LSTQEAAGIAGISHAAFKSRLHQARLRVRVVIGAQALVTSGR* |
| Ga0126379_138599181 | 3300010366 | Tropical Forest Soil | TQEAAEIAGVGEAAFKSRLHQARLRVRAAIGDEALASTEGEV* |
| Ga0126381_1011701481 | 3300010376 | Tropical Forest Soil | AEIAGVSQAAFKSRLHQARLRVRAAIGDEALVTAGG* |
| Ga0134126_111643281 | 3300010396 | Terrestrial Soil | AAEIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG* |
| Ga0126357_11538962 | 3300010864 | Boreal Forest Soil | STRESAAIAGVGEAAFKSRLHEARMKVRSALSDAALIAPAG* |
| Ga0137382_107383702 | 3300012200 | Vadose Zone Soil | EGLSTREAAEIAGVGEAAFKSRLHQARLRVRALVGDAALVASAG* |
| Ga0137382_112389341 | 3300012200 | Vadose Zone Soil | IAGVGEAAFKSRLHQARLRVRALVGDSALVASAG* |
| Ga0137376_113800731 | 3300012208 | Vadose Zone Soil | EITGVGQAAFKSRLHQARLRVRAAIGDEALVSSGG* |
| Ga0137387_108744902 | 3300012349 | Vadose Zone Soil | PQQAAEIAGVSQSAFKSRLHQARLRVRATIGDEMLEHAG* |
| Ga0137386_103482904 | 3300012351 | Vadose Zone Soil | EGLPTRDAAEIAGIGQAAFKSRLHEARRKLRAALGDKALLSGA* |
| Ga0126375_119752091 | 3300012948 | Tropical Forest Soil | QEAAEIAGVSQAAFKSRLHQARLRVRAAIGDETLVTTGG* |
| Ga0164303_114007481 | 3300012957 | Soil | STQEAAEIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG* |
| Ga0134087_106582391 | 3300012977 | Grasslands Soil | IAGVGEAAFKSRLHQARLRVRALVGDAALVANAGRAPDPSA* |
| Ga0157374_118690891 | 3300013296 | Miscanthus Rhizosphere | TQEAAEIVGIGQAALKSRLHQARLRVRAAIGDETLTAIGG* |
| Ga0181525_101341513 | 3300014654 | Bog | AAVPLTDGGLSTQQAAEIAGVGEAAFKSRLHQARLRVRAAIGDEALIDAGR* |
| Ga0157377_103512651 | 3300014745 | Miscanthus Rhizosphere | TREAAEITGVSEAAFKSRLHQARLKVRAAVGDAALLGIT* |
| Ga0182033_107340331 | 3300016319 | Soil | QEAAEIADVGQAAFKSRLHQARLRVRAAIGDEALVTSGG |
| Ga0182032_107879561 | 3300016357 | Soil | EIAGVGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0182034_113029631 | 3300016371 | Soil | QEAAEIAGIGQAAFKSRLHQARLRVRAAVGDQALVSSGG |
| Ga0182040_116967242 | 3300016387 | Soil | QQAAEIADVGQAAFKSRLHQARHRLRVAIGDEALTGSGW |
| Ga0182037_102862203 | 3300016404 | Soil | STQEAAEIAGIGQAAFKSRLHQARLRVRAVIGDEALVASGG |
| Ga0182037_104133731 | 3300016404 | Soil | EAAEAAGIGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0182039_102744851 | 3300016422 | Soil | STQEAAEIAGVSQAAFKSRLHQARLRVRAAIGDEVLVTAGG |
| Ga0182039_112228961 | 3300016422 | Soil | DVEGFSTQEAAEIAGIGQAAFKSRLHQARLRVRAAVTDQALVSSGG |
| Ga0187806_11261492 | 3300017928 | Freshwater Sediment | DVEGLSTQEAAEIAGVGQAAFKSRLHQARLRVRAAIGDQALVTAR |
| Ga0187765_108773632 | 3300018060 | Tropical Peatland | LSTQEAAEIAGISQAAFKSRLHQARLRVRAAIGDQALVTAGG |
