| Basic Information | |
|---|---|
| Family ID | F063300 |
| Family Type | Metagenome |
| Number of Sequences | 129 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSV |
| Number of Associated Samples | 28 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.97 % |
| % of genes near scaffold ends (potentially truncated) | 94.57 % |
| % of genes from short scaffolds (< 2000 bps) | 83.72 % |
| Associated GOLD sequencing projects | 23 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.938 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface (83.721 % of family members) |
| Environment Ontology (ENVO) | Unclassified (87.597 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (86.047 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 4.76% β-sheet: 45.24% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 3.10 |
| PF07676 | PD40 | 2.33 |
| PF01750 | HycI | 2.33 |
| PF00884 | Sulfatase | 2.33 |
| PF01555 | N6_N4_Mtase | 1.55 |
| PF04055 | Radical_SAM | 1.55 |
| PF07238 | PilZ | 1.55 |
| PF01694 | Rhomboid | 1.55 |
| PF12801 | Fer4_5 | 1.55 |
| PF12040 | DUF3526 | 0.78 |
| PF12092 | DUF3568 | 0.78 |
| PF03453 | MoeA_N | 0.78 |
| PF02517 | Rce1-like | 0.78 |
| PF00482 | T2SSF | 0.78 |
| PF07589 | PEP-CTERM | 0.78 |
| PF01261 | AP_endonuc_2 | 0.78 |
| PF02580 | Tyr_Deacylase | 0.78 |
| PF09861 | Lar_N | 0.78 |
| PF06695 | Sm_multidrug_ex | 0.78 |
| PF13546 | DDE_5 | 0.78 |
| PF00754 | F5_F8_type_C | 0.78 |
| PF14014 | DUF4230 | 0.78 |
| PF01208 | URO-D | 0.78 |
| PF13520 | AA_permease_2 | 0.78 |
| PF13649 | Methyltransf_25 | 0.78 |
| PF01965 | DJ-1_PfpI | 0.78 |
| PF01709 | Transcrip_reg | 0.78 |
| PF02518 | HATPase_c | 0.78 |
| PF02632 | BioY | 0.78 |
| PF02738 | MoCoBD_1 | 0.78 |
| PF14100 | DUF6807 | 0.78 |
| PF00202 | Aminotran_3 | 0.78 |
| PF13492 | GAF_3 | 0.78 |
| PF06463 | Mob_synth_C | 0.78 |
| PF03144 | GTP_EFTU_D2 | 0.78 |
| PF11175 | DUF2961 | 0.78 |
| PF02585 | PIG-L | 0.78 |
| PF02502 | LacAB_rpiB | 0.78 |
| PF00730 | HhH-GPD | 0.78 |
| PF01292 | Ni_hydr_CYTB | 0.78 |
| PF01475 | FUR | 0.78 |
| PF07228 | SpoIIE | 0.78 |
| PF13435 | Cytochrome_C554 | 0.78 |
| PF00156 | Pribosyltran | 0.78 |
| PF03572 | Peptidase_S41 | 0.78 |
| PF05170 | AsmA | 0.78 |
| PF12796 | Ank_2 | 0.78 |
| PF01402 | RHH_1 | 0.78 |
| PF01408 | GFO_IDH_MocA | 0.78 |
| PF02625 | XdhC_CoxI | 0.78 |
| PF03825 | Nuc_H_symport | 0.78 |
| PF00676 | E1_dh | 0.78 |
| PF01165 | Ribosomal_S21 | 0.78 |
| PF00318 | Ribosomal_S2 | 0.78 |
| PF02954 | HTH_8 | 0.78 |
| PF02826 | 2-Hacid_dh_C | 0.78 |
| PF08668 | HDOD | 0.78 |
| PF03727 | Hexokinase_2 | 0.78 |
| PF01791 | DeoC | 0.78 |
| PF02661 | Fic | 0.78 |
| PF01300 | Sua5_yciO_yrdC | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0680 | Ni,Fe-hydrogenase maturation factor | Energy production and conversion [C] | 2.33 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.55 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.55 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.55 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.55 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.78 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.78 |
| COG1975 | Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.78 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.78 |
| COG2426 | Uncharacterized membrane protein | Function unknown [S] | 0.78 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.78 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 0.78 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.78 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.78 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.78 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.78 |
| COG5026 | Hexokinase | Carbohydrate transport and metabolism [G] | 0.78 |
| COG1490 | D-aminoacyl-tRNA deacylase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1268 | Biotin transporter BioY | Coenzyme transport and metabolism [H] | 0.78 |
| COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.78 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.78 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.78 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.78 |
| COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 0.78 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.78 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.78 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.78 |
| COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.78 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.71 % |
| Unclassified | root | N/A | 47.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2100351012|ASLM90b_contig00488__length_808___numreads_8 | Not Available | 808 | Open in IMG/M |
| 3300005613|Ga0074649_1121012 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300005613|Ga0074649_1138046 | Not Available | 808 | Open in IMG/M |
| 3300009135|Ga0118736_10008003 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2329 | Open in IMG/M |
| 3300009135|Ga0118736_10052527 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1024 | Open in IMG/M |
| 3300009136|Ga0118735_10007746 | Not Available | 3541 | Open in IMG/M |
| 3300009136|Ga0118735_10062711 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1138 | Open in IMG/M |
| 3300009150|Ga0114921_10112659 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_62_9 | 1823 | Open in IMG/M |
| 3300009150|Ga0114921_10288575 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1167 | Open in IMG/M |
| 3300009150|Ga0114921_10486930 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 900 | Open in IMG/M |
| 3300009150|Ga0114921_10582389 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 822 | Open in IMG/M |
| 3300009150|Ga0114921_10598606 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 810 | Open in IMG/M |
| 3300009150|Ga0114921_10677254 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 761 | Open in IMG/M |
| 3300009150|Ga0114921_10776452 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300009150|Ga0114921_10798864 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 699 | Open in IMG/M |
| 3300009150|Ga0114921_10813129 | Not Available | 693 | Open in IMG/M |
| 3300009150|Ga0114921_10841109 | Not Available | 681 | Open in IMG/M |
| 3300009150|Ga0114921_11262178 | Not Available | 553 | Open in IMG/M |
| 3300009150|Ga0114921_11368367 | Not Available | 531 | Open in IMG/M |
| 3300009150|Ga0114921_11440551 | Not Available | 516 | Open in IMG/M |
| 3300009150|Ga0114921_11512466 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 502 | Open in IMG/M |
| 3300009150|Ga0114921_11515349 | Not Available | 501 | Open in IMG/M |
| 3300009488|Ga0114925_10069101 | Not Available | 2172 | Open in IMG/M |
| 3300009488|Ga0114925_10225322 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla | 1251 | Open in IMG/M |
| 3300009488|Ga0114925_10229267 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300009488|Ga0114925_10369941 | Not Available | 985 | Open in IMG/M |
| 3300009488|Ga0114925_10389127 | Not Available | 962 | Open in IMG/M |
| 3300009488|Ga0114925_10425429 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 921 | Open in IMG/M |
| 3300009488|Ga0114925_10510164 | Not Available | 843 | Open in IMG/M |
| 3300009488|Ga0114925_10528247 | Not Available | 829 | Open in IMG/M |
| 3300009488|Ga0114925_10571612 | Not Available | 798 | Open in IMG/M |
| 3300009488|Ga0114925_10715150 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 716 | Open in IMG/M |
| 3300009488|Ga0114925_10751418 | Not Available | 699 | Open in IMG/M |
| 3300009488|Ga0114925_10845610 | Not Available | 659 | Open in IMG/M |
| 3300009488|Ga0114925_10853872 | Not Available | 656 | Open in IMG/M |
| 3300009488|Ga0114925_10920213 | Not Available | 633 | Open in IMG/M |
| 3300009488|Ga0114925_10948842 | Not Available | 624 | Open in IMG/M |
| 3300009488|Ga0114925_11041492 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009488|Ga0114925_11046255 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla | 595 | Open in IMG/M |
| 3300009488|Ga0114925_11110871 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 578 | Open in IMG/M |
| 3300009488|Ga0114925_11144971 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium | 570 | Open in IMG/M |
| 3300009488|Ga0114925_11151511 | Not Available | 568 | Open in IMG/M |
| 3300009488|Ga0114925_11175016 | Not Available | 563 | Open in IMG/M |
| 3300009488|Ga0114925_11248109 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009488|Ga0114925_11334935 | Not Available | 529 | Open in IMG/M |
| 3300009488|Ga0114925_11351978 | Not Available | 526 | Open in IMG/M |
| 3300009488|Ga0114925_11410089 | Not Available | 516 | Open in IMG/M |
| 3300009499|Ga0114930_10003635 | All Organisms → cellular organisms → Bacteria | 13389 | Open in IMG/M |
| 3300009499|Ga0114930_10027785 | All Organisms → cellular organisms → Bacteria | 3771 | Open in IMG/M |
| 3300009499|Ga0114930_10030578 | All Organisms → cellular organisms → Bacteria | 3540 | Open in IMG/M |
| 3300009499|Ga0114930_10044378 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2774 | Open in IMG/M |
| 3300009499|Ga0114930_10066873 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
| 3300009499|Ga0114930_10104700 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1568 | Open in IMG/M |
| 3300009499|Ga0114930_10122671 | Not Available | 1411 | Open in IMG/M |
| 3300009499|Ga0114930_10178820 | Not Available | 1095 | Open in IMG/M |
| 3300009499|Ga0114930_10222372 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 944 | Open in IMG/M |
| 3300009499|Ga0114930_10226927 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 932 | Open in IMG/M |
| 3300009499|Ga0114930_10266448 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium | 835 | Open in IMG/M |
| 3300009499|Ga0114930_10340953 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300009499|Ga0114930_10364927 | Not Available | 676 | Open in IMG/M |
| 3300009528|Ga0114920_10302160 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1079 | Open in IMG/M |
| 3300009528|Ga0114920_10428694 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 900 | Open in IMG/M |
| 3300009528|Ga0114920_10485002 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300009528|Ga0114920_10488494 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 840 | Open in IMG/M |
| 3300009528|Ga0114920_10570285 | Not Available | 773 | Open in IMG/M |
| 3300009528|Ga0114920_10620311 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RBG_13_62_9 | 739 | Open in IMG/M |
| 3300009528|Ga0114920_10645371 | Not Available | 724 | Open in IMG/M |
| 3300009528|Ga0114920_10677432 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 705 | Open in IMG/M |
| 3300009528|Ga0114920_10789645 | Not Available | 650 | Open in IMG/M |
| 3300009528|Ga0114920_10794965 | Not Available | 648 | Open in IMG/M |
| 3300009528|Ga0114920_10877116 | Not Available | 615 | Open in IMG/M |
| 3300009528|Ga0114920_11032094 | Not Available | 563 | Open in IMG/M |
| 3300009528|Ga0114920_11140257 | Not Available | 534 | Open in IMG/M |
| 3300009529|Ga0114919_10168389 | Not Available | 1571 | Open in IMG/M |
| 3300009529|Ga0114919_10206488 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1398 | Open in IMG/M |
| 3300009529|Ga0114919_10276623 | Not Available | 1182 | Open in IMG/M |
| 3300009529|Ga0114919_10333266 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1061 | Open in IMG/M |
| 3300009529|Ga0114919_10510198 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009529|Ga0114919_10558089 | Not Available | 787 | Open in IMG/M |
| 3300009529|Ga0114919_10946072 | Not Available | 581 | Open in IMG/M |
| 3300009529|Ga0114919_10956006 | Not Available | 577 | Open in IMG/M |
| 3300009788|Ga0114923_10370883 | Not Available | 1051 | Open in IMG/M |
| 3300009788|Ga0114923_10603892 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 824 | Open in IMG/M |
| 3300009788|Ga0114923_10834239 | Not Available | 701 | Open in IMG/M |
| 3300009788|Ga0114923_10900462 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300009788|Ga0114923_11508216 | Not Available | 528 | Open in IMG/M |
| 3300009788|Ga0114923_11658695 | Not Available | 505 | Open in IMG/M |
| 3300009788|Ga0114923_11678017 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300011118|Ga0114922_10196962 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1701 | Open in IMG/M |
| 3300011118|Ga0114922_10975221 | Not Available | 689 | Open in IMG/M |
| 3300011118|Ga0114922_11506926 | Not Available | 541 | Open in IMG/M |
| 3300014903|Ga0164321_10048377 | Not Available | 1602 | Open in IMG/M |
| 3300014903|Ga0164321_10067405 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300015370|Ga0180009_10099664 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1530 | Open in IMG/M |
| 3300022221|Ga0224506_10205235 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300024265|Ga0209976_10410927 | Not Available | 718 | Open in IMG/M |
| 3300024265|Ga0209976_10502313 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 641 | Open in IMG/M |
| 3300024265|Ga0209976_10699575 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300024353|Ga0209979_1003671 | All Organisms → cellular organisms → Bacteria | 13365 | Open in IMG/M |
| 3300024353|Ga0209979_1042442 | Not Available | 2264 | Open in IMG/M |
| 3300024353|Ga0209979_1234309 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | 623 | Open in IMG/M |
| 3300024429|Ga0209991_10056802 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300024429|Ga0209991_10116490 | Not Available | 1334 | Open in IMG/M |
| 3300024429|Ga0209991_10297601 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 775 | Open in IMG/M |
| 3300024429|Ga0209991_10354595 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300024432|Ga0209977_10028794 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2669 | Open in IMG/M |
| 3300024432|Ga0209977_10066455 | Not Available | 1758 | Open in IMG/M |
| 3300024432|Ga0209977_10282724 | Not Available | 800 | Open in IMG/M |
| 3300024432|Ga0209977_10590632 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium SM23_30 | 509 | Open in IMG/M |
| 3300024433|Ga0209986_10035121 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
| 3300024433|Ga0209986_10103257 | Not Available | 1545 | Open in IMG/M |
| 3300024433|Ga0209986_10107641 | Not Available | 1502 | Open in IMG/M |
| 3300024433|Ga0209986_10210612 | Not Available | 964 | Open in IMG/M |
| 3300024433|Ga0209986_10226537 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 919 | Open in IMG/M |
| 3300024433|Ga0209986_10370441 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300027893|Ga0209636_10478203 | All Organisms → cellular organisms → Bacteria → PVC group | 1036 | Open in IMG/M |
| 3300027901|Ga0209427_10572036 | Not Available | 838 | Open in IMG/M |
| 3300031275|Ga0307437_1021654 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2565 | Open in IMG/M |
| 3300031331|Ga0307432_1145932 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium B3_Pla | 606 | Open in IMG/M |
| 3300031554|Ga0315544_1000205 | All Organisms → cellular organisms → Bacteria | 58812 | Open in IMG/M |
| 3300031585|Ga0315534_1123958 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300031624|Ga0315545_1041282 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2561 | Open in IMG/M |
| 3300031652|Ga0315553_10047826 | All Organisms → cellular organisms → Bacteria | 2420 | Open in IMG/M |
| 3300031652|Ga0315553_10097494 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1488 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 83.72% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 3.88% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.55% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.55% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.55% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.55% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 1.55% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 1.55% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.78% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 0.78% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 0.78% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2100351012 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from low methane PC12-244-90cm | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
| 3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
| 3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
| 3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009788 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300015370 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300024265 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024429 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300031275 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-90 | Environmental | Open in IMG/M |
| 3300031331 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-150 | Environmental | Open in IMG/M |
| 3300031554 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-130 | Environmental | Open in IMG/M |
| 3300031585 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-40 | Environmental | Open in IMG/M |
| 3300031624 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-10 | Environmental | Open in IMG/M |
| 3300031652 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASLM90b_03543390 | 2100351012 | Coastal Water And Sediment | LVERGQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKI |
| Ga0074649_11210121 | 3300005613 | Saline Water And Sediment | MQAYWLVVRVLLTPPAEAAASQKWKIIYFQVLTVSRRPELSRIAGA |
| Ga0074649_11380461 | 3300005613 | Saline Water And Sediment | LGERGQGWQGSKTQAYWLVVRVLLTPPAEATASQKWKII |
| Ga0115863_14248941 | 3300009034 | Sediment, Intertidal | GWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRYTKPLLSVFS* |
| Ga0118736_100080034 | 3300009135 | Marine Sediment | LAERGQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQV |
| Ga0118736_100525271 | 3300009135 | Marine Sediment | VERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSLDSTMFS* |
| Ga0118735_100077461 | 3300009136 | Marine Sediment | QGWQGSKTQAYWLVVRVLLTPPAEATASQKWKIIYLQVLSPELSALA* |
| Ga0118735_100627113 | 3300009136 | Marine Sediment | GWQGSKTQAYWLVVRVLLTPPAEAATSQKWKIIYLQVL* |
| Ga0114921_101126591 | 3300009150 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSALPPNE* |
| Ga0114921_102885751 | 3300009150 | Deep Subsurface | RGQGWQGSKTQAYWLVVRVLLTPPAEAEASQKWKIIYLQVLSECLS* |
| Ga0114921_104869301 | 3300009150 | Deep Subsurface | GWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRLI* |
| Ga0114921_105823891 | 3300009150 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSSSNIKHNF* |
| Ga0114921_105986061 | 3300009150 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSLIISASRVVSSL* |
| Ga0114921_106618221 | 3300009150 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSTASTEDVKTSVNVV* |
| Ga0114921_106772541 | 3300009150 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLIVCQI* |
| Ga0114921_107764522 | 3300009150 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLMGNLVL* |
| Ga0114921_107988641 | 3300009150 | Deep Subsurface | GWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSTWANMKGL* |
| Ga0114921_108131292 | 3300009150 | Deep Subsurface | LVERGQGWQGSKMQAYWLVVRVLLTPPAKAAASQKW |
| Ga0114921_108411092 | 3300009150 | Deep Subsurface | LAERGQGWQGSKTQAYWLVVRVLLTPPVEAAASQKWKIIYLQVLITPNLQGTMLI |
| Ga0114921_112621781 | 3300009150 | Deep Subsurface | GQGWQESKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLIARGAVTNEYRI* |
| Ga0114921_113683672 | 3300009150 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRQSLTP* |
| Ga0114921_114405511 | 3300009150 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRFKQ* |
| Ga0114921_115124661 | 3300009150 | Deep Subsurface | RGQGWQGSKTQDYWLVVRVLLTPPAEAAASQKWKIIYLQVLSVCCRFV* |
| Ga0114921_115153491 | 3300009150 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSVN* |
| Ga0114925_100691011 | 3300009488 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLMRL* |
| Ga0114925_102253222 | 3300009488 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRAEKG* |
| Ga0114925_102292671 | 3300009488 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRERKLRE* |
| Ga0114925_103699412 | 3300009488 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLIVNGYPPT* |
| Ga0114925_103891271 | 3300009488 | Deep Subsurface | GQGWQPSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLT* |
| Ga0114925_104254292 | 3300009488 | Deep Subsurface | QGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSTWANMKGL* |
| Ga0114925_105101641 | 3300009488 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLIWL* |
| Ga0114925_105282471 | 3300009488 | Deep Subsurface | RGQGWQGSKMQDYWLVVRVLLTPPAEAAASQKWKIIYLQVLMAAR* |
| Ga0114925_105716121 | 3300009488 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLR* |
| Ga0114925_107151501 | 3300009488 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAARQKWKIIYLQVLNCVGQGITT* |
| Ga0114925_107514181 | 3300009488 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLMAPR* |
| Ga0114925_108456101 | 3300009488 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSSSRILPGF* |
| Ga0114925_108538722 | 3300009488 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLKV* |
| Ga0114925_109202132 | 3300009488 | Deep Subsurface | LAERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIY |
| Ga0114925_109488421 | 3300009488 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRIEGR* |
| Ga0114925_110414922 | 3300009488 | Deep Subsurface | GQDWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLNIDMYQ* |
| Ga0114925_110462552 | 3300009488 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRFKYG* |
| Ga0114925_111108712 | 3300009488 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRA* |
| Ga0114925_111449712 | 3300009488 | Deep Subsurface | LAERGQGWQGSKMQAYWLVVRVLLTPPAEAAASQK |
| Ga0114925_111515111 | 3300009488 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLNVSPHKR* |
| Ga0114925_111708971 | 3300009488 | Deep Subsurface | KMQAYWLVVRVLLTPPAEAAAGQKWKIIYLQILREKKSKIE* |
| Ga0114925_111750161 | 3300009488 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSINIAICSQLNQ* |
| Ga0114925_112481091 | 3300009488 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSAQLSQP* |
| Ga0114925_113349351 | 3300009488 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLIFVWL* |
| Ga0114925_113519781 | 3300009488 | Deep Subsurface | LAERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLKLF |
| Ga0114925_114100891 | 3300009488 | Deep Subsurface | GPGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSSA* |
| Ga0114930_100036351 | 3300009499 | Deep Subsurface | LQRGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYL* |
| Ga0114930_100277851 | 3300009499 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSLKTRQGFFERPA* |
| Ga0114930_100305784 | 3300009499 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRPDASLCSA* |
| Ga0114930_100443781 | 3300009499 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEATASQKWKIIYLQVLSPELPALA* |
| Ga0114930_100668731 | 3300009499 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSIGSTNAKKY* |
| Ga0114930_101047002 | 3300009499 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSLVLSWSN* |
| Ga0114930_101226711 | 3300009499 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRVLGASPG* |
| Ga0114930_101788201 | 3300009499 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLNIVIRLR* |
| Ga0114930_102223721 | 3300009499 | Deep Subsurface | WQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLNTSF* |
| Ga0114930_102269272 | 3300009499 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRTYMFRDWFLL* |
| Ga0114930_102664481 | 3300009499 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSMMESR* |
| Ga0114930_103409531 | 3300009499 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSTEK* |
| Ga0114930_103649271 | 3300009499 | Deep Subsurface | RGQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQGLS* |
| Ga0114920_103021601 | 3300009528 | Deep Subsurface | ERGQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQALSECLS* |
| Ga0114920_104286942 | 3300009528 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLIVRKSEC* |
| Ga0114920_104850021 | 3300009528 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSADYIKL* |
| Ga0114920_104884941 | 3300009528 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSLLKSS* |
| Ga0114920_105522611 | 3300009528 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSGYQSRCAWERAVSYP* |
| Ga0114920_105702852 | 3300009528 | Deep Subsurface | LAERGQGWQESKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVL |
| Ga0114920_106203111 | 3300009528 | Deep Subsurface | GWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSALPPNE* |
| Ga0114920_106453712 | 3300009528 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLIVKCCKTLA* |
| Ga0114920_106774322 | 3300009528 | Deep Subsurface | VSFLAERGQGWQGSKTQAYWLVVRVLLTPPAEVADAPKPLW* |
| Ga0114920_107896451 | 3300009528 | Deep Subsurface | ERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYL* |
| Ga0114920_107949652 | 3300009528 | Deep Subsurface | ERGQGWQGSKTQACWLVVRVLLTPPAEAAAGQKWKIIYLQVLIAHSQG* |
| Ga0114920_108771162 | 3300009528 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSV* |
| Ga0114920_110320942 | 3300009528 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLKNL* |
| Ga0114920_111402571 | 3300009528 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLI* |
| Ga0114919_101683891 | 3300009529 | Deep Subsurface | GWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRL* |
| Ga0114919_102064882 | 3300009529 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRLQRQDFGL* |
| Ga0114919_102766231 | 3300009529 | Deep Subsurface | ERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLHVLNPAALSL* |
| Ga0114919_103332662 | 3300009529 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRAILKP* |
| Ga0114919_105101981 | 3300009529 | Deep Subsurface | LGERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQ |
| Ga0114919_105580891 | 3300009529 | Deep Subsurface | QGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRIEGR* |
| Ga0114919_109460721 | 3300009529 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLNPP* |
| Ga0114919_109560061 | 3300009529 | Deep Subsurface | LPERGQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQ |
| Ga0114923_103708832 | 3300009788 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSEQKGI* |
| Ga0114923_106038921 | 3300009788 | Deep Subsurface | FLVERGQGWQGSKMQAYWLVVRVLLRPPAEAAASQKWKIIYLQVLRLI* |
| Ga0114923_108342391 | 3300009788 | Deep Subsurface | LVERGQDWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRTTFIRL |
| Ga0114923_109004621 | 3300009788 | Deep Subsurface | LVEQGQGWQGSKTQAYWLVGRVLMTPPAEAAASQKWKIIYLQVLIVK* |
| Ga0114923_115082161 | 3300009788 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSFMQQ* |
| Ga0114923_116586952 | 3300009788 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSSNLETKH* |
| Ga0114923_116780171 | 3300009788 | Deep Subsurface | LDERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQ |
| Ga0114922_101969621 | 3300011118 | Deep Subsurface | LVERGQGWQGNKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLNTR |
| Ga0114922_109752211 | 3300011118 | Deep Subsurface | RGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSSA* |
| Ga0114922_115069262 | 3300011118 | Deep Subsurface | WQGSKMQAYWLVGRILLTPPAKAAASQKWKIIFLHVLIPYFIKYG* |
| Ga0164321_100483771 | 3300014903 | Marine Sediment | LVERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQ |
| Ga0164321_100674052 | 3300014903 | Marine Sediment | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLILQRHLTAKI* |
| Ga0180009_100996641 | 3300015370 | Groundwater | RGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLNLS* |
| Ga0224506_102052351 | 3300022221 | Sediment | RGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSADYIKL |
| Ga0209976_104109272 | 3300024265 | Deep Subsurface | LAERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQV |
| Ga0209976_105023131 | 3300024265 | Deep Subsurface | MQAYWLVVRVLLTLPAEAAASQKWKIIYLQVLSLLLSFTGTDFT |
| Ga0209976_106995752 | 3300024265 | Deep Subsurface | RGQGWQGSKTQAYWLVVRVLLTPPAAAAASQKWKIIYLQVLNYPDT |
| Ga0209979_10036711 | 3300024353 | Deep Subsurface | LQRGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYL |
| Ga0209979_10424421 | 3300024353 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEATASQKWKIIYLQVLSPELPALA |
| Ga0209979_12343092 | 3300024353 | Deep Subsurface | WQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLNL |
| Ga0209991_100568021 | 3300024429 | Deep Subsurface | ERGQGWQGSKTQAYWLVVQVLLTPPAEAAASQKWKIIYLQVLILQRHLGFQNAATYS |
| Ga0209991_101164901 | 3300024429 | Deep Subsurface | LAERGQGWQESKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLKQALS |
| Ga0209991_102976012 | 3300024429 | Deep Subsurface | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSDSY |
| Ga0209991_103545951 | 3300024429 | Deep Subsurface | RGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSL |
| Ga0209977_100287941 | 3300024432 | Deep Subsurface | RGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRERKLRE |
| Ga0209977_100664553 | 3300024432 | Deep Subsurface | LAERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLNL |
| Ga0209977_102827242 | 3300024432 | Deep Subsurface | LAERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVL |
| Ga0209977_104940551 | 3300024432 | Deep Subsurface | QGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSLFIGGYNSRHN |
| Ga0209977_105906322 | 3300024432 | Deep Subsurface | QGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSAV |
| Ga0209986_100351211 | 3300024433 | Deep Subsurface | GWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRLQRQDFGL |
| Ga0209986_101032572 | 3300024433 | Deep Subsurface | LPERGQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVL |
| Ga0209986_101076411 | 3300024433 | Deep Subsurface | ERGQGWQVSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSADYIKL |
| Ga0209986_102106121 | 3300024433 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLHVLNPAALSL |
| Ga0209986_102265371 | 3300024433 | Deep Subsurface | GQGWQGSKTQAYWLVVRVLLTPPAEATASQKWKIIYLQVLSPELSALA |
| Ga0209986_103704411 | 3300024433 | Deep Subsurface | GWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSAQLSQP |
| Ga0209636_104782031 | 3300027893 | Marine Sediment | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLRLSGYRVIR |
| Ga0209427_105720361 | 3300027901 | Marine Sediment | LVERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQV |
| Ga0307437_10216541 | 3300031275 | Salt Marsh | RGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSLVLS |
| Ga0307432_11459321 | 3300031331 | Salt Marsh | LVERGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKW |
| Ga0315544_10002051 | 3300031554 | Salt Marsh Sediment | QRGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYL |
| Ga0315534_11239581 | 3300031585 | Salt Marsh Sediment | GQGWQGSKMQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLCADYIKL |
| Ga0315545_10412823 | 3300031624 | Salt Marsh Sediment | GQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSLVLS |
| Ga0315553_100478263 | 3300031652 | Salt Marsh Sediment | LAERGQGWQGSKMQVYWLVVRVLLTPPAEAAASQKWKIIY |
| Ga0315553_100974941 | 3300031652 | Salt Marsh Sediment | RGQGWQGSKTQAYWLVVRVLLTPPAEAAASQKWKIIYLQVLSLRIRIYWT |
| ⦗Top⦘ |