Metagenome Family F063214

Basic Information
Family ID	F063214
Family Type	Metagenome
Number of Sequences	129
Average Sequence Length	38 residues
Representative Sequence	MLTTNQVPFIAQVSVIPYSLGYESAKYLLYQGLYNINLD
Number of Associated Samples	27
Number of Associated Scaffolds	129

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	34.11 %
% of genes from short scaffolds (< 2000 bps)	24.81 %
Associated GOLD sequencing projects	27
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Most Common Taxonomy
Group	Eukaryota (57.364 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (48.837 % of family members)
Environment Ontology (ENVO)	Unclassified (99.225 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (89.922 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 129 Family Scaffolds
PF03732	Retrotrans_gag	6.20
PF07727	RVT_2	3.10
PF00078	RVT_1	2.33
PF13960	DUF4218	1.55
PF03641	Lysine_decarbox	1.55
PF10536	PMD	0.78
PF02705	K_trans	0.78
PF00098	zf-CCHC	0.78
PF04577	Glyco_transf_61	0.78
PF14223	Retrotran_gag_2	0.78
PF00665	rve	0.78
PF14372	DUF4413	0.78
PF08284	RVP_2	0.78

COG ID	Name	Functional Category	% Frequency in 129 Family Scaffolds
COG1611	Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family	Nucleotide transport and metabolism [F]	1.55
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.78
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.78
COG3158	K+ uptake protein Kup	Inorganic ion transport and metabolism [P]	0.78
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.78
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.78

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.95 %
Unclassified	root	N/A	17.05 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	79.07 %
Unclassified	root	N/A	17.05 %
Viruses	superkingdom	All Organisms → Viruses	3.88 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	57.36 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	21.71 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	55.04 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	55.04 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	51.94 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	51.94 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	44.19 %
Methylomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	44.19 %
unclassified Methylomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	44.19 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
unclassified Sphingobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	44.19 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	40.31 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	40.31 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	40.31 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	40.31 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	40.31 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	40.31 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	40.31 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	39.53 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	39.53 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	28.68 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	3.10 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Name	Rank	Taxonomy	Distribution
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	21.71 %
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	19.38 %
