| Basic Information | |
|---|---|
| Family ID | F063204 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 46 residues |
| Representative Sequence | PETYEQDMEVLRLPFTEALNAALEGQIVHSGSVTALCRAARALKLL |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.77 % |
| % of genes near scaffold ends (potentially truncated) | 98.46 % |
| % of genes from short scaffolds (< 2000 bps) | 90.77 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.462 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.923 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.308 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.73% β-sheet: 0.00% Coil/Unstructured: 70.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF13205 | Big_5 | 73.85 |
| PF08281 | Sigma70_r4_2 | 5.38 |
| PF01061 | ABC2_membrane | 2.31 |
| PF09195 | Endonuc-BglII | 1.54 |
| PF00206 | Lyase_1 | 0.77 |
| PF00293 | NUDIX | 0.77 |
| PF07676 | PD40 | 0.77 |
| PF00440 | TetR_N | 0.77 |
| PF00005 | ABC_tran | 0.77 |
| PF02785 | Biotin_carb_C | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.46 % |
| Unclassified | root | N/A | 1.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig180470 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300001359|A3035W6_1022234 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300001359|A3035W6_1344251 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300001418|JGI20188J14859_1025262 | Not Available | 599 | Open in IMG/M |
| 3300002911|JGI25390J43892_10002792 | All Organisms → cellular organisms → Bacteria | 3784 | Open in IMG/M |
| 3300002916|JGI25389J43894_1046804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 735 | Open in IMG/M |
| 3300004479|Ga0062595_100879125 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300005167|Ga0066672_10551755 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005167|Ga0066672_10950122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
| 3300005174|Ga0066680_10235891 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300005406|Ga0070703_10487639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300005435|Ga0070714_101990186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 567 | Open in IMG/M |
| 3300005445|Ga0070708_100256086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1645 | Open in IMG/M |
| 3300005467|Ga0070706_100682190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 953 | Open in IMG/M |
| 3300005467|Ga0070706_101105906 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005468|Ga0070707_100183135 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
| 3300005468|Ga0070707_100688408 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300005471|Ga0070698_101748378 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005518|Ga0070699_100410059 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300005536|Ga0070697_100093367 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
| 3300005537|Ga0070730_10088179 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
| 3300005540|Ga0066697_10576221 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005542|Ga0070732_10737447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300005552|Ga0066701_10436599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 812 | Open in IMG/M |
| 3300005554|Ga0066661_10287634 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300005555|Ga0066692_10368931 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300005555|Ga0066692_10684394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 637 | Open in IMG/M |
| 3300005555|Ga0066692_10884884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
| 3300005558|Ga0066698_10159775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1526 | Open in IMG/M |
| 3300005558|Ga0066698_11063963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300005566|Ga0066693_10098646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1051 | Open in IMG/M |
