| Basic Information | |
|---|---|
| Family ID | F063486 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MITLSWIIERLLVKPTEGSLTDVVITADWRCNGTQDQY |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 6.98 % |
| % of genes near scaffold ends (potentially truncated) | 98.45 % |
| % of genes from short scaffolds (< 2000 bps) | 95.35 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (90.698 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.256 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.039 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (51.938 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.85% Coil/Unstructured: 65.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 37.98 |
| PF13385 | Laminin_G_3 | 0.78 |
| PF00574 | CLP_protease | 0.78 |
| PF04545 | Sigma70_r4 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.55 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.55 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.67 % |
| Unclassified | root | N/A | 2.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004795|Ga0007756_10132496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1291 | Open in IMG/M |
| 3300005525|Ga0068877_10294592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300005662|Ga0078894_11595105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300005805|Ga0079957_1141412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
| 3300005805|Ga0079957_1344772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300006802|Ga0070749_10313839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300006802|Ga0070749_10729000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 529 | Open in IMG/M |
| 3300007234|Ga0075460_10062139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1386 | Open in IMG/M |
| 3300007363|Ga0075458_10074645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1060 | Open in IMG/M |
| 3300007363|Ga0075458_10148665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300007972|Ga0105745_1316589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300007973|Ga0105746_1038411 | All Organisms → Viruses → Predicted Viral | 1479 | Open in IMG/M |
| 3300007973|Ga0105746_1154160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300007973|Ga0105746_1213611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300008107|Ga0114340_1208945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300008117|Ga0114351_1142563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1331 | Open in IMG/M |
| 3300008117|Ga0114351_1237972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300008117|Ga0114351_1442037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300008259|Ga0114841_1122526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
| 3300008262|Ga0114337_1116772 | Not Available | 1213 | Open in IMG/M |
| 3300008264|Ga0114353_1077255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3306 | Open in IMG/M |
| 3300008266|Ga0114363_1201352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300008266|Ga0114363_1213848 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300008267|Ga0114364_1134250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300008339|Ga0114878_1102877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| 3300008339|Ga0114878_1184999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300008448|Ga0114876_1131166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300008450|Ga0114880_1202210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300009085|Ga0105103_10643499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300010160|Ga0114967_10600269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300010354|Ga0129333_11434068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300010370|Ga0129336_10206335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1117 | Open in IMG/M |