Unclassified	root	N/A	17.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.88 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	1.55 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1.55 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.78 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.78 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.78 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.78 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300006051\|Ga0075364_10687207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	698	Open in IMG/M
3300025164\|Ga0209521_10325461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	865	Open in IMG/M
3300028786\|Ga0307517_10006373	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	17490	Open in IMG/M
3300028786\|Ga0307517_10046972	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	4488	Open in IMG/M
3300028786\|Ga0307517_10096780	Not Available	2361	Open in IMG/M
3300028786\|Ga0307517_10102280	Not Available	2247	Open in IMG/M
3300028786\|Ga0307517_10135095	Not Available	1757	Open in IMG/M
3300028786\|Ga0307517_10164120	All Organisms → Viruses → Predicted Viral	1480	Open in IMG/M
3300028786\|Ga0307517_10198903	Not Available	1256	Open in IMG/M
3300028794\|Ga0307515_10023273	All Organisms → cellular organisms → Bacteria	10865	Open in IMG/M
3300028794\|Ga0307515_10067177	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4950	Open in IMG/M
3300028794\|Ga0307515_10109731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3237	Open in IMG/M
3300028794\|Ga0307515_10695039	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	632	Open in IMG/M
3300030521\|Ga0307511_10020729	Not Available	6216	Open in IMG/M
3300030521\|Ga0307511_10021263	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	6117	Open in IMG/M
3300030521\|Ga0307511_10158857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1275	Open in IMG/M
3300030521\|Ga0307511_10281063	Not Available	769	Open in IMG/M
3300030522\|Ga0307512_10013816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	7546	Open in IMG/M
3300030522\|Ga0307512_10031114	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4629	Open in IMG/M
3300031456\|Ga0307513_10018369	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8358	Open in IMG/M
3300031456\|Ga0307513_10022487	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	7405	Open in IMG/M
3300031456\|Ga0307513_10032076	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	5932	Open in IMG/M
3300031456\|Ga0307513_10041521	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5075	Open in IMG/M
3300031456\|Ga0307513_10075367	Not Available	3503	Open in IMG/M
3300031456\|Ga0307513_10090019	Not Available	3131	Open in IMG/M
3300031456\|Ga0307513_10300947	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1370	Open in IMG/M
3300031456\|Ga0307513_10733521	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	693	Open in IMG/M
3300031507\|Ga0307509_10016394	Not Available	8575	Open in IMG/M
3300031507\|Ga0307509_10026754	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	6428	Open in IMG/M
3300031507\|Ga0307509_10045966	Not Available	4703	Open in IMG/M
3300031507\|Ga0307509_10062623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3921	Open in IMG/M
3300031507\|Ga0307509_10073575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	3557	Open in IMG/M
3300031507\|Ga0307509_10082359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	3319	Open in IMG/M
3300031507\|Ga0307509_10088830	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	3171	Open in IMG/M
3300031507\|Ga0307509_10091723	All Organisms → cellular organisms → Eukaryota → Sar	3108	Open in IMG/M
3300031507\|Ga0307509_10096139	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3015	Open in IMG/M
3300031507\|Ga0307509_10107724	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2801	Open in IMG/M
3300031507\|Ga0307509_10133334	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2434	Open in IMG/M
3300031507\|Ga0307509_10261100	All Organisms → Viruses → Predicted Viral	1507	Open in IMG/M
3300031616\|Ga0307508_10005905	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	11554	Open in IMG/M
3300031616\|Ga0307508_10006575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	10916	Open in IMG/M
3300031616\|Ga0307508_10026039	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5302	Open in IMG/M
3300031616\|Ga0307508_10043393	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4029	Open in IMG/M
3300031616\|Ga0307508_10057358	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	3445	Open in IMG/M
3300031616\|Ga0307508_10080833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2832	Open in IMG/M
3300031616\|Ga0307508_10115437	Not Available	2286	Open in IMG/M
3300031616\|Ga0307508_10156046	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1886	Open in IMG/M
3300031649\|Ga0307514_10431778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	656	Open in IMG/M
3300031649\|Ga0307514_10456373	Not Available	626	Open in IMG/M
3300031649\|Ga0307514_10533957	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	546	Open in IMG/M
3300031730\|Ga0307516_10013660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	8628	Open in IMG/M
3300031730\|Ga0307516_10025069	Not Available	6077	Open in IMG/M
3300031730\|Ga0307516_10032997	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	5212	Open in IMG/M
3300031730\|Ga0307516_10044951	Not Available	4365	Open in IMG/M
3300031730\|Ga0307516_10060695	All Organisms → cellular organisms → Eukaryota	3672	Open in IMG/M
3300031730\|Ga0307516_10350587	Not Available	1141	Open in IMG/M
3300031838\|Ga0307518_10020021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4804	Open in IMG/M
3300032354\|Ga0325403_1000107	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	43397	Open in IMG/M
3300032354\|Ga0325403_1001979	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	17772	Open in IMG/M
3300032354\|Ga0325403_1007157	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	10665	Open in IMG/M
3300032354\|Ga0325403_1011355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	8453	Open in IMG/M
3300032354\|Ga0325403_1014956	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	7249	Open in IMG/M
3300032354\|Ga0325403_1019183	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	6250	Open in IMG/M
3300032354\|Ga0325403_1021985	Not Available	5719	Open in IMG/M
3300032354\|Ga0325403_1030952	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4469	Open in IMG/M
3300032354\|Ga0325403_1031596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	4399	Open in IMG/M
3300032354\|Ga0325403_1048586	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3014	Open in IMG/M
3300032354\|Ga0325403_1064361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2216	Open in IMG/M
3300032354\|Ga0325403_1087854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1450	Open in IMG/M
3300032354\|Ga0325403_1106451	All Organisms → Viruses → Predicted Viral	1072	Open in IMG/M
3300032354\|Ga0325403_1150220	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	628	Open in IMG/M
3300032355\|Ga0325401_1003922	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	13839	Open in IMG/M
3300032355\|Ga0325401_1014487	All Organisms → cellular organisms → Eukaryota	7540	Open in IMG/M
3300032355\|Ga0325401_1014662	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	7489	Open in IMG/M