| 3300005566|Ga0066693_10328329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 614 | Open in IMG/M |
| 3300005568|Ga0066703_10125580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1529 | Open in IMG/M |
| 3300005568|Ga0066703_10197826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1218 | Open in IMG/M |
| 3300005569|Ga0066705_10943128 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005598|Ga0066706_10386304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1113 | Open in IMG/M |
| 3300006031|Ga0066651_10532876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300006050|Ga0075028_100719590 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006794|Ga0066658_10343004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 798 | Open in IMG/M |
| 3300006796|Ga0066665_10372860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1171 | Open in IMG/M |
| 3300006797|Ga0066659_10109670 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300006797|Ga0066659_11491892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 566 | Open in IMG/M |
| 3300006914|Ga0075436_101417049 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300007258|Ga0099793_10053118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1793 | Open in IMG/M |
| 3300007265|Ga0099794_10741240 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009012|Ga0066710_101592554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1001 | Open in IMG/M |
| 3300009088|Ga0099830_10294594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1294 | Open in IMG/M |
| 3300009088|Ga0099830_11165218 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300009088|Ga0099830_11780151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300009089|Ga0099828_10471893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
| 3300009089|Ga0099828_11329816 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300009090|Ga0099827_10813644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 809 | Open in IMG/M |
| 3300009137|Ga0066709_104177053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300010104|Ga0127446_1050251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300010114|Ga0127460_1109655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1306 | Open in IMG/M |
| 3300010120|Ga0127451_1110055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
| 3300010130|Ga0127493_1084239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1041 | Open in IMG/M |
| 3300010132|Ga0127455_1121501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 772 | Open in IMG/M |
| 3300010361|Ga0126378_13056952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 533 | Open in IMG/M |
| 3300010366|Ga0126379_13185795 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300011269|Ga0137392_10065329 | All Organisms → cellular organisms → Bacteria | 2783 | Open in IMG/M |
| 3300011269|Ga0137392_11377585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300011271|Ga0137393_10694754 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300011271|Ga0137393_10958719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 729 | Open in IMG/M |
| 3300011271|Ga0137393_11593288 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300011999|Ga0120148_1032657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1109 | Open in IMG/M |
| 3300012010|Ga0120118_1119495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 635 | Open in IMG/M |
| 3300012014|Ga0120159_1203681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300012096|Ga0137389_10405488 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300012096|Ga0137389_11812748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_4_66_7 | 506 | Open in IMG/M |
| 3300012189|Ga0137388_10576359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1046 | Open in IMG/M |
| 3300012199|Ga0137383_10163912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1628 | Open in IMG/M |