| 3300011114|Ga0151515_10716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13893 | Open in IMG/M |
| 3300011268|Ga0151620_1143251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300012666|Ga0157498_1020592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10315704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10559519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300013295|Ga0170791_13911914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300013295|Ga0170791_14952353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300013372|Ga0177922_10935148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300013372|Ga0177922_10961264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300017707|Ga0181363_1044933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300017736|Ga0181365_1042950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1135 | Open in IMG/M |
| 3300017736|Ga0181365_1081947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300017736|Ga0181365_1104509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300017747|Ga0181352_1071560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
| 3300017747|Ga0181352_1095459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300017747|Ga0181352_1112332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300017747|Ga0181352_1112822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300017747|Ga0181352_1171312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300017754|Ga0181344_1152965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300017766|Ga0181343_1090498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300017766|Ga0181343_1178228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300017777|Ga0181357_1084610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
| 3300017785|Ga0181355_1265593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300017785|Ga0181355_1269787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300017785|Ga0181355_1314880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300019784|Ga0181359_1241689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300021141|Ga0214163_1130394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300021424|Ga0194117_10529297 | Not Available | 522 | Open in IMG/M |
| 3300021961|Ga0222714_10515604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300021962|Ga0222713_10034663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4019 | Open in IMG/M |
| 3300021962|Ga0222713_10136541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1710 | Open in IMG/M |
| 3300021962|Ga0222713_10615958 | Not Available | 631 | Open in IMG/M |
| 3300022179|Ga0181353_1119337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300022179|Ga0181353_1134835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300022407|Ga0181351_1069592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1428 | Open in IMG/M |
| 3300022752|Ga0214917_10293474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300024348|Ga0244776_10729260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300024557|Ga0255283_1074125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300024560|Ga0256306_1126494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300024571|Ga0256302_1158308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300025585|Ga0208546_1062264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300025889|Ga0208644_1379545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 528 | Open in IMG/M |
| 3300027138|Ga0255064_1018697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
| 3300027156|Ga0255078_1039464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
| 3300027538|Ga0255085_1047691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300027581|Ga0209651_1037710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
| 3300027697|Ga0209033_1213352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300027754|Ga0209596_1130236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1144 | Open in IMG/M |
| 3300027759|Ga0209296_1245402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300027764|Ga0209134_10084782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| 3300027770|Ga0209086_10141973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1172 | Open in IMG/M |
| 3300027798|Ga0209353_10274414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300027806|Ga0209985_10007575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7945 | Open in IMG/M |
| 3300027806|Ga0209985_10171828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
| 3300027808|Ga0209354_10040251 | All Organisms → Viruses → Predicted Viral | 1877 | Open in IMG/M |
| 3300031758|Ga0315907_10600192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 854 | Open in IMG/M |
| 3300031772|Ga0315288_11019084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300031787|Ga0315900_10124821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2441 | Open in IMG/M |
| 3300031857|Ga0315909_10088095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2716 | Open in IMG/M |
| 3300031857|Ga0315909_10146817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1950 | Open in IMG/M |
| 3300031885|Ga0315285_10887642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300031951|Ga0315904_10204824 | All Organisms → Viruses → Predicted Viral | 1933 | Open in IMG/M |
| 3300031951|Ga0315904_10538414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
| 3300031952|Ga0315294_10343642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1418 | Open in IMG/M |
| 3300031963|Ga0315901_10463629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300031963|Ga0315901_10484913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300031963|Ga0315901_10777777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300031963|Ga0315901_10857334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300031997|Ga0315278_10562227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1170 | Open in IMG/M |
| 3300031997|Ga0315278_10876162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300031999|Ga0315274_11042750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300032046|Ga0315289_10397982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
| 3300032053|Ga0315284_11124137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| 3300032093|Ga0315902_10687801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300032093|Ga0315902_10722745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300032093|Ga0315902_10964314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300032116|Ga0315903_10216114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1688 | Open in IMG/M |
| 3300032116|Ga0315903_11101348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300032177|Ga0315276_10602348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1181 | Open in IMG/M |
| 3300033521|Ga0316616_102710958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300033980|Ga0334981_0251973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300034019|Ga0334998_0440051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300034020|Ga0335002_0463683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300034061|Ga0334987_0225075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1298 | Open in IMG/M |
| 3300034063|Ga0335000_0631128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300034095|Ga0335022_0532802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300034101|Ga0335027_0323837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
| 3300034104|Ga0335031_0576072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300034106|Ga0335036_0447290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300034109|Ga0335051_0304768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300034118|Ga0335053_0193027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1344 | Open in IMG/M |
| 3300034119|Ga0335054_0312133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300034119|Ga0335054_0323120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300034120|Ga0335056_0195877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
| 3300034200|Ga0335065_0630261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300034200|Ga0335065_0773457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300034279|Ga0335052_0279872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.63% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.98% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.43% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.65% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.10% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.10% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.88% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.55% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.78% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.78% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0007756_101324962 | 3300004795 | Freshwater Lake | MTILWLIERLLTKPVEGSNTDVVITADWRCNGTETTGSGD |
| Ga0068877_102945921 | 3300005525 | Freshwater Lake | MPTLSWIIERLLCKPTEGTLTDVVITADWRCNGTETTGTGDTE |
| Ga0078894_115951052 | 3300005662 | Freshwater Lake | MNTISIVWIIERLLVKPTEGTLTDVVITADWRCNGSQD |
| Ga0079957_11414122 | 3300005805 | Lake | MTTISIVWIIERLLVKPTEGDKIDVVITADWRCNGSQD |
| Ga0079957_13447722 | 3300005805 | Lake | MTILWLIERLLVKPTEGTLTDVVITADWRCNGTETTVSGDAEQT |
| Ga0070749_103138391 | 3300006802 | Aqueous | MNISWIIERLLVKPTEGSLTDVVITADWRCNGTETTG |
| Ga0070749_107290001 | 3300006802 | Aqueous | MTTISIVWIIERLLVKPTEGDKTDVVITADWRCNGTETTGSGDT |
| Ga0075460_100621393 | 3300007234 | Aqueous | MPTLSWIIERLLCKPVEGTLTDVVITADWRCNGTETTGSGDTE |
| Ga0075458_100746451 | 3300007363 | Aqueous | MITISWIIERLLVKPTEGSLTDVVITADWRCNGTETTGTGD |
| Ga0075458_101486651 | 3300007363 | Aqueous | MITLSWLIERLLVKPVECSLTDVVITADWRCNGSQ |
| Ga0105745_13165891 | 3300007972 | Estuary Water | MTTISIVWIIERLLVKPTEGDKTDVVITADWRCNGTETTGTGDDEKT |
| Ga0105746_10384111 | 3300007973 | Estuary Water | MNISISWIIERLLVKPTEGSLTDVVITADWRCNGSQDNYS |
| Ga0105746_11541602 | 3300007973 | Estuary Water | MIPLSWIIERLLVKPTEGSLTDVVITADWRCNGTQDQ |
| Ga0105746_12136112 | 3300007973 | Estuary Water | MTTISIVWIIERLLVKPTEGSLTDVVITADWRCNG |
| Ga0114340_12089451 | 3300008107 | Freshwater, Plankton | MTTINWIIESLLVRKVEGSNTDVVITADWRCNGSQESFSGTCYGSCSF |
| Ga0114351_11425631 | 3300008117 | Freshwater, Plankton | MITLSWIIERLLVKPTEGTLTDVVITADWRCNGSQES |
| Ga0114351_12379721 | 3300008117 | Freshwater, Plankton | MTILWLIERLLTKPVEGSYTDVVITADWRCNGTETTGT |
| Ga0114351_14420372 | 3300008117 | Freshwater, Plankton | MTILWLIERLLVKPTEGSNTDVVITADWRCNGSQESFSGTCYGS |
| Ga0114841_11225262 | 3300008259 | Freshwater, Plankton | MTILWIIERLLVKPTEGSNTDVVITADWRGNGTDQNY |
| Ga0114337_11167721 | 3300008262 | Freshwater, Plankton | MTTINWIIESLLVRKVEGSNTDVVITADWRCNGTETTGSG |
| Ga0114353_10772551 | 3300008264 | Freshwater, Plankton | MTILWLIERLLTKPVEGPNTDVVITADWRCNGSQDSYSGTCYGSC |
| Ga0114363_12013521 | 3300008266 | Freshwater, Plankton | MPTLSWIIERLLVKPTEGTLTDVVITADWRCNGTETTGSGD |
| Ga0114363_12138481 | 3300008266 | Freshwater, Plankton | MNISWIIERLLVKPTEGTLTDVVITADWRCNGTETTGSGD |
| Ga0114364_11342501 | 3300008267 | Freshwater, Plankton | MTILWIIERLLVKPTEGSLTDVVITADWRCNGTDGTYS |
| Ga0114878_11028771 | 3300008339 | Freshwater Lake | MITLSWIIERLLCKPVEGTLTDVVITADWRCNGSQ |
| Ga0114878_11849991 | 3300008339 | Freshwater Lake | MTILWLIERLLTKPVEGSYTDVVITADWRCNGTETTGTGDDAK |
| Ga0114876_11311661 | 3300008448 | Freshwater Lake | MTTISWIIERLLVKPTEGTLTDVVITADWRCNGTETTGSGDT |
| Ga0114880_12022102 | 3300008450 | Freshwater Lake | MITINWIIERLLVKPTEGDKTDVVITADWRCNGTDGA |
| Ga0105103_106434992 | 3300009085 | Freshwater Sediment | MITISWIIERLLVKPTEGDKTDVVITADWRCNGTETTGTGD |
| Ga0114967_106002691 | 3300010160 | Freshwater Lake | MTTLYWIIVRLLVKPTEGSETNVVITADWRCNGTQDQYSGTC |
| Ga0129333_114340682 | 3300010354 | Freshwater To Marine Saline Gradient | MNISWIIERLLVKPTEGDKTDVVITADWRCNGTETTGTGDDAKTY |
| Ga0129336_102063351 | 3300010370 | Freshwater To Marine Saline Gradient | MITISWIIERLLVKPTEGDKTDVVITADWRCNGTETTGTGDD |
| Ga0151515_107161 | 3300011114 | Freshwater | MTILWLIERLLVKPTEGTLTDVVITADWRCNGSQESFSGTCYGSCS |
| Ga0151620_11432512 | 3300011268 | Freshwater | MTISWIIERLLVKPTEGTLTDVVITADWRCNGTETTGSGDTEQT |
| Ga0157498_10205921 | 3300012666 | Freshwater, Surface Ice | MNISWIIERLLVKPTEGSLTDVVITADWRCNGTET |
| (restricted) Ga0172367_103157042 | 3300013126 | Freshwater | MNIYWSIQTLWVRPVEGSLTDVVVTAAWRCNGTDG |
| (restricted) Ga0172367_105595191 | 3300013126 | Freshwater | MTTLTWLIETLWVRPVEGSLTDVVVTAAWRCNGTDG |
| Ga0170791_139119142 | 3300013295 | Freshwater | MTTLYWIIERLLVKPTEGSLTDVVITADWRCNGTQDQYSGT |
| Ga0170791_149523531 | 3300013295 | Freshwater | MTILWIIERLLVKPIEGSNPDVVITADWRCNGTQDQYSGT |
| Ga0177922_109351482 | 3300013372 | Freshwater | MNISWIIERLLVKPTEGTLTDVVITADWRCNGSQDQYSG |
| Ga0177922_109612641 | 3300013372 | Freshwater | MTILWIIERLLVKPTEGSLTDVVITADWRCNGTQDQYSGT |
| Ga0181363_10449332 | 3300017707 | Freshwater Lake | MITISWIIERLLVKPTEGSLTDVVITADWRCNGSQ |
| Ga0181365_10429502 | 3300017736 | Freshwater Lake | MPTILWIIERLLVKPTEGSLTDVVITADWRCNGTQ |
| Ga0181365_10819471 | 3300017736 | Freshwater Lake | MTTINWIIQSLLVRKVEGSLTDVVITADWRCNGTQDQYR |
| Ga0181365_11045091 | 3300017736 | Freshwater Lake | MITLSWIIERLLVKPTEGTYSDVVITADWRCNGTQDQYSGT |
| Ga0181352_10715601 | 3300017747 | Freshwater Lake | MITISWIIERLLVKPTEGTLTDVVITADWRCNGLQESFSGTCY |
| Ga0181352_10954591 | 3300017747 | Freshwater Lake | MPTILWIIERLLVKPTEGTLTDVVITADWRCNGSQESFS |
| Ga0181352_11123321 | 3300017747 | Freshwater Lake | MTINWIIERLLVRKVEGAYSDVVITADWRCNGSQD |
| Ga0181352_11128222 | 3300017747 | Freshwater Lake | MTISWIIERLLVKPTEGTLTDVVITADWRCNGLQESFSGTCY |
| Ga0181352_11713121 | 3300017747 | Freshwater Lake | MTIISWIIERLLVKPTEGSLTDVVITADWRCNGTETT |
| Ga0181344_11529652 | 3300017754 | Freshwater Lake | MTTINWIIERLLCKPVEGSLTDVVITADWRCNGTQDQ |
| Ga0181343_10904981 | 3300017766 | Freshwater Lake | MTTINWIIERLLVKPTEGTLTDVVITADWRCNGSQDNYSGT |
| Ga0181343_11782282 | 3300017766 | Freshwater Lake | MNISWIIERLLVRKVEGTYSDVVITADWRCNGSQDQYSGT |
| Ga0181357_10846102 | 3300017777 | Freshwater Lake | MTTINWIIQSLLVRKVEGSLTDVVITADWRCNGTQDQYRG |
| Ga0181355_12655932 | 3300017785 | Freshwater Lake | MTTIKWIIESLLVRKVEGSLTDVVITADWRCNGTQD |
| Ga0181355_12697872 | 3300017785 | Freshwater Lake | MITLSWIIERLLVKPTEGSLTDFVITADWRCNGTQDQYSGTCY |
| Ga0181355_13148802 | 3300017785 | Freshwater Lake | MTILWLIERLLVKPIEGSNPDVVITADWRCNGTQAL |
| Ga0181359_12416891 | 3300019784 | Freshwater Lake | MTTIKWIIQSLLVRKVEGSLTDVVITADWRCNGTQDQ |
| Ga0214163_11303942 | 3300021141 | Freshwater | MITLSWIIERLLVKPTEGTLTDVVITADWRCNGSQDQYSGT |
| Ga0194117_105292971 | 3300021424 | Freshwater Lake | MPTLTWLIETLWVRPVEGSLTDVVVTAAWRCNGTDGTY |
| Ga0222714_105156042 | 3300021961 | Estuarine Water | MTILWLIERLLVKPTEGSLTDVVITADWRCNGTETTGSGDT |
| Ga0222713_100346636 | 3300021962 | Estuarine Water | MITLNWIIERLLVKPTEGDKTDVVITADWRCNGSQDS |
| Ga0222713_101365411 | 3300021962 | Estuarine Water | MTISWIIERLLVKPTEGSYTDVVITADWRCNGTETTGSG |
| Ga0222713_106159581 | 3300021962 | Estuarine Water | MPTISWIIERLLVKPTEGSLTDVVITADWRCNGSQDQ |
| Ga0181353_11193371 | 3300022179 | Freshwater Lake | MITLSWIIERLLVKPTECTLTDVVITADWRCNGAVQSPTEA |
| Ga0181353_11348352 | 3300022179 | Freshwater Lake | MINFNWIIENLLVRKTEGSLTDVVITADWRCNGSQENYSGTCYGSCSFAP |
| Ga0181351_10695921 | 3300022407 | Freshwater Lake | MTILWIIERLLVKPTEGSLTNVVITADWRCNGTQDQYSGTC |
| Ga0214917_102934742 | 3300022752 | Freshwater | MTTISWIIERLLVKPTEGSLTDVVITADWRCNGVD |
| Ga0244776_107292602 | 3300024348 | Estuarine | MITLSWIIERLLCKPVEGSNPDVVITADWRCNGTQDQ |
| Ga0255283_10741252 | 3300024557 | Freshwater | MITISWIIERLLVKPTEGTLTDVVITADWRCTGTDGKYSG |
| Ga0256306_11264942 | 3300024560 | Freshwater | MITLSWIIERLLVRPTEGSLADVVITADWRCNGTDE |
| Ga0256302_11583082 | 3300024571 | Freshwater | MITLSWIIERLLVRPTEGSLADVVITADWRCNGTDETYSGTCY |
| Ga0208546_10622641 | 3300025585 | Aqueous | MNISWIIERLLVKPTEGSLTDVVITADWRCNGSQDQYSGT |
| Ga0208644_13795451 | 3300025889 | Aqueous | MTTISIVWIIERLLVKPTEGDKTDVVITADWRCNGTETTGSGDTK |
| Ga0255064_10186972 | 3300027138 | Freshwater | MITLSWIIERLLVRPTEGSLADVVITADWRCNGSQDQY |
| Ga0255078_10394642 | 3300027156 | Freshwater | MTILWIIERLLVRPTEGSLTDVVITADWRCNGSQDQ |
| Ga0255085_10476911 | 3300027538 | Freshwater | MITLSWIIERLLVRPTEGSLADVVITADWRCNGTDETYS |
| Ga0209651_10377101 | 3300027581 | Freshwater Lake | MTIIWIIERLLVKPTEGSLTNVVITADWRCNGTQDQY |
| Ga0209033_12133521 | 3300027697 | Freshwater Lake | MTLSWIIERLLVKPTEGTLTDVVITADWRCNGSQDQY |
| Ga0209596_11302362 | 3300027754 | Freshwater Lake | MITLSWIIERLLVKPTEGSLTDVVITADWRCNGTQDQYSGT |
| Ga0209296_12454022 | 3300027759 | Freshwater Lake | MPTILWIIERLLVKPTEGSLTDVVITADWRCNGTQDQYS |
| Ga0209134_100847822 | 3300027764 | Freshwater Lake | MTILWLIERLLVRKVEGTYSDVVITADWRCNGTQDQYSGTCYGSC |
| Ga0209086_101419732 | 3300027770 | Freshwater Lake | MITLSWIIERLLVKPTEGSLTDVVITADWRCNGTQDQY |
| Ga0209353_102744141 | 3300027798 | Freshwater Lake | MTILWIIERLLVKPIEGSNPDVVITADWRCNGIDETY |
| Ga0209985_1000757514 | 3300027806 | Freshwater Lake | MITLSWIIERLLVKPTEGSLTDVVITADWRCNGTETTGT |
| Ga0209985_101718281 | 3300027806 | Freshwater Lake | MPTLSWIIERLLCKPTEGTLTDVVITADWRCNGTET |
| Ga0209354_100402511 | 3300027808 | Freshwater Lake | MITLSWIIERLLVKPTEGSETNVVITADWRCNGTQDQYS |
| Ga0315907_106001922 | 3300031758 | Freshwater | MNTISILWIIERLLVKPTEGTLTDVVVTADWRCNGTDGTYSG |
| Ga0315288_110190842 | 3300031772 | Sediment | MTILWIIERLLVKPTEGSLTDVVITADWRCNGSQDQYSGTCY |
| Ga0315900_101248211 | 3300031787 | Freshwater | MTTISWIIERLLVKPTEGDKTDVVITADWRCNGTETTGS |
| Ga0315909_100880951 | 3300031857 | Freshwater | MITLSWIIERLLVKPTEGTLTDVVITADWRCNGSQESFSGT |
| Ga0315909_101468171 | 3300031857 | Freshwater | MTILWLIERLLVKPTEGSLTDVVITADWRCNGSQDQY |
| Ga0315285_108876422 | 3300031885 | Sediment | MPTILWIIERLLVKPAEGSLTDVVITADWRCNGTQDN |
| Ga0315904_102048241 | 3300031951 | Freshwater | MTTLSWIIERLLVKPTEGDKTNVVITADWRCNGTNGTYSGTC |
| Ga0315904_105384141 | 3300031951 | Freshwater | MNISWIIERLLVKPTEGSLTDVVITADWRCNGTETTGT |
| Ga0315294_103436422 | 3300031952 | Sediment | MTILWIIERLLVKPIEGSNHDVVITADWRCNGTDETYSGTCYGS |
| Ga0315901_104636291 | 3300031963 | Freshwater | MPTLSWIIERLLCKPTEGTLTDVVITADWRCNGTETTGTGDTEQT |
| Ga0315901_104849132 | 3300031963 | Freshwater | MTILWLIERLLTKPVEGSLTDVVITADWRCNGTETTGSGDT |
| Ga0315901_107777772 | 3300031963 | Freshwater | MTTISIVWIIERLLVKPTEGSLTDVVITADWRCNGSQ |
| Ga0315901_108573341 | 3300031963 | Freshwater | MITLSWIIERLLCKPVEGTLTDVVITADWRCNGSQDNY |
| Ga0315278_105622272 | 3300031997 | Sediment | MPTILWIIERLLVKPTEVSLTDVVITADWRCNGTQDQYSGT |
| Ga0315278_108761621 | 3300031997 | Sediment | MITINWIIERLLVKPTEGSLTDVVITADWRCNGTQD |
| Ga0315274_110427502 | 3300031999 | Sediment | MTILWIIERLLVKPTEGSLTDVVITADWRCNGTQDNYSGTCY |
| Ga0315289_103979821 | 3300032046 | Sediment | MTILWIIERLLVKPAEGSLTDVVITADWHCNGTQDNYSGT |
| Ga0315284_111241371 | 3300032053 | Sediment | MTINWIIERLLVKPTEDSLTDVVITADWRCNGTQDQYSG |
| Ga0315902_106878011 | 3300032093 | Freshwater | MTTISIVWIIERLLVKPTEGSLTDVVITADWRCNGSQESFSGTCYG |
| Ga0315902_107227451 | 3300032093 | Freshwater | MNISWIIERLLVKPTEGSLTDVVITADWRCNGTETTGTG |
| Ga0315902_109643141 | 3300032093 | Freshwater | MITISWLIERLLVKPTEGTHTDVVITADWRCNGTETTGTGDDAK |
| Ga0315903_102161141 | 3300032116 | Freshwater | MTILWIIERLLVKPTEGSLTDVVITADWRCNGTETTGSG |
| Ga0315903_111013482 | 3300032116 | Freshwater | MTTISIVWIIERLLVKPTEGDKTDVVITADWRCNGSQESFS |
| Ga0315276_106023482 | 3300032177 | Sediment | MITLSWIIERLLVKPTEGTLTDVVITADWRCNGSQDQYSGTCY |
| Ga0316616_1027109582 | 3300033521 | Soil | MLTLSWIIERLLCKPVEGTLTDVVITADWRCNGTDGTYS |
| Ga0334981_0251973_693_797 | 3300033980 | Freshwater | MNISWIIERLLVKPTEGTLTDVVITADWRCNGSQD |
| Ga0334998_0440051_618_737 | 3300034019 | Freshwater | MTILWLIERLLVKPTEGSLTDVVITADWRCNGTEITGTGD |
| Ga0335002_0463683_1_105 | 3300034020 | Freshwater | MITLSWIIERLLVKPTEGDKTDVVITADWRCNGTD |
| Ga0334987_0225075_1180_1296 | 3300034061 | Freshwater | MNISINWIIERLLVKPTEGDKTDVVITADWRCNGSQDNY |
| Ga0335000_0631128_2_133 | 3300034063 | Freshwater | MNTISILWIIERLLVKPTEGTLTDVVITADWRCNGTETIGTGDD |
| Ga0335022_0532802_1_123 | 3300034095 | Freshwater | MIILWIIERLLVKPIEGSETNVVITADWRCNGTDETYSGTC |
| Ga0335027_0323837_915_1028 | 3300034101 | Freshwater | MITLSWIIERLLVRKVEGTHTDVVITADWRCNGSQDQY |
| Ga0335031_0576072_535_669 | 3300034104 | Freshwater | MNTISILWIIERLLVKPTEGTLTDVVITADWRCNGTETTGTGDDE |
| Ga0335036_0447290_704_817 | 3300034106 | Freshwater | MNISWIIERLLVRKVEGTYSDVVITADWRCNGTETIGT |
| Ga0335051_0304768_633_770 | 3300034109 | Freshwater | MITLSWIIERLLVRKVEGTLTDVVITADWRCNGTQDQYSGTCYGSC |
| Ga0335053_0193027_1211_1342 | 3300034118 | Freshwater | MITLNWIIERLLVRKVEGTYSDVVITADWRCNGTQDQYSGTCYG |
| Ga0335054_0312133_791_919 | 3300034119 | Freshwater | MITLSWIIERLLVKPTEGSLTDVVITADWRCNGSQDNYSGTCY |
| Ga0335054_0323120_23_133 | 3300034119 | Freshwater | MITLSWIIERLLVKPTEGTLTDVVVTADWRWTGTQV |
| Ga0335056_0195877_1061_1168 | 3300034120 | Freshwater | MTINWIIERLLVKPTEGTLTDVVITADWRCNGSQDQ |
| Ga0335065_0630261_1_123 | 3300034200 | Freshwater | MITLSWIIERLLVKPTEGTHTDVVITADWRCNGTQDQYSGT |
| Ga0335065_0773457_423_539 | 3300034200 | Freshwater | MITLSWIIERLLVRKVEGTYSDVVITADWRCNGIETIGT |
| Ga0335052_0279872_1_141 | 3300034279 | Freshwater | MITILWIIERLLVKPTEGTHTDVVITADWRCNGTETIGDDVKSRDCI |
| ⦗Top⦘ |