| Ga0210395_102077141 | 3300020582 | Soil | EGLSTQEAAEIAGVGQAAFKSRLHQARLRVRAAIGDEALAGSGG |
| Ga0210404_109127541 | 3300021088 | Soil | TQEAAEIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG |
| Ga0210405_111922571 | 3300021171 | Soil | STQEAAEIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG |
| Ga0213874_103768921 | 3300021377 | Plant Roots | EAAKIAGLGEAAFKSRLHEARLKVRAALGDDTLIAEERPARG |
| Ga0210385_101757161 | 3300021402 | Soil | TQQAAEIAGVSQAAFKSRLHQARLQVRAAIGDDALTAVGG |
| Ga0210397_108169802 | 3300021403 | Soil | DVEGLSTQEAAEIAGVGQAAFKSRLHQARLRVRAAIGDEALAGSGG |
| Ga0210384_101220364 | 3300021432 | Soil | LSTQEAAEIAGISQAAFKSRLHQARLHVRVAIGDQALVTAGG |
| Ga0210390_103825781 | 3300021474 | Soil | QAAEIAGVSQAAFKSRLHQARLQVRAAIGDDALTSVGG |
| Ga0210410_109426451 | 3300021479 | Soil | REAAEIVGVGEAAFKSRLHQARLRVRALVGDSALVASTS |
| Ga0126371_107329611 | 3300021560 | Tropical Forest Soil | EAAEIAGVGQAAFKSRLHQARLRVRAAIGDQALVASPG |
| Ga0207685_101376471 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | EIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG |
| Ga0207684_104547861 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EITGVGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0207663_101056441 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GLSTQEAAEIAGVSQAALKSRLHQARLRVRAAIGDEALVTSGG |
| Ga0207665_112861712 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LSTQEAAEIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG |
| Ga0207658_121265212 | 3300025986 | Switchgrass Rhizosphere | REAAEITGVSQAAFKSRLHQARLKVRAAVGDAALLGAG |
| Ga0207676_124630642 | 3300026095 | Switchgrass Rhizosphere | STREAAEITGVSQAAFKSRLHQARLKVRAAVGDAALLGAG |
| Ga0209074_101263082 | 3300027787 | Agricultural Soil | AAEITGVSQAAFKSRLHQARLKVRAAVGDAALLGAG |
| Ga0209139_100582263 | 3300027795 | Bog Forest Soil | STREAAEIAGVGEAAFKSRLHQARLKVRASLGDAALVAAG |
| Ga0209465_106901511 | 3300027874 | Tropical Forest Soil | AEIAGVSQAAFKSRLHQARLRVRAAVGDEALVTAGG |
| Ga0307313_101732191 | 3300028715 | Soil | QEAAEIVGIGQAAFKSRLHQARLRVRAAIGDETLTAIGG |
| Ga0302223_100649871 | 3300028781 | Palsa | VEGLSTQQAAEIAGVGEAAFKSRLHQARLRVRAAIGDEALIDAGR |
| Ga0307305_100181441 | 3300028807 | Soil | QEAAEIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG |
| Ga0311338_104407291 | 3300030007 | Palsa | STREAAKIAGVGEAAFKSRLHQARLKVRAALGDAALIAAPI |
| Ga0311338_110367702 | 3300030007 | Palsa | KREAANISGVGEAAFKSRLHHARFKVRASLGDAALAGARERR |
| Ga0302177_101031803 | 3300030053 | Palsa | FSTQEAAEIAGVTPAAFKSRLHQARLQVRAAIGDDALIAVGG |
| Ga0311354_102242251 | 3300030618 | Palsa | TQEAAEIAGVTPAAFKSRLHQARLQVRAAIGDDALIAVGG |
| Ga0310039_102350541 | 3300030706 | Peatlands Soil | GLSTQQAAEIVGVGEAAFKSRLHQARLRVRAAIGDEALIDAGR |
| Ga0170824_1110878772 | 3300031231 | Forest Soil | STQEAAEITGVGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0302307_102152991 | 3300031233 | Palsa | TQEAAEIAGVSQAAFKSRLHQARLRVRAAVGDQTLVTTGG |
| Ga0302325_107416361 | 3300031234 | Palsa | EGLSTREAAKIAGVGEAAFKSRLHQARLKVRAALGDAALIAAAI |
| Ga0318573_103686772 | 3300031564 | Soil | AAEIAGISQAAFKSRLHQARLRVRVAIGDQALVTAGG |
| Ga0318573_107807111 | 3300031564 | Soil | EAAEIAGVSQAAFKSRLHQARLRVRAAIGDEALVTAGG |
| Ga0318561_101089863 | 3300031679 | Soil | LSTQEAAEVTALGQAAFKSRLHQARLRVRAAIGDQALVTAR |
| Ga0318561_104131771 | 3300031679 | Soil | EAAEIAGIGQAAFKSRLHQARLRVRAAIGDQALVPTG |
| Ga0310686_1138995821 | 3300031708 | Soil | QAAEIAGVGQAAFKSRLHQARLRVRAAIGDQALIDAGR |
| Ga0310686_1191649181 | 3300031708 | Soil | TQEAAEIAGVSQAAFKSRLHQARLRVRAAIGDQTLVSTGG |
| Ga0306917_106681771 | 3300031719 | Soil | EAAEIAGIRQAAFKSRLHQARLRVRAAIGDQTLASTGG |
| Ga0306918_113705632 | 3300031744 | Soil | LSTQDAAEIAGVGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0318492_102550822 | 3300031748 | Soil | TQEAAEVAGIGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0318535_100162231 | 3300031764 | Soil | GESLDVTQEAAEIAGISQAAFKSRLHQARLRVRVAIGDQALVTVGG |
| Ga0318535_101138831 | 3300031764 | Soil | TQEAAEIAGVSQAAFKSRLHQARLRVRAAVGDEALVSSGG |
| Ga0318554_101713571 | 3300031765 | Soil | TQEAAEIAGLSQAAFKSRLHQARLRVRAAIGDEALVTAGG |
| Ga0318554_102611551 | 3300031765 | Soil | VEGLSTQEAAEIAGIGQAAFKSRLHQARLRVRAAIGDQALVPTG |
| Ga0318554_103654551 | 3300031765 | Soil | TQQAAEIAGISQAAFKSRLHQARQRARAAIGDQALVTAGA |
| Ga0318526_102975962 | 3300031769 | Soil | STQEAAEVTALGQAAFKSRLHQARLRVRAAIGDQALVTAR |
| Ga0318521_108014811 | 3300031770 | Soil | STQEAAEIAGIGQAAFKSRLHQARLRVRAAIGDQVLASTGG |
| Ga0318498_103361361 | 3300031778 | Soil | EIAGIRQAAFKSRLHQARLRVRAAIGDQTLASTGG |
| Ga0318566_104536451 | 3300031779 | Soil | VEGLSTQEAAEIAGIGQAAFKSRLHQARLRVRAAIGDQALVASPG |
| Ga0318557_102595131 | 3300031795 | Soil | EIAGISQAAFKTRLHQARLRVRVAIGDQALVTAGG |
| Ga0318565_100487251 | 3300031799 | Soil | VEGLSTQEAAEIAGIGQAAFKSRLHQARLRVRAVIGDEALVASGG |
| Ga0318565_102069783 | 3300031799 | Soil | AAEIAGIGQAAFKSRLHQARLRVRAAIGDQALVPTG |
| Ga0307478_102231521 | 3300031823 | Hardwood Forest Soil | EAAEIAGVSQAAFKSRLHQARLRVRAAIGDQALVSTGG |
| Ga0318517_104291141 | 3300031835 | Soil | STQEAAEIAGIGQAAFKSRLHQARLRVRAAVGDQALVSSGG |
| Ga0318527_105226492 | 3300031859 | Soil | LSTQEAAEIAGISQAAFKSRLHQARLRARVAIGDQALVTAGG |
| Ga0318495_101044431 | 3300031860 | Soil | LSTQEAAEIAGVGQAAFKSRLHQARLRVRAAIGDEALVTSGG |
| Ga0306925_104284921 | 3300031890 | Soil | EAAEVAGIGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0318536_101405231 | 3300031893 | Soil | AAEIAGVGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0318536_105952141 | 3300031893 | Soil | TQEAAEIAGVGQAAFKSRLHQARLRVRAAIGDEALVTSGG |
| Ga0318551_101276813 | 3300031896 | Soil | STQEAAEIAGVSQAAFKSRLHQARLRVRATIGDEALVTTGG |
| Ga0318520_101617732 | 3300031897 | Soil | VEGLSTQQAAEIAGVGLAAFKSRLHQARLRVRAAIGDQALVDASR |
| Ga0318520_103744041 | 3300031897 | Soil | LSTQEAAQIAGVGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0306921_112522742 | 3300031912 | Soil | STQEAAEIAGVSQAAFKSRLHQARLRVRAAIGDETLVTTGG |
| Ga0310912_106325642 | 3300031941 | Soil | EGLSTQDAAEIAGVGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0310913_105772572 | 3300031945 | Soil | AEIAGVGQAAFKSRLHQARLRVRAAIGDEALVTSGG |
| Ga0306926_107386621 | 3300031954 | Soil | LSTQEAAEIAGIRQAAFKSRLHQARLRVRAAIGDQTLASTGG |
| Ga0306922_109724262 | 3300032001 | Soil | AEIAGVSQAAFKSRLHQARLRVRAAIGDETLVTTGG |
| Ga0318559_101306641 | 3300032039 | Soil | TQEAAEIAGVSQAAFKSRLHQARLRVRAAVGDEALVTAGG |
| Ga0318559_102048952 | 3300032039 | Soil | VEGLSTQEAAEAAGIGEAAFKSRLHQARLRVRAAIGDEALASTGG |
| Ga0318549_102784922 | 3300032041 | Soil | GFSTQEAAEIAGVSQAAFKSRLHQARLRVRAAVGDEALVTAGG |
| Ga0318556_105464741 | 3300032043 | Soil | TQEAAEIAGIRQAAFKSRLHQARLRVRAAIGDQTLASTGG |
| Ga0318558_105796592 | 3300032044 | Soil | TQEAAEIAGVSQAAFKSRLHQARLRVRTAIGDEALVTAGG |
| Ga0318510_100765691 | 3300032064 | Soil | GLSTQEAAEIAGVGQAAFKSRLHQARLRVRAAIGDEALVTSGG |
| Ga0318513_105319901 | 3300032065 | Soil | AAEIAGVSQAAFKSRLHQARLRVRTAIGDEALVTAGG |
| Ga0318524_100145501 | 3300032067 | Soil | VEGLSTQEAAEIAGVGQAAFKSRLHQARLRVRAAIGDEALVTSGG |
| Ga0307471_1027298602 | 3300032180 | Hardwood Forest Soil | TREAAEIAGVGEAAFKSRLHQARLTVRALVGDAALAASAG |
| Ga0307471_1036460471 | 3300032180 | Hardwood Forest Soil | VEGLSTQEAAEVAGVGQAAFKSRLHQARLRVRAAVGDEALVSSGG |
| Ga0306920_1036289472 | 3300032261 | Soil | EAAEVTALGQAAFKSRLHQARLRVRAAIGDQALVTAR |
| Ga0335085_105937902 | 3300032770 | Soil | MPRACGDVEGLSTHEPAEITGIGQAAFKSRRHQARLRVRAVIGDQALGTASG |
| Ga0335080_103082831 | 3300032828 | Soil | GLSTQEAAEIAGVSQAAFKSRLHQARLRARAAIGDETLVTSGG |
| Ga0335081_102642451 | 3300032892 | Soil | QEAAEIVGISQAAFKSRLHQARLRVRAAIGDAALITAGA |
| Ga0335074_108197831 | 3300032895 | Soil | AEIAGVSPAAFKSRLHQARLQVRAAIGDDALVPAGR |
| Ga0335075_100623915 | 3300032896 | Soil | VKAGIGHAAFKSRLQQARLLIRAAAGDQALINVGQLY |
| ⦗Top⦘ |