| 3300012199|Ga0137383_10898930 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300012200|Ga0137382_10266670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1189 | Open in IMG/M |
| 3300012202|Ga0137363_10278104 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300012202|Ga0137363_11507685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 563 | Open in IMG/M |
| 3300012209|Ga0137379_11352355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 617 | Open in IMG/M |
| 3300012211|Ga0137377_10073868 | All Organisms → cellular organisms → Bacteria | 3196 | Open in IMG/M |
| 3300012349|Ga0137387_10371068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1037 | Open in IMG/M |
| 3300012353|Ga0137367_10275401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1207 | Open in IMG/M |
| 3300012357|Ga0137384_10372329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1182 | Open in IMG/M |
| 3300012363|Ga0137390_10643856 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300012363|Ga0137390_11979426 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012379|Ga0134058_1058581 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
| 3300012390|Ga0134054_1026530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 865 | Open in IMG/M |
| 3300012390|Ga0134054_1055223 | All Organisms → cellular organisms → Bacteria | 2937 | Open in IMG/M |
| 3300012395|Ga0134044_1117018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2505 | Open in IMG/M |
| 3300012398|Ga0134051_1202128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3036 | Open in IMG/M |
| 3300012402|Ga0134059_1360919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1511 | Open in IMG/M |
| 3300012405|Ga0134041_1031425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 533 | Open in IMG/M |
| 3300012972|Ga0134077_10510817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 533 | Open in IMG/M |
| 3300014052|Ga0120109_1037896 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300014150|Ga0134081_10211389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 663 | Open in IMG/M |
| 3300014154|Ga0134075_10339432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 657 | Open in IMG/M |
| 3300015164|Ga0167652_1090054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300017930|Ga0187825_10200341 | Not Available | 719 | Open in IMG/M |
| 3300018433|Ga0066667_11580718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 583 | Open in IMG/M |
| 3300018433|Ga0066667_12026712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 530 | Open in IMG/M |
| 3300018482|Ga0066669_10527342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1026 | Open in IMG/M |
| 3300018482|Ga0066669_12309229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
| 3300020002|Ga0193730_1062432 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300021046|Ga0215015_10479382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 882 | Open in IMG/M |
| 3300021046|Ga0215015_10695694 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300021046|Ga0215015_10804550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 690 | Open in IMG/M |
| 3300021432|Ga0210384_11644917 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300025457|Ga0208850_1081904 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300025922|Ga0207646_10000247 | All Organisms → cellular organisms → Bacteria | 73874 | Open in IMG/M |
| 3300025922|Ga0207646_10219408 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300026306|Ga0209468_1070233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1175 | Open in IMG/M |
| 3300026308|Ga0209265_1121443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 659 | Open in IMG/M |
| 3300026317|Ga0209154_1146133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 985 | Open in IMG/M |
| 3300026318|Ga0209471_1259786 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026322|Ga0209687_1033718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1666 | Open in IMG/M |
| 3300026324|Ga0209470_1310569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
| 3300026324|Ga0209470_1312146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300026326|Ga0209801_1116877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1145 | Open in IMG/M |
| 3300026330|Ga0209473_1150163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 944 | Open in IMG/M |
| 3300026334|Ga0209377_1028242 | All Organisms → cellular organisms → Bacteria | 2724 | Open in IMG/M |
| 3300026334|Ga0209377_1189327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 703 | Open in IMG/M |
| 3300026480|Ga0257177_1018293 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300026528|Ga0209378_1266012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
| 3300026552|Ga0209577_10476158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 850 | Open in IMG/M |
| 3300027633|Ga0208988_1153984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
| 3300027651|Ga0209217_1045690 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300027842|Ga0209580_10146260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1161 | Open in IMG/M |
| 3300027862|Ga0209701_10089522 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300027915|Ga0209069_10848982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300031954|Ga0306926_11207121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 888 | Open in IMG/M |
| 3300031962|Ga0307479_10992364 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300032180|Ga0307471_100375689 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.15% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.54% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.77% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_01823650 | 2124908032 | Soil | MEVLRIPFKEALEAALGGTIVHSGSVTALCRAARALKV |
| A3035W6_10222342 | 3300001359 | Permafrost | DMEVRRLPFKAALHAALDGAIAHSGSVTALVRAAHTLKLL* |
| A3035W6_13442512 | 3300001359 | Permafrost | DMEVRRLPFKEALQAALDGAIAHSGSVTALVRAAHALKLL* |
| JGI20188J14859_10252621 | 3300001418 | Arctic Peat Soil | MPFADALEAALGGTIVHSGSVTALCRASRTLKLT* |
| JGI25390J43892_100027921 | 3300002911 | Grasslands Soil | TYEQDMEVLRLPFAEALNAALEGEIVHSGSVTALCRAAQALKLL* |
| JGI25389J43894_10468042 | 3300002916 | Grasslands Soil | DMEVLRLPFAEAWSAALDGQIIHSGSVTALCRAAHALKLL* |
| Ga0062595_1008791251 | 3300004479 | Soil | RNPETYEQDMEVLRLPFTEAFEAALQGAIAHSGSVTALTRAARALKIL* |
| Ga0066672_105517551 | 3300005167 | Soil | RSPETYEQDMEVLRIPFSEALNAALEGEIVHSGSVTALCRAARALKLV* |
| Ga0066672_109501221 | 3300005167 | Soil | RSPETYEQDMEVLRVPFIEALDAALEGQIVHSGSVTALCRAARGLKLI* |
| Ga0066680_102358912 | 3300005174 | Soil | ASERNPESYEQDMEVMRLPFVDALQSALDGGIAHSGSVTSLVRAARALKLI* |
| Ga0070703_104876392 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | DRNPESYEQDMEVLRMPFADAFEAALDGTIAHSGSVTALCRAARTLKLV* |
| Ga0070714_1019901862 | 3300005435 | Agricultural Soil | YEQDMEVLRLPFAEAFEAALGGQIVHSGSVTALSRTARALKLI* |
| Ga0070708_1002560862 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AEGLTESKRTPETYEQDMEVLRLPFTEALHAALEGEIVHSGSVTALCRAARALKIL* |
| Ga0070706_1006821902 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | YEQDMEVLRLPFTEALEAAVSGEIVHAGSVIALIRAARKLTLL* |
| Ga0070706_1011059061 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVLRLPFVEALHAALDGGIAHSGSVTALVRAARALNLL* |
| Ga0070707_1001831354 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ITESARAPETYEQDMEVLRLPFTEALNAALEGQIVHSGSITALCRAARALKLI* |
| Ga0070707_1006884081 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ERNPETYEQDMEVLRLPFTDALQAALEGDIAHSGSITALTRAARALKLL* |
| Ga0070698_1017483781 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DMEVLRLPLVEALEAALDGGIAHSGSVTALVRAARALDLL* |
| Ga0070699_1004100592 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TESARAPEAYEQDMEVLRLPFTEALNAALDGQILHSGSITALCRAARTLKLL* |
| Ga0070697_1000933673 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EAYEQDMEVLRLPFVDAWHAALDGQIIHSGSVTALCRAARALKLLRPR* |
| Ga0070730_100881792 | 3300005537 | Surface Soil | EVLRLPFAEALEAALSGAIVHSGSVTALCRAARMLKVI* |
| Ga0066697_105762211 | 3300005540 | Soil | DMEVMRLPLQEALEAALSGDIGHSTSVTSLARAARALKLI* |
| Ga0070732_107374472 | 3300005542 | Surface Soil | NPETYEQDMEVLRLSFADALDAALEGEIVHSGSITALCRAARALKLL* |
| Ga0066701_104365992 | 3300005552 | Soil | RLTESERSPETYEQDMEVLRIPFSEALNAALEGEIVHSGSVTALCRAARALSLL* |
| Ga0066661_102876341 | 3300005554 | Soil | ERSPETYEQDMEVLRLPFTEALNAALEGDIVHSGSVTALCRAARALKLL* |
| Ga0066692_103689311 | 3300005555 | Soil | YEQDMEVMRLPLQEALEAALSGDIGHSTSVTSLARAARALKLI* |
| Ga0066692_106843942 | 3300005555 | Soil | SPETYEQDMEVLRLPLGEALNAALEGQIVHSGSVTALCRAARALKLL* |
| Ga0066692_108848843 | 3300005555 | Soil | GLTEAERSPETYEQDMEVLRVPFIEALDAALEGQIVHSGSVTALCRAARGLKLI* |
| Ga0066698_101597751 | 3300005558 | Soil | NPETYEQDMEVLRLPFTDALQAALEGQIVHSGSVTALCRAAHALELP* |
| Ga0066698_110639632 | 3300005558 | Soil | RQPETYEQDMEVLRIPLREAVDAALNGEIEHSGSVTSLVRAAVALNLIKF* |
| Ga0066693_100986461 | 3300005566 | Soil | MRLSLLDALNAALDGEIVHSGSVTALARAAKALRLV* |
| Ga0066693_103283291 | 3300005566 | Soil | PETYEQDMEVLRLPFAEAWSAALDGQIIHSGSVTALCRAAHALKLL* |
| Ga0066703_101255801 | 3300005568 | Soil | YEQDMEVLRLPFTEALNAALEGQIVHSGSVTALCRAARALKLL* |
| Ga0066703_101978262 | 3300005568 | Soil | YEQDMEVLRVPFIEALDAALEGQIVHSGSVTALCRAARGLKLI* |
| Ga0066705_109431281 | 3300005569 | Soil | RSPETYEQDMEVLRLPLREAIEAALAGEIAHSGSVTSLLRAASALGLISLR* |
| Ga0066706_103863042 | 3300005598 | Soil | SKQNREAYEQDMEVMRLPLQEALEAALSGDIGHSTSVTSLARAARALKLI* |
| Ga0066651_105328762 | 3300006031 | Soil | SARSPETYEQDMEVLRLPFTEALNAALEGQIVHSGSVTALCRAARAMGLL* |
| Ga0075028_1007195902 | 3300006050 | Watersheds | ERNPEAYEQDMDMLRLPFGDALQAALDGEIAHSGSVTALARAARVLKV* |
| Ga0066658_103430041 | 3300006794 | Soil | EQDMEVLRIPFSEALNAALEGEIVHSGSVTALCRAARALKLI* |
| Ga0066665_103728601 | 3300006796 | Soil | TYEQDMEVLRVPFIEALDAALEGQIVHSGSVTALCRAARGLKLI* |
| Ga0066659_101096701 | 3300006797 | Soil | PETYEQDMEVLRIPFSEALNAALEGEIVHSGSVTALCRAARALKLV* |
| Ga0066659_114918921 | 3300006797 | Soil | PETYEQDMEVLRIPFSEALNAALEGEIVHSGSVTALCRAARSLKLV* |
| Ga0075436_1014170491 | 3300006914 | Populus Rhizosphere | PEAYEQDMEVLRLPFAEALNAALEGQIVHSGSITALCRAARALKLL* |
| Ga0099793_100531181 | 3300007258 | Vadose Zone Soil | PETYEQDMVVLRLPFTEALDAALEGQIVHSGSVTALCRVGRALKVL* |
| Ga0099794_107412401 | 3300007265 | Vadose Zone Soil | DMEVLRLPFADALQAALDGEITHSGSVTALARAARALKLL* |
| Ga0066710_1015925541 | 3300009012 | Grasslands Soil | EAARQPETYEQDMEVLRIPLREAVDAALNSEIEHSGSVTSLVRAAVALNLIKF |
| Ga0099830_102945942 | 3300009088 | Vadose Zone Soil | AYEQDMEVMRLPLTEALEAALSGDIGHSTSVTSLARAARALKLI* |
| Ga0099830_111652181 | 3300009088 | Vadose Zone Soil | ERHPETYEQDMEVLRLPFTDALQAALDGEITHSGSVTALARAARALKLL* |
| Ga0099830_117801512 | 3300009088 | Vadose Zone Soil | EQDMVVLRLPFTEALDAALEGQIVHSGSVTALCRAARALEVL* |
| Ga0099828_104718931 | 3300009089 | Vadose Zone Soil | PERYEQDMEVLRTPFAEALEAAISGEIVHAGSVIALIRAARALKVL* |
| Ga0099828_113298162 | 3300009089 | Vadose Zone Soil | ETYEQDMEVLRLPFTDALQAALDGEITHSGSVTALARAARALKLL* |
| Ga0099827_108136441 | 3300009090 | Vadose Zone Soil | EQDMEVLRLPFHEALGAALDGRTVHSGSVTALCRATRALELL* |
| Ga0066709_1041770531 | 3300009137 | Grasslands Soil | TESKQNREAYEQDMEVMRLPLQEALEAALSGDIGHSTSVTSLARAARALKLI* |
| Ga0127446_10502511 | 3300010104 | Grasslands Soil | QDMEVLRLPFTDALQAALEGQIVHSGSVTALCRAAHALELP* |
| Ga0127460_11096552 | 3300010114 | Grasslands Soil | EELTESNRNPERYEQDMEVMRLPFRDALDAALEGEIMHSGSITALCRAARALTIL* |
| Ga0127451_11100552 | 3300010120 | Grasslands Soil | LRLPFTGALQAALEGQIVHSGSVTALCRAAHALELP* |
| Ga0127493_10842391 | 3300010130 | Grasslands Soil | MEVMRLPFRDALDAALEGEIMHSGSITALCRAARALTIL* |
| Ga0127455_11215011 | 3300010132 | Grasslands Soil | ERYEQDMEVMRLPFRDALDAALEGEIMHSGSITALCRAARALTIL* |
| Ga0126378_130569522 | 3300010361 | Tropical Forest Soil | LTEAARSPEAYEQDMEMLRLPFSEALDEALWGGIVHSGSVTALCRAARALKVF* |
| Ga0126379_131857951 | 3300010366 | Tropical Forest Soil | AYEQDMDVMRLPFVDALNAALSGEIVHSGSVTALCRAARALKVI* |
| Ga0137392_100653291 | 3300011269 | Vadose Zone Soil | EQDMEVRRLPFKEALQAALDGAIAHSGSVTALVRAAHALKLL* |
| Ga0137392_113775851 | 3300011269 | Vadose Zone Soil | LRLPFTEALDAALEGQIVHSGSVTALCRAARALKVL* |
| Ga0137393_106947542 | 3300011271 | Vadose Zone Soil | RLPFAEALHAALDGGIAHSGSVTALVRAARALNLL* |
| Ga0137393_109587191 | 3300011271 | Vadose Zone Soil | ERNPETYEQDMEVLRLPFKEAFEAALSGAIAHSGSVTALSRSARALKLI* |
| Ga0137393_115932881 | 3300011271 | Vadose Zone Soil | DMEVLRLPFVEALHAALDGGIAHSGSVTALVRAARALNLL* |
| Ga0120148_10326571 | 3300011999 | Permafrost | DMEVLRMPFAEALEAALDGTIVHSGSVTALCRAARTLKVL* |
| Ga0120118_11194951 | 3300012010 | Permafrost | SITQAERNPETYEQDMEVLRLTFTDALEAALSGQIAHSGSVTALSRAARALKLL* |
| Ga0120159_12036812 | 3300012014 | Permafrost | EQDMEMLRLPFAEAFEAALSGQIAHSGSVPALSRSARALKLI* |
| Ga0137389_104054881 | 3300012096 | Vadose Zone Soil | TSERKPETYEQDMEVLRLPFVEALQAALDGDIAHSGSVTCLVRAARALKVV* |
| Ga0137389_118127481 | 3300012096 | Vadose Zone Soil | ESARSPETYEQDMEVMRVPFGEALNAALEGDIVHSGSVTALCRAARALKLI* |
| Ga0137388_105763592 | 3300012189 | Vadose Zone Soil | RLPFAEALNAALEGQIVHSGSITALCRAARALRLL* |
| Ga0137383_101639122 | 3300012199 | Vadose Zone Soil | AKQNLEPYEQDMDVMRLPLTEALEAALTGDIGHSTSVTSLARAARALKLI* |
| Ga0137383_108989301 | 3300012199 | Vadose Zone Soil | RLPFVDALQSALDGGIAHSGSVTSLVRAARALKLI* |
| Ga0137382_102666702 | 3300012200 | Vadose Zone Soil | YEQDMEVLRLPFGEALHAALEGQIVHSGSVTALCRAARALKLL* |
| Ga0137363_102781041 | 3300012202 | Vadose Zone Soil | QDMEVLRLPFVEALHAALDGGIAHSGSVTALVRAARALNLL* |
| Ga0137363_115076852 | 3300012202 | Vadose Zone Soil | RLPFSEALSAALEGQIVHSGSVTALCRAARALKLI* |
| Ga0137379_113523552 | 3300012209 | Vadose Zone Soil | VLRLPFTDALQAALQGQIVHSGSVTALCRAAHALEVF* |
| Ga0137377_100738684 | 3300012211 | Vadose Zone Soil | ESARNPETYEQDMEVLRLPFTDALQAALEGQIVHSGSVTALCRAAHALELP* |
| Ga0137387_103710681 | 3300012349 | Vadose Zone Soil | QGITESARAPEAYEQDMEVLRLPMLEALRAALEGEIEHSGSVTSLARAAMALNLIQI* |
| Ga0137367_102754012 | 3300012353 | Vadose Zone Soil | LTETARSPETYEQDMEVLRLPFTEAVNAALEGQIVHSGSVTALCRAARALGLL* |
| Ga0137384_103723292 | 3300012357 | Vadose Zone Soil | QNREAYEQDMEVMRLPLQEALEAAFSGDIGHSTSVTSLARAARALRLI* |
| Ga0137390_106438562 | 3300012363 | Vadose Zone Soil | SDRNPETYEQDMEVRRLPFKAALQAALDGAIAHSGSVTALVRAAHALKLL* |
| Ga0137390_119794261 | 3300012363 | Vadose Zone Soil | RNPETYEQDMEVRRLPFKEALQAALDGAIAHSGSVTALVRAAHALKLL* |
| Ga0134058_10585811 | 3300012379 | Grasslands Soil | ETYEQDMEVLRLPFTDALQAALEGQIVHSGSVTALCRAAHALELP* |
| Ga0134054_10265302 | 3300012390 | Grasslands Soil | RSPERYEQDMEVMRLPFREALDAALEGEIMHSGSITALCRAARALTIL* |
| Ga0134054_10552233 | 3300012390 | Grasslands Soil | PETYEQDMEVLRLPFTDALQAALEGQIVHSGSVTALCRAAHALELP* |
| Ga0134044_11170183 | 3300012395 | Grasslands Soil | LRLPFTEALNAALEGQIVHSGSVTALCRAARALKLL* |
| Ga0134051_12021281 | 3300012398 | Grasslands Soil | QDMEVLRLPLTDALQAALEGQIVHSGSVTALCRAAHALELP* |
| Ga0134059_13609191 | 3300012402 | Grasslands Soil | MRLPFRDALDAALAGEIMHSGSITALCRAARALTIL* |
| Ga0134041_10314251 | 3300012405 | Grasslands Soil | LTESAPNPETYEQDMEVLRLPFTDALQAALEGQIVHSGSVTALCRAAHALELP* |
| Ga0134077_105108171 | 3300012972 | Grasslands Soil | SPERYEQDMEVMRLPFREALDAALEGEIMHSGSITALCRAARALTIL* |
| Ga0120109_10378962 | 3300014052 | Permafrost | MEVLRMPFSEALEAALDGTIAHSGSVTALCRAARRLKLI* |
| Ga0134081_102113891 | 3300014150 | Grasslands Soil | PETYEQDMEVLRLPFTEALNAALEGQIVHSGSVTALCRAARALKLL* |
| Ga0134075_103394321 | 3300014154 | Grasslands Soil | DMEVMRLPFREALDAALEGEIMHSGSITALCRAARALTIL* |
| Ga0167652_10900541 | 3300015164 | Glacier Forefield Soil | DRHPEAYEQDMEVVRLPFAEALEAALDGTIAHