Basic Information | |
---|---|
Family ID | F063456 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 46 residues |
Representative Sequence | TVWRKFASNLVDAQPLPTGHYLQEEAPDRVYDHFVKFFTA |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.75 % |
% of genes near scaffold ends (potentially truncated) | 91.47 % |
% of genes from short scaffolds (< 2000 bps) | 95.35 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.721 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.380 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.682 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.016 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.88% β-sheet: 0.00% Coil/Unstructured: 69.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF13620 | CarboxypepD_reg | 5.43 |
PF03401 | TctC | 4.65 |
PF08448 | PAS_4 | 3.10 |
PF13458 | Peripla_BP_6 | 2.33 |
PF00106 | adh_short | 1.55 |
PF01738 | DLH | 1.55 |
PF00355 | Rieske | 1.55 |
PF00296 | Bac_luciferase | 0.78 |
PF00561 | Abhydrolase_1 | 0.78 |
PF13533 | Biotin_lipoyl_2 | 0.78 |
PF14534 | DUF4440 | 0.78 |
PF00691 | OmpA | 0.78 |
PF13508 | Acetyltransf_7 | 0.78 |
PF12681 | Glyoxalase_2 | 0.78 |
PF13649 | Methyltransf_25 | 0.78 |
PF02738 | MoCoBD_1 | 0.78 |
PF03928 | HbpS-like | 0.78 |
PF04545 | Sigma70_r4 | 0.78 |
PF09587 | PGA_cap | 0.78 |
PF06439 | 3keto-disac_hyd | 0.78 |
PF04909 | Amidohydro_2 | 0.78 |
PF08681 | DUF1778 | 0.78 |
PF05096 | Glu_cyclase_2 | 0.78 |
PF02371 | Transposase_20 | 0.78 |
PF00135 | COesterase | 0.78 |
PF00011 | HSP20 | 0.78 |
PF12796 | Ank_2 | 0.78 |
PF01636 | APH | 0.78 |
PF00903 | Glyoxalase | 0.78 |
PF09903 | DUF2130 | 0.78 |
PF00581 | Rhodanese | 0.78 |
PF04392 | ABC_sub_bind | 0.78 |
PF01555 | N6_N4_Mtase | 0.78 |
PF00756 | Esterase | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.65 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.78 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.78 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.78 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.78 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.78 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.72 % |
Unclassified | root | N/A | 16.28 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_12296337 | Not Available | 528 | Open in IMG/M |
3300003321|soilH1_10168396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1096 | Open in IMG/M |
3300004024|Ga0055436_10200813 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300004082|Ga0062384_101022566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 592 | Open in IMG/M |
3300004092|Ga0062389_102193293 | Not Available | 726 | Open in IMG/M |
3300004103|Ga0058903_1488429 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300004633|Ga0066395_10438615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
3300005332|Ga0066388_100742110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1583 | Open in IMG/M |
3300005332|Ga0066388_105305745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 654 | Open in IMG/M |
3300005332|Ga0066388_107513111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300005354|Ga0070675_100574327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1021 | Open in IMG/M |
3300005439|Ga0070711_100731587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 835 | Open in IMG/M |
3300005535|Ga0070684_102136118 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005598|Ga0066706_11479001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300005615|Ga0070702_101033840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
3300005618|Ga0068864_102706058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
3300005764|Ga0066903_101196908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1410 | Open in IMG/M |
3300005764|Ga0066903_104267320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
3300005764|Ga0066903_105810139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
3300005764|Ga0066903_107582661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
3300006034|Ga0066656_10943358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 553 | Open in IMG/M |
3300006052|Ga0075029_101118450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300006806|Ga0079220_11264764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
3300009012|Ga0066710_101811698 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300009090|Ga0099827_10497458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1047 | Open in IMG/M |
3300009143|Ga0099792_10521314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 747 | Open in IMG/M |
3300009524|Ga0116225_1347538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300009633|Ga0116129_1060546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1148 | Open in IMG/M |
3300009792|Ga0126374_10597281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
3300009826|Ga0123355_11625065 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300010043|Ga0126380_11413013 | Not Available | 612 | Open in IMG/M |
3300010043|Ga0126380_11998662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300010046|Ga0126384_10931087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
3300010046|Ga0126384_11366316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300010047|Ga0126382_12082847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300010048|Ga0126373_13158115 | Not Available | 513 | Open in IMG/M |
3300010358|Ga0126370_12082550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 556 | Open in IMG/M |
3300010359|Ga0126376_12047988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300010362|Ga0126377_12848035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium rubrum | 558 | Open in IMG/M |
3300010366|Ga0126379_10565423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1218 | Open in IMG/M |
3300010366|Ga0126379_12434759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 623 | Open in IMG/M |
3300010373|Ga0134128_12613831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
3300010379|Ga0136449_100794923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1564 | Open in IMG/M |
3300010398|Ga0126383_12617347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300010876|Ga0126361_10735520 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300011269|Ga0137392_11118916 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012081|Ga0154003_1058296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
3300012199|Ga0137383_11285216 | Not Available | 522 | Open in IMG/M |
3300012199|Ga0137383_11325948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300012202|Ga0137363_10067875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 2614 | Open in IMG/M |
3300012202|Ga0137363_11659276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300012208|Ga0137376_11158732 | Not Available | 661 | Open in IMG/M |
3300012212|Ga0150985_106177511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
3300012231|Ga0137465_1056035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1168 | Open in IMG/M |
3300012357|Ga0137384_11280545 | Not Available | 579 | Open in IMG/M |
3300012469|Ga0150984_116220459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300012924|Ga0137413_10773293 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300012929|Ga0137404_10757229 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300012944|Ga0137410_11242127 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300012944|Ga0137410_11833082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta | 536 | Open in IMG/M |
3300012971|Ga0126369_13647273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300014166|Ga0134079_10066126 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300014325|Ga0163163_12685050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300014968|Ga0157379_11416200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 17Sr1-1 | 674 | Open in IMG/M |
3300016319|Ga0182033_12080476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300016357|Ga0182032_10324934 | Not Available | 1223 | Open in IMG/M |
3300016371|Ga0182034_10144789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1776 | Open in IMG/M |
3300016371|Ga0182034_10369831 | Not Available | 1169 | Open in IMG/M |
3300016404|Ga0182037_10288894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1313 | Open in IMG/M |
3300016404|Ga0182037_11165061 | Not Available | 676 | Open in IMG/M |
3300016404|Ga0182037_11358056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300016404|Ga0182037_12086062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300017973|Ga0187780_10449606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
3300018059|Ga0184615_10620491 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300018060|Ga0187765_10940417 | Not Available | 588 | Open in IMG/M |
3300020579|Ga0210407_11077892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
3300021088|Ga0210404_10684245 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300021178|Ga0210408_10325510 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300021178|Ga0210408_10893425 | Not Available | 692 | Open in IMG/M |
3300021432|Ga0210384_11118729 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300021478|Ga0210402_10172066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1982 | Open in IMG/M |
3300021478|Ga0210402_10195944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1855 | Open in IMG/M |
3300021478|Ga0210402_10262239 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
3300021479|Ga0210410_10897043 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300022726|Ga0242654_10190346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
3300022726|Ga0242654_10418809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300025916|Ga0207663_10628659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300025921|Ga0207652_10291376 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300025926|Ga0207659_10090613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2283 | Open in IMG/M |
3300026340|Ga0257162_1025799 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300027663|Ga0208990_1089043 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300027846|Ga0209180_10131973 | Not Available | 1435 | Open in IMG/M |
3300027855|Ga0209693_10290072 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300027889|Ga0209380_10200148 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300027898|Ga0209067_10038432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2438 | Open in IMG/M |
3300028906|Ga0308309_10521757 | Not Available | 1028 | Open in IMG/M |
3300029636|Ga0222749_10084425 | Not Available | 1466 | Open in IMG/M |
3300029636|Ga0222749_10522804 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300031184|Ga0307499_10031376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1209 | Open in IMG/M |
3300031344|Ga0265316_10282721 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300031474|Ga0170818_104068425 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300031715|Ga0307476_10513503 | Not Available | 888 | Open in IMG/M |
3300031723|Ga0318493_10427274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
3300031770|Ga0318521_10548900 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300031771|Ga0318546_10712448 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300031781|Ga0318547_10769083 | Not Available | 600 | Open in IMG/M |
3300031879|Ga0306919_11314449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300031890|Ga0306925_11782782 | Not Available | 590 | Open in IMG/M |
3300031893|Ga0318536_10675619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300031910|Ga0306923_10247260 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
3300031910|Ga0306923_10558760 | Not Available | 1289 | Open in IMG/M |
3300031910|Ga0306923_11090959 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300031910|Ga0306923_11103917 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300031912|Ga0306921_10247538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2088 | Open in IMG/M |
3300031912|Ga0306921_12614156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
3300031912|Ga0306921_12654804 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300031941|Ga0310912_10298842 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300031945|Ga0310913_10299279 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300031947|Ga0310909_10174293 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
3300031947|Ga0310909_10379899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 1186 | Open in IMG/M |
3300031954|Ga0306926_10907123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
3300032001|Ga0306922_11609253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300032001|Ga0306922_12402567 | Not Available | 503 | Open in IMG/M |
3300032059|Ga0318533_10386124 | Not Available | 1022 | Open in IMG/M |
3300032060|Ga0318505_10571636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300032160|Ga0311301_10140207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4434 | Open in IMG/M |
3300032160|Ga0311301_10468664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1886 | Open in IMG/M |
3300032261|Ga0306920_102335018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
3300032261|Ga0306920_103208931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.05% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.20% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.55% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.55% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.55% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.55% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.78% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.78% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.78% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.78% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.78% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_122963371 | 3300000789 | Soil | RRFASNLVDAQPFPTGHYLQEEAPDRVYDYFVKFFTA* |
soilH1_101683961 | 3300003321 | Sugarcane Root And Bulk Soil | TVWRKYASNLVDIQPLPSGHYIQEEQPDQVYDRCIRFFTA* |
Ga0055436_102008132 | 3300004024 | Natural And Restored Wetlands | PLLVLWGTRGAPPTQEYPTVWRRFASNLIDAQPLPTGHALQVEAPTRVYDHFIKFFTA* |
Ga0062384_1010225662 | 3300004082 | Bog Forest Soil | RGAPPTQEYPTVWRKFASNLVDAQPLPTGHYLQEEAPDQVIDHLLKFFTT* |
Ga0062389_1021932931 | 3300004092 | Bog Forest Soil | QEYPTVWRRFASNLVDAQPLPTGHAPQVEAPDRVYDHFIKFFTA* |
Ga0058903_14884291 | 3300004103 | Forest Soil | PTVWRKFASNLVDAQPLPTGHYLQEEAPDRVYDYFIKFFTT* |
Ga0066395_104386152 | 3300004633 | Tropical Forest Soil | VWRKFASNLVDAQPLPTGHYLQEEAPDLVYDHFVKFFTT* |
Ga0066388_1007421103 | 3300005332 | Tropical Forest Soil | GAPPTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPGRVYDHFIKFFTA* |
Ga0066388_1053057452 | 3300005332 | Tropical Forest Soil | VWRKFASNLVDAQPLPTRHYPQEEVPDRVIEHFLKFFTA* |
Ga0066388_1075131112 | 3300005332 | Tropical Forest Soil | PTVWRKFASNLVDAQPLPTGHYLQEEAPDRVIDHFVKFFTT* |
Ga0070675_1005743272 | 3300005354 | Miscanthus Rhizosphere | GTRGQPPTQEYPTVWRKYASNLVDIQPLPSGHYIQEEQPDQVYDHCIRFFTA* |
Ga0070711_1007315871 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | QEYPTVWRKFASNLVDAQPLPTGHYLQEEAPDQVIDHCLKFFTT* |
Ga0070684_1021361182 | 3300005535 | Corn Rhizosphere | TVWRKWARNLVDIQPVPAGHYIQEELPDQVYDHCIRFFTA* |
Ga0066706_114790011 | 3300005598 | Soil | GAPPTQEFPTVWRKFASNLVDAQPLPTGHYLQEEAPDQVYDYFVKFFTA* |
Ga0070702_1010338401 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VLWGTRGQPPTQEFPTVWRKFAKNLVDAQPLPTGHYLQEEAPDQVYDYFVKFLVT* |
Ga0068864_1027060582 | 3300005618 | Switchgrass Rhizosphere | YASNLVGAYPLPTGHYLQEEAPDQCYDHFMKFFTT* |
Ga0066903_1011969081 | 3300005764 | Tropical Forest Soil | FASNLVDAQPLPTGHYLQEEAPDRVIDHFVKFFTT* |
Ga0066903_1042673201 | 3300005764 | Tropical Forest Soil | RKFASNLVDAQPLPTGHYLQEEAPDLVYDHFVKFFTT* |
Ga0066903_1058101391 | 3300005764 | Tropical Forest Soil | PLLLLWGTRGAPPTQEYPTVWRRYATNLVDAQPLPTGHALQVEAPDRVYDHFVKFFRA* |
Ga0066903_1075826612 | 3300005764 | Tropical Forest Soil | PTQEYPTVWSKFASNLVDAQPLPTGHYLMEEAPDRLIEHFFKFFTA* |
Ga0066656_109433581 | 3300006034 | Soil | GTRGQPPTQEFPTVWRKFAKNLVDAQPLPTGHYLQEEAPDKVLDYFVKFFTA* |
Ga0075029_1011184502 | 3300006052 | Watersheds | GAPPTQEFPTVWRKYASNLVDAQPLPTGHYLQEEAPDRVYDYFVKFFTT* |
Ga0079220_112647641 | 3300006806 | Agricultural Soil | TVWRKFAKNLVDAQPLPTGHYLQEEAPDQVYDYFVKFFTT* |
Ga0066710_1018116982 | 3300009012 | Grasslands Soil | MPPTQEYPTVWRKFASNLVDAQSLPTGHVLQAEAPDRVY |
Ga0099827_104974581 | 3300009090 | Vadose Zone Soil | EFPTVWRKFAKNLVDAQPLPTGHYLQEEAPDQVYDYFVKFLTT* |
Ga0099792_105213142 | 3300009143 | Vadose Zone Soil | PPTQEFPTVWRKFASNLVDAQPLPTGHYLQEEAPDRVIDYFLKFFTA* |
Ga0116225_13475382 | 3300009524 | Peatlands Soil | VWRKFASNLVDAQPLPTGHYLQEEAPDQVIDHCLKFFTT* |
Ga0116129_10605461 | 3300009633 | Peatland | TVWRKFASNLVDAQPLPTGHYLQEEAPDRVYDHFVKFFTA* |
Ga0126374_105972812 | 3300009792 | Tropical Forest Soil | GTRGAPPTQEFPTVWRKFASNLVDAQPLPTGHYLQEEAPDLVYDHFVKFFTT* |
Ga0123355_116250652 | 3300009826 | Termite Gut | KFASNLVDAQPLPTGHALQVEAPERVYDHFVKFFRA* |
Ga0126380_114130132 | 3300010043 | Tropical Forest Soil | TVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFVKFFTA* |
Ga0126380_119986621 | 3300010043 | Tropical Forest Soil | RGAPPTQEYPTVWRKFASTLVDAQPLPTGHYLQEEAPDQVIDHFVKFFTT* |
Ga0126384_109310872 | 3300010046 | Tropical Forest Soil | MPLPILWATRGAPPTQEYPTVWRKFASNLVDSQPLPPDRVIEHFFKFQYAGKALK* |
Ga0126384_113663161 | 3300010046 | Tropical Forest Soil | QEFPTVWRKFAKNLVDAQPLPTGHYLQEEAPDKVYDYFVKFFTA* |
Ga0126382_120828471 | 3300010047 | Tropical Forest Soil | PTQEFPTVWRKFAKNLVDAQPLPTGHYLQEEAPDKVYDYFVKFFTT* |
Ga0126373_131581151 | 3300010048 | Tropical Forest Soil | GRPPTQEYPNAWRQFASNLVDAQPLPTGHALQVEAPNAVYDHFVKFFAA* |
Ga0126370_120825501 | 3300010358 | Tropical Forest Soil | ESPTVWRKFASNLVDAQPLPTGHYLQEEAPDRVIDHFVKFFTT* |
Ga0126376_120479881 | 3300010359 | Tropical Forest Soil | TQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFVSFFRA* |
Ga0126377_128480352 | 3300010362 | Tropical Forest Soil | GLPPTQEFPTVWRKFASNLVDAQPLPTGHYLQEEAPDRVIDHFVKFFTA* |
Ga0126379_105654231 | 3300010366 | Tropical Forest Soil | VLWGTRGRPPTQEYPNAWRQFASNLVDAQPLPTGHALQVEAPNAVYDHFVKFFAA* |
Ga0126379_124347591 | 3300010366 | Tropical Forest Soil | GMPPTQEYPTVWRKFASNLVDAQPLPTGHALQAEAPDRVYDHFVKFFRA* |
Ga0134128_126138311 | 3300010373 | Terrestrial Soil | FASNLVDAQPLPTGHALQVEAPDRVYDHFVKFFTA* |
Ga0136449_1007949231 | 3300010379 | Peatlands Soil | TQEYPTVWRRYASNLVDAQPLPTGHAVQVEAPDGVYYHFVKFFRA* |
Ga0126383_126173471 | 3300010398 | Tropical Forest Soil | VWRKFASNLVDAQPLPTGHYLQEEAPDRVIEHLLKFFTA* |
Ga0126361_107355201 | 3300010876 | Boreal Forest Soil | RGAPPTQEFPTVWRKYASNLVDAQPLPTGHYLQEEAPDRVYDHFVKFFTT* |
Ga0137392_111189161 | 3300011269 | Vadose Zone Soil | PPSEEYPAVWRKFASNLVDAQPLPTGHYMQEEAPDQVYDHFVKFFTA* |
Ga0154003_10582961 | 3300012081 | Attine Ant Fungus Gardens | TVWRKFAKNLVDAQPLPTGHYLQEEAPDQVYDYFVKFLTA* |
Ga0137383_112852161 | 3300012199 | Vadose Zone Soil | EYPTVRRRVASNLVAAQPLPTSHALQVEAPDRVYDHFVKFFTA* |
Ga0137383_113259482 | 3300012199 | Vadose Zone Soil | YLFATRGGPPTQELPTVWRKFASNLVHAEPLPTGHHMQEDAPDGVYDQFVKFFTV* |
Ga0137363_100678751 | 3300012202 | Vadose Zone Soil | ILWGTRGAPPTQEFPTVWRKFASNLVDAQPLTTGHYLQEEAPDRVIDHFLKFFTA* |
Ga0137363_116592762 | 3300012202 | Vadose Zone Soil | MATPLLVLWGTRGAPPTQQYPTVWRKFASNLVDAQPLPTGHAVQVEAPDGVYDQFVKFFTV* |
Ga0137376_111587321 | 3300012208 | Vadose Zone Soil | ASNLVDAQPLPTGHALQVEAPDRVYDHFVKFFTA* |
Ga0150985_1061775112 | 3300012212 | Avena Fatua Rhizosphere | EYPTVWRKFASNLVDAQPLPTGHYLQEEAPDRVYDYFVKFFAA* |
Ga0137465_10560353 | 3300012231 | Soil | TPLLVLWGTRGAPPTQEFPTVWRRFASNLVDAQPLPTGHALQVEAPDGVYDHFVKFFTA* |
Ga0137384_112805451 | 3300012357 | Vadose Zone Soil | KFAKNLVDAQPLPTGHYLQEEAPDQVYNYFVKFLTA* |
Ga0150984_1162204592 | 3300012469 | Avena Fatua Rhizosphere | EFPTVWRKFATNLVDAQPLPTGHALQVEAPDRVYDYFIKFFTA* |
Ga0137413_107732932 | 3300012924 | Vadose Zone Soil | ASNLVDVQPLPTGHYLQEDAPDQCYDHFVKFFKA* |
Ga0137404_107572292 | 3300012929 | Vadose Zone Soil | KYASNLVDVQPLPTGHYLQEEAPDQCYDHFMKFFKA* |
Ga0137410_112421272 | 3300012944 | Vadose Zone Soil | VWRKFASNLADVQPLATGHYLQEEAPDQVHDHFVKFFTA* |
Ga0137410_118330821 | 3300012944 | Vadose Zone Soil | GAPPTQEFPTVWRKFASNLVDAQPLATGHYLQEEAPDRVHDHFVKFFTG* |
Ga0126369_136472732 | 3300012971 | Tropical Forest Soil | GAPPTQEYPTVWRRFASNLVDAQPLPTGHAIQVEAPDRVYDHFIKFFTA* |
Ga0134079_100661261 | 3300014166 | Grasslands Soil | PPTQEFPTVWRKFASNLVDAQPLPTGHYLQEEAPDQVYDYFVKFFTA* |
Ga0163163_126850502 | 3300014325 | Switchgrass Rhizosphere | WGTRGQPPTQEFPTVWRKFAKNLVDAQPLPTGHYLQEEAPDQVYDYFVKFLVT* |
Ga0157379_114162001 | 3300014968 | Switchgrass Rhizosphere | KCASNLVNAQPRPTCRVLHEEAPDRVSDQFIKFFMG* |
Ga0182033_120804761 | 3300016319 | Soil | APPTQEYPTVWRKFASNLVDAQPLPTGHYLQKEVPDRVIKHFLKFFTA |
Ga0182032_103249341 | 3300016357 | Soil | VLWGTRGLPPTEEYPTVWRKFASNLIDAQPLPTGHALQVEAPDRVYDHFVKFFKA |
Ga0182034_101447893 | 3300016371 | Soil | TQEYPTVWRKFASNLVDAQPLPPDRVIEHFFKFQNTRARR |
Ga0182034_103698311 | 3300016371 | Soil | PPTDEFPTVWRKFASNLVDAQPLPTGHYLQEEAPDQVYDYFVKFCTA |
Ga0182037_102888943 | 3300016404 | Soil | WRKFASNLVDAQPLPTGHYLQEEAPDQVIDHCVKFFTT |
Ga0182037_111650612 | 3300016404 | Soil | VWRKFASNLVDAQPLPTGHYLMEEAPDRVIEHLLKFFTA |
Ga0182037_113580561 | 3300016404 | Soil | KDRKIAPPLLILWGTRGAPPTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPGPVYDYFIKFFTA |
Ga0182037_120860622 | 3300016404 | Soil | PPTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFIKFFTA |
Ga0187780_104496061 | 3300017973 | Tropical Peatland | PTVWRKYASNLVDAQPLPTGHYLQEEAPDQCVDHFVKFFTT |
Ga0184615_106204912 | 3300018059 | Groundwater Sediment | WLRFASNLVAAEPLPTGHYLHEEMPNTVYDRFVDFFKA |
Ga0187765_109404172 | 3300018060 | Tropical Peatland | WRKYASNMVDAQPLPTGHYLQEEAPDRVIDYFLKFFTT |
Ga0210407_110778922 | 3300020579 | Soil | LPTVWRAFASNLVDAQPLQTGHHMQEDAPDQLYDRFVKFFTL |
Ga0210404_106842451 | 3300021088 | Soil | GAPPTQEYPTAWRRFATNLVDAQPLPTGHALQVEAPDRVYDHFVKFFTA |
Ga0210408_103255101 | 3300021178 | Soil | GTRGAPPTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVHDHFVKFFTA |
Ga0210408_108934251 | 3300021178 | Soil | TVWKKYASNLVDAQPLPTGHYLQEEAPDRVIEHLLKFLA |
Ga0210384_111187291 | 3300021432 | Soil | PPTQEFPTVWRKFASNLVDAQPLPTGHYLQEEAPDRVYDHLVKFFTA |
Ga0210402_101720661 | 3300021478 | Soil | TPLLVLWGTRGAPPTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVHDHFIKFFTA |
Ga0210402_101959443 | 3300021478 | Soil | PTVWRKFASNLVDAQPLPTGHYLQEEAPDQVIDHFIKFFTT |
Ga0210402_102622391 | 3300021478 | Soil | KFASNLVDAQPLPTGHYLQEEAPDRVYDHFVKFFTT |
Ga0210410_108970432 | 3300021479 | Soil | FASNLVDAQPLPTGHYLQEEAPDRVYDHFVKFFTA |
Ga0242654_101903462 | 3300022726 | Soil | WGSRGAPPTQEYPTVWRKFASNLIDGQPLPTGHYLMEEAPDRVIEHLLKFFTA |
Ga0242654_104188092 | 3300022726 | Soil | WGSRGAPPTQEYPTVWRKFASNLIDGQPLPTGHYLMEEAPDGVIEHLLKFFTA |
Ga0207663_106286591 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QEYPTVWRKFASNLVDAQPLPTGHYLQEEAPDQVIDHCLKFFTT |
Ga0207652_102913761 | 3300025921 | Corn Rhizosphere | EYPTVWRKFASNLVDIQPLPSGHYIQEEQPDRVYNDSIKFFTA |
Ga0207659_100906131 | 3300025926 | Miscanthus Rhizosphere | GTRGQPPTQEYPTVWRKYASNLVDIQPLPSGHYIQEEQPDQVYDHCIRFFTA |
Ga0257162_10257992 | 3300026340 | Soil | PPTQEYPTVWRKFASNLVDAQPLPTGHYLQEEAPDQVIDHFIKFFTT |
Ga0208990_10890431 | 3300027663 | Forest Soil | WRKFASNLVDVQPLPTGHYLQEDAPDQCYDHFVKFFKA |
Ga0209180_101319732 | 3300027846 | Vadose Zone Soil | RKFASNLVDAQPLPTGHYLQEEAPDRVVDHFLKFFTA |
Ga0209693_102900722 | 3300027855 | Soil | APPTQEYPTVWRKYASNLVDAQPLPTGHYLQEEAPDQVVDHFVKFFTT |
Ga0209380_102001484 | 3300027889 | Soil | RGAPPTQEYPTVWGRFATNLVDAQPLPTGHALQVEAPDRVHDHFVKFFTA |
Ga0209067_100384321 | 3300027898 | Watersheds | VWRKYASNLVDAQPLPTGHYLQEEAPDRVYDYFVKFFTT |
Ga0308309_105217571 | 3300028906 | Soil | KFASNLVDAQALATGHYLMEEAPDGVIEHLLKFFTA |
Ga0222749_100844251 | 3300029636 | Soil | TPLLVLWGTRGAPPSQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFVKFFTA |
Ga0222749_105228042 | 3300029636 | Soil | RGAPPTQEYPTVWRRFATNLVDAQPLPTGHALQVEAPDRVYDHFVKFFTA |
Ga0307499_100313762 | 3300031184 | Soil | VWRKFAKNLVDAQPLPTGHYLQEEAPDQVYDYFVKFFVT |
Ga0265316_102827211 | 3300031344 | Rhizosphere | TRGSPPTDEYPTVWRKYASSLVDIQPLPSGHYLQEEQPDRVYDYFIKFFTA |
Ga0170818_1040684253 | 3300031474 | Forest Soil | WRKFASNLVDAQPLPTGHYLQEEAPDQVIEHCLKFFTT |
Ga0307476_105135032 | 3300031715 | Hardwood Forest Soil | VWRKFASNLVDAQPLPTGHYLQEEAPDQVIDRFIKFFTT |
Ga0318493_104272742 | 3300031723 | Soil | PTVWRKFASNLVDAQPLPTGHYLQEEAPDQVIDHCVKFFTT |
Ga0318521_105489002 | 3300031770 | Soil | MPLPILWATRGAPPTQEYPTVWRKFASNLVDAQPLPTGHYLQEEVPDRVIKHFLKFFMA |
Ga0318546_107124481 | 3300031771 | Soil | APPTQEYPTVWRKFASNLVDAQPLPTGHYLQEEAPDRVIEHFLKFFTA |
Ga0318547_107690832 | 3300031781 | Soil | YASNLVDAQPLPTGHYLQEEAPDRVYDYLVKFFTT |
Ga0306919_113144491 | 3300031879 | Soil | PLLVLWGTRGAPPTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFIKFFTA |
Ga0306925_117827821 | 3300031890 | Soil | TRGRPPTQEYPNAWRQFASNLVDAQPLPTGHALQVEAPNAVYDHFVKFFAA |
Ga0318536_106756191 | 3300031893 | Soil | PTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFVKFFTT |
Ga0306923_102472601 | 3300031910 | Soil | KDRKIAMPSLLLVATRGAPPTEELPTVWRKYMSHLVEVQYLPTGHHMQEEAPDGVYDQFVKFFTT |
Ga0306923_105587602 | 3300031910 | Soil | LLPTSWRKYASNLVDARPLPTGHALQVEAPDRVYDHFVKFFKA |
Ga0306923_110909592 | 3300031910 | Soil | MPLLILWGTRGAPPTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFLKFFTA |
Ga0306923_111039171 | 3300031910 | Soil | PTVWRKFASNLVDAQPLPTGHYLQKEVPDRVIKHFLKFFTA |
Ga0306921_102475382 | 3300031912 | Soil | VLWGTRGAPPTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYEHFVKFFTA |
Ga0306921_126141562 | 3300031912 | Soil | KYASNLVDAQPLPTGHYLQEDAPDKLIDYFVKFFTA |
Ga0306921_126548041 | 3300031912 | Soil | MPLLILWGTRGAPPTKEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFVRFFTA |
Ga0310912_102988423 | 3300031941 | Soil | VTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFIKFFTA |
Ga0310913_102992791 | 3300031945 | Soil | RKFASNLVDAQPLPTGHYLQEEAPDRVYDHFVKFFTT |
Ga0310909_101742931 | 3300031947 | Soil | RKYMSHLVEVQYLPTGHHMQEEAPDGVYDQFVKFFTT |
Ga0310909_103798991 | 3300031947 | Soil | VWRKFASNLVDAQPLPTGHYLQEEAPDQVIDHCVKFFTT |
Ga0306926_109071231 | 3300031954 | Soil | VLRKFASNLVDAQPLPTGHYPQEEVPDRVIKHFLKFFTA |
Ga0306922_116092532 | 3300032001 | Soil | IVTPLLVLWGTRGAPPTQEYPTVWRRFASNLVDAQPLPTGHALQGEAPDRVYEHFVKFFT |
Ga0306922_124025671 | 3300032001 | Soil | PTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFVKFFAA |
Ga0318533_103861243 | 3300032059 | Soil | QEYPTIWRKFASNLIDAQPLPTGHALQVEAPDRVYDHFVKFFKA |
Ga0318505_105716362 | 3300032060 | Soil | RGAPPTEELPTVWRKYMSHLVEVQYLPTGHHMQEEAPDGVYDQFVKFFTT |
Ga0311301_101402071 | 3300032160 | Peatlands Soil | TQEYPTVWRRYASNLVDAQPLPTGHAVQVEAPDGVYYHFVKFFRA |
Ga0311301_104686644 | 3300032160 | Peatlands Soil | VTPLLVLWGTRGAPPTQEYPTVWRRFASNLVDAQPLPTGHALQVEAPDRVYDHFIKFFTT |
Ga0306920_1023350182 | 3300032261 | Soil | LLFGTRGAPPSQEYPTAWRKFASNLVDAQPLPTGRYMQEEAPDQIYDHFVKFFTA |
Ga0306920_1032089311 | 3300032261 | Soil | QEYPTVWRKYASNLVDAQPLPTGHYLQEEAPDQVVDHFIKFFTT |
⦗Top⦘ |