3300032355\|Ga0325401_1019488	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6352	Open in IMG/M
3300032355\|Ga0325401_1029229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	4865	Open in IMG/M
3300032355\|Ga0325401_1044764	Not Available	3518	Open in IMG/M
3300032355\|Ga0325401_1050424	Not Available	3184	Open in IMG/M
3300032355\|Ga0325401_1051755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	3114	Open in IMG/M
3300032355\|Ga0325401_1063527	All Organisms → Viruses → Predicted Viral	2574	Open in IMG/M
3300032355\|Ga0325401_1120517	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1239	Open in IMG/M
3300032355\|Ga0325401_1143898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	987	Open in IMG/M
3300032374\|Ga0325400_1016878	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	6913	Open in IMG/M
3300032374\|Ga0325400_1038357	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	4182	Open in IMG/M
3300032374\|Ga0325400_1063017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	2866	Open in IMG/M
3300032374\|Ga0325400_1262877	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	664	Open in IMG/M
3300032389\|Ga0325405_1000418	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	41102	Open in IMG/M
3300032389\|Ga0325405_1001437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	24125	Open in IMG/M
3300032389\|Ga0325405_1003851	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	15404	Open in IMG/M
3300032389\|Ga0325405_1004446	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14311	Open in IMG/M
3300032389\|Ga0325405_1014644	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	7294	Open in IMG/M
3300032389\|Ga0325405_1015448	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7025	Open in IMG/M
3300032389\|Ga0325405_1024655	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5000	Open in IMG/M
3300032389\|Ga0325405_1041169	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3131	Open in IMG/M
3300032389\|Ga0325405_1042864	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2998	Open in IMG/M
3300032389\|Ga0325405_1090811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	999	Open in IMG/M
3300032390\|Ga0325404_1005825	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	12975	Open in IMG/M
3300032390\|Ga0325404_1019972	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6011	Open in IMG/M
3300032390\|Ga0325404_1025843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	4876	Open in IMG/M
3300032390\|Ga0325404_1065877	All Organisms → Viruses → Predicted Viral	1653	Open in IMG/M
3300032390\|Ga0325404_1082922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1091	Open in IMG/M
3300032390\|Ga0325404_1090836	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	925	Open in IMG/M
3300032390\|Ga0325404_1111552	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	635	Open in IMG/M
3300032735\|Ga0325410_1000415	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	43842	Open in IMG/M
3300032735\|Ga0325410_1008135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	11370	Open in IMG/M
3300032735\|Ga0325410_1016360	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	7294	Open in IMG/M
3300032735\|Ga0325410_1017194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7031	Open in IMG/M
3300032735\|Ga0325410_1022618	Not Available	5689	Open in IMG/M
3300032735\|Ga0325410_1061158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1814	Open in IMG/M
3300032740\|Ga0325411_1002323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	21456	Open in IMG/M
3300032740\|Ga0325411_1003473	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	17783	Open in IMG/M
3300032740\|Ga0325411_1017462	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6894	Open in IMG/M
3300032741\|Ga0325414_1138512	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	556	Open in IMG/M
3300033160\|Ga0325402_1017886	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6474	Open in IMG/M
3300033179\|Ga0307507_10005608	Not Available	20423	Open in IMG/M
3300033179\|Ga0307507_10028290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	5978	Open in IMG/M
3300033179\|Ga0307507_10041266	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4621	Open in IMG/M
3300033179\|Ga0307507_10050514	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4012	Open in IMG/M
3300033179\|Ga0307507_10090574	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2624	Open in IMG/M
3300033179\|Ga0307507_10623214	Not Available	552	Open in IMG/M
3300033180\|Ga0307510_10028117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	6425	Open in IMG/M
3300033180\|Ga0307510_10372432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	874	Open in IMG/M
3300034389\|Ga0325419_006206	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	13071	Open in IMG/M
3300034689\|Ga0325421_017735	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6073	Open in IMG/M
3300034778\|Ga0325423_025781	Not Available	4720	Open in IMG/M
3300034778\|Ga0325423_028775	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4278	Open in IMG/M
3300034899\|Ga0325407_006225	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	12164	Open in IMG/M
3300034899\|Ga0325407_028782	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	4436	Open in IMG/M
3300034899\|Ga0325407_115131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	740	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.22%
Environmental	Environmental	0.78%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.22%
Terrestrial	Environmental → Terrestrial	0.78%

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	49.61%
Wood	Host-Associated → Plants → Wood	45.74%
Phylloplane	Host-Associated → Plants → Phylloplane	3.88%
Soil	Environmental → Terrestrial → Soil	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	48.84%
Unclassified	Host-Associated → Plants → Wood → Unclassified	45.74%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	3.88%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.78%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.78%

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F063214

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300006051	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Host-Associated	Open in IMG/M
3300025164	Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4	Environmental	Open in IMG/M
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated	Open in IMG/M
3300032740	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4	Host-Associated	Open in IMG/M
3300032741	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3	Host-Associated	Open in IMG/M
3300033160	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated	Open in IMG/M
3300034689	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2	Host-Associated	Open in IMG/M
3300034778	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4	Host-Associated	Open in IMG/M
3300034899	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4	Host-Associated	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0075364_106872071	3300006051	Populus Endosphere	MLTTNQVPFIAQVSVIPYSMGYESAKYLLYQVLYNINLD*
Ga0209521_103254611	3300025164	Soil	TTNQVPFIAQVSVIPYSMGYESAKYLLYQVLYNINLD
Ga0307517_1000637314	3300028786	Ectomycorrhiza	MLTTNQVPFIAQVSIIPYSMGYESAKYLLYQVLYNINLD
Ga0307517_100469723	3300028786	Ectomycorrhiza	MLTTHQVPFIAQVSVIPYGLGYESAKYLLYQGLYNINVD
Ga0307517_100967801	3300028786	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYDLGYESAKYSLYQGLYNINLD
Ga0307517_101022805	3300028786	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESAKYLLYQGLYNI
Ga0307517_101350951	3300028786	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYSMGYQSAKYLVYQVLYNINLD
Ga0307517_101641201	3300028786	Ectomycorrhiza	MLTRNQVPFIAHVSVIPYGLGYESVKYLLYQGLYNINL
Ga0307517_101989031	3300028786	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESAKYLLYQGLYNINLDY
Ga0307515_100232737	3300028794	Ectomycorrhiza	MLTTNQVHFIAQVSVIPYDLGYESAKYLLYQGYTT
Ga0307515_100671774	3300028794	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESAKYLLYQGYIT
Ga0307515_101097311	3300028794	Ectomycorrhiza	MLTTNHVPFIAQVSVIPYGFSYESAKYLLYQGFYNINLD
Ga0307515_106950391	3300028794	Ectomycorrhiza	MLTTNQVAFIAQVLVIPYSMGYESAKYLLYQVLYNI
Ga0307511_100207291	3300030521	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYSMGYESAKYLLYQVLYN
Ga0307511_100212634	3300030521	Ectomycorrhiza	MLTTHQVPFIAQVSVIPYGLGYESVKYLLYQGLYNINVD
Ga0307511_101588571	3300030521	Ectomycorrhiza	MLTTNQVPFITQVSVIPYGLGYESAKYLLYQGLYNI
Ga0307511_102810631	3300030521	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESVKYLLYKGLYN
Ga0307512_100138165	3300030522	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESAKYLLYQGLYNINLD
Ga0307512_100311143	3300030522	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESAKYLLYQGLYNINID
Ga0307513_100183691	3300031456	Ectomycorrhiza	MLTTNQVPFIAQVSVISYSLGYESAKYLLYQELYNINLD
Ga0307513_100224877	3300031456	Ectomycorrhiza	MLTTNQIPFIAQVSVIPYDLGYESAKYLLYQGLYNINLD
Ga0307513_100320763	3300031456	Ectomycorrhiza	MLTANQVPFIAQVSVIPYSLGYESTKYLLYQGLYNINLD
Ga0307513_100415216	3300031456	Ectomycorrhiza	MLTTNQVPFIATQVSVIPYNMGYESVKYLLYQVLHNINLY
Ga0307513_100753671	3300031456	Ectomycorrhiza	MLTTDQVPFIAQVSVIPYGLGYESAKYLLYQGLYNINLD
Ga0307513_100900193	3300031456	Ectomycorrhiza	MLTTNQVPFIAQVSVKPYGLGYESAKYLLYQGLYNINLD
Ga0307513_103009471	3300031456	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYSMGYESTKYLLYQVLYNI
Ga0307513_107335211	3300031456	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYSMGYESAKYLLYQVLYNI
Ga0307509_100163946	3300031507	Ectomycorrhiza	MLTINQVPFIAQVSVIPYSMGYESAKYLLYQVLYKINLD
Ga0307509_100267546	3300031507	Ectomycorrhiza	MLTTDQVLFIAQVSVIPYDLGYESAKYLLYQVLYNINLD
Ga0307509_100459666	3300031507	Ectomycorrhiza	MLTTNEVPFIAQVWVIPYSLGYESAKYLLYKGYTA
Ga0307509_100626232	3300031507	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGCESAMYLLYQGYTT
Ga0307509_100735753	3300031507	Ectomycorrhiza	MLTTNQVPFIAQVLVIPYGVGYESVKYLLYQGLYNINLD
Ga0307509_100823592	3300031507	Ectomycorrhiza	MLTTNQVLFIAQVSVIPYSMGYESAKYLLYQVLYNINLD
Ga0307509_100888301	3300031507	Ectomycorrhiza	MLTKNQVPFIAQVSVIPYGLSYENAKYLLYQGLYNINLD
Ga0307509_100917231	3300031507	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLSYESAKYLLYKGLHNINLD
Ga0307509_100961391	3300031507	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYENIKYLLYQGYTP
Ga0307509_101077243	3300031507	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESAKYLLYQGLYNIN
Ga0307509_101333341	3300031507	Ectomycorrhiza	MLTRNQVSFIAQMSVIPYNLGYESAKYLLYQGLYNINLD
Ga0307509_102611001	3300031507	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESVKYLLYQGLYNINLD
Ga0307508_100059057	3300031616	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYSLGYESTKYLLYQGYTT
Ga0307508_100065755	3300031616	Ectomycorrhiza	MLTTSQVPFIAQVSVIPYGLGYESAKYLLYQELYNINLD
Ga0307508_100260396	3300031616	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESAKYLLYQGYTT
Ga0307508_100433931	3300031616	Ectomycorrhiza	MLTTNQVPFIAHVSVIPYGLGYESAKYLFYQGLYNINLD
Ga0307508_100573581	3300031616	Ectomycorrhiza	MLTTNQVSFIVQVSVIPYGLGYESAKYLLYQGLYNINLD
Ga0307508_100808331	3300031616	Ectomycorrhiza	MLTTNQVYFIAQVSVIPYNMGYESAKYLLYQVLYNINLDLPFNK
Ga0307508_101154374	3300031616	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYDLGYESAKYSLYQGLYN
Ga0307508_101560465	3300031616	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLDYESANYLLYQVLYN
Ga0307514_104317781	3300031649	Ectomycorrhiza	FMLTTNQVPFITQVSVTIQLGYESAKYLLYQGLYNINLD
Ga0307514_104563731	3300031649	Ectomycorrhiza	MLTTDQVFFIAQVSVIPYDLGYESAKYLLYQVLYNMNL
Ga0307514_105339571	3300031649	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYVLGYESAKYLLYQRLYNLNLDEPFNKQSI
Ga0307516_100136604	3300031730	Ectomycorrhiza	MLTTNQVSFIAQVSVIQYNLGYESAKYLLYQGLYNINLD
Ga0307516_100250691	3300031730	Ectomycorrhiza	MLTTNQVPFIAHVSVIPHGLGYESTKYLLYQGYTA
Ga0307516_100329973	3300031730	Ectomycorrhiza	MLTTDQVLFIAQVSVIPYDLGYESAKYLLYQVLYNINLDYPFNK
Ga0307516_100449514	3300031730	Ectomycorrhiza	MLTTNQVPFIAQVSVIPHGLGYESAMYLLYQGLYNINLD
Ga0307516_100606952	3300031730	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLSYESAKYLLYKELHNINLD
Ga0307516_103505871	3300031730	Ectomycorrhiza	MLTTNQVHFIAQVLVIPYGLGYESVKYLLYQGYTT
Ga0307518_100200212	3300031838	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYNIGYESAKHLLYQVLYNINLD
Ga0325403_100010725	3300032354	Xylem	MLTTNQVPFIAQVSVIPYGLGYESAKYFLYQGLYNINLD
Ga0325403_10019796	3300032354	Xylem	MLTTNQVPFIAQVPVIPYSLGYESAKYLLYQGYTT
Ga0325403_10071575	3300032354	Xylem	MLTTNQVPFIAQVLIISYGLSYEHAKYLLYQGLYNINLD
Ga0325403_10113558	3300032354	Xylem	MLTRNQVPFIAQVSVIPYSMGYESAKYLMYQVLYNINQD
Ga0325403_10149564	3300032354	Xylem	MLTTNQVPFIAQVSIIPYGLGYESAKYLLYQGLYNINLD
Ga0325403_10191835	3300032354	Xylem	MLTTNQVPFIAQVSVIPYSMSYESAKYLLYQVLYNINLD
Ga0325403_10219852	3300032354	Xylem	MLTTNQVPFIAQVSIIPCGWAMKVPTNESAKCLLYQGLYNINLD
Ga0325403_10309523	3300032354	Xylem	MLTTNQVPFIAQVLVIPYSMGYESAKYLLYQVLYNINLD
Ga0325403_10315962	3300032354	Xylem	MSLTTNQVPFIAQVSVIPYSMGYESAKYLLYQVLYKINLD
Ga0325403_10485865	3300032354	Xylem	MLTTNQVTFIAQVSVIPYSMGYESAKYLLYQVLHNI
Ga0325403_10643611	3300032354	Xylem	MLTTNQVPFIAQVSVIPYGLGYESAKYLLYQGLDNINLD
Ga0325403_10878541	3300032354	Xylem	MLTTNQVPFIAQVSVIPYSMGYESAKYLLYQVLYNINLD
Ga0325403_11064511	3300032354	Xylem	MLTTNQVPFIAQVSVISYSMGYESAKYLLYQVLYNI
Ga0325403_11502201	3300032354	Xylem	MLTTNQVPFIAQVSVIPYSMGYESDKYSLYQVLYN
Ga0325401_10039225	3300032355	Xylem	MLTTNEVHFIAQVSIIPYGLGYESAEYLLYQGLYNINLD
Ga0325401_10144872	3300032355	Xylem	MLTTNQVSFIAHVSVIPYDLGYESAKYLLYQGYTT
Ga0325401_10146625	3300032355	Xylem	MLITNQVHFIAQVSVIPYGLGYESAKYLLYQGYTT
Ga0325401_10194882	3300032355	Xylem	MLTTNQVSFIAQVPIIPYDLGYESTKYLLYQGYTT
Ga0325401_10292291	3300032355	Xylem	MVTTNQAPFIAQVLVISYGLGYESVKYLLYQGLYNINLD
Ga0325401_10447641	3300032355	Xylem	MLTTNQITFIAQVSVIPYSMGYESAKYLLYQVLYNINLD
Ga0325401_10504242	3300032355	Xylem	TNQVPFIAQVSVIPYSMGYESAKYLLYQVLYNINLD
Ga0325401_10517552	3300032355	Xylem	MIITYVNNKSVPFIAQVSVIPYNMSYENAKYFLYQVLYNINLD
Ga0325401_10635273	3300032355	Xylem	MLTTNQVPFIAQVSVIPYSIGYESAKYLLYQVLYNI
Ga0325401_11205171	3300032355	Xylem	MLTRNQVPFIAQVSVIPYSMGYESAKYLMYQVLYNI
Ga0325401_11438981	3300032355	Xylem	TNQVPFIAQVSVIPYSMGYESVKYLLYQVLYNINLD
Ga0325400_101687811	3300032374	Xylem	MLTINQVPFIAQVSVIPYGLGYESAKYLLYQGLYNINLD
Ga0325400_10383571	3300032374	Xylem	MLTTNQAPFIAQVLVIPYGLGYESAKYLLYQGYIT
Ga0325400_10630172	3300032374	Xylem	MLTTNQVPFIEEVSVIPYDLGYESAKYLMYQGYTT
Ga0325400_12628772	3300032374	Xylem	MLTTNQVPFIAQVSIIPYSMGYESAKYLLYQVLYNI
Ga0325405_10004184	3300032389	Xylem	MLTTNQVPFIAQVSVIPYGLSYESAKYLLYQELYNINLD
Ga0325405_100143718	3300032389	Xylem	MLTTNQVPFIAQVSVIPYNMGYENAKYLLYQVLYNINLD
Ga0325405_10038516	3300032389	Xylem	MLTTNQVPFIAQVSIIPYGLSYEHAKYLLYQGLYNINLD
Ga0325405_100444620	3300032389	Xylem	MLTTNQVSFIAQVSVIPYSMGNKSAKYLLYQVLNNINLD
Ga0325405_10146445	3300032389	Xylem	MLTTNQVPFIEKVSVIPYDLGYESAKYLMYQGYTT
Ga0325405_10154484	3300032389	Xylem	MLTTNQVPFIAQVSVIPYSLGYESAKHLLYQGLYNINLD
Ga0325405_10246551	3300032389	Xylem	MLTTNQVPFIAQVSVIPYSMGYEIAKYLLYQVLYNINLD
Ga0325405_10411694	3300032389	Xylem	MLTTNQVPFIAQVSVIPYSMGYESAKYLLYQVSYNI
Ga0325405_10428641	3300032389	Xylem	MLTTNQVLFIAQVSVIPYSMGYESAKYLLYQVLYNINL
Ga0325405_10908111	3300032389	Xylem	LMLTTNQVPFIAQVSVIPYSMGYESAKYLLYQVLYNINLD
Ga0325404_10058251	3300032390	Xylem	MLITNQVPFIAQVSVIPYSMSYESAKYLLYQVLYNINLD
Ga0325404_10199725	3300032390	Xylem	MLTTNQVPFIAQVSVIPYNMGYESAKYLLYQVLYNINLD
Ga0325404_10258431	3300032390	Xylem	MLTTNQAPFIAQVLVIPYGLGYESAKYLLYQGLYNINLD
Ga0325404_10658771	3300032390	Xylem	MLTTNQVLFIAQVSVIPYSMGYESAKYLLYQVLYNI
Ga0325404_10829222	3300032390	Xylem	LTTNQVPFIAQVSVIPYNMGYESAKYLLYQVLYNINLD
Ga0325404_10908361	3300032390	Xylem	MLTTNQVPFIAQVLVIPYSMGYESAKYLLYQVLYNI
Ga0325404_11115521	3300032390	Xylem	MLTTNQVPFIAQVSVIPYSMGYESSKYLLYQVLYNINL
Ga0325410_100041524	3300032735	Xylem	MLTTNQVSFIEQVSVIPYGLGYESAKYLLYQGYAT
Ga0325410_10081352	3300032735	Xylem	MLTTNQVYFIAQVSVIPYNMGYESAKYLLYQMLYNINLDLPFNK
Ga0325410_10163608	3300032735	Xylem	MLTTNQVPFIEEVSVIPYDLGYESAKYMMYQGYTT
Ga0325410_10171943	3300032735	Xylem	MLTTNQVPFIAQVSVIPYSLGYESAKYLLYQGLYNINLD
Ga0325410_10226184	3300032735	Xylem	MLTTNQVPFIAQVSVIPYSMGYESAKYLLYQVLYNINPD
Ga0325410_10611581	3300032735	Xylem	MLTTNQVPFIAQVSVIPYSMGYESVKYLLYQVLYNI
Ga0325411_10023231	3300032740	Xylem	MLTTNQVPFIAQVSVIPYNMGYESAKYLLYQVLYNINL
Ga0325411_10034731	3300032740	Xylem	MLTTNQVPFIAQVSVIPYSMGYESAKYLLYQILYNINLD
Ga0325411_101746211	3300032740	Xylem	MLTTNQVPFIAQVLVIPYSMGYEGAKYLLYQVLYNINLD
Ga0325414_11385121	3300032741	Leaf	MLTTNQVAFIAQVSVIPYSMGYESAKYLLYQVLYNINLD
Ga0325402_10178868	3300033160	Xylem	MLTTNQVPFIAQVSVIPYSMGYESAKYLFYQVLYNINLD
Ga0307507_100056088	3300033179	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYGLGYESAKYLLYQGYTI
Ga0307507_100282903	3300033179	Ectomycorrhiza	MLTTNQVPFIVQVSVIPYGLGYENVKYLLYQGYTA
Ga0307507_100412661	3300033179	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYNMGYESAKYLLYQVLYN
Ga0307507_100505141	3300033179	Ectomycorrhiza	MLTTNHVPFIAQVSVIPYGLSYESAKYLLYQGFYNINLD
Ga0307507_100905742	3300033179	Ectomycorrhiza	MLTANQVPFIAQVSVIPYSLGYKSAKHLLYQGLNNINLD
Ga0307507_106232142	3300033179	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYSMGYESAKYLLYQGLYN
Ga0307510_100281175	3300033180	Ectomycorrhiza	MLTTNQVLFIARVGYTIRLGYESAKYLLYQGLHNINLD
Ga0307510_103724322	3300033180	Ectomycorrhiza	MLTTNQVPFIAQVSVIPYSMGYESVKYLLYQVLYNINLD
Ga0325419_006206_12958_13071	3300034389	Leaf	MLTTNQVPFIAQVSVIPYSMGYESVKYLLYQVLYNINL
Ga0325421_017735_4355_4474	3300034689	Leaf	MVTTNQAPFIAQVLVIPYGLGYESAKYLLYQGLYNINLD
Ga0325423_025781_147_266	3300034778	Leaf	MLTTNQVPFIAQVSIIPYSMGYESVKYLLYQVLYNINLD
Ga0325423_028775_58_177	3300034778	Leaf	MLTKNQVPFIAQVSVILYSMGYESAKYLLYQVLYNINLD
Ga0325407_006225_11481_11600	3300034899	Xylem	MLTKNQVPFIAQVSVIPYSMGYESAKYLLYQVLYNINPD
Ga0325407_028782_4058_4192	3300034899	Xylem	MLTTNQVPFIAQVSVIPYGWAMKVPTNESAKYLLYQGLYNINLD
Ga0325407_115131_2_121	3300034899	Xylem	MLTTNQVPFIAQVSVIPYSMGYESAKYLLYQVLHNINLD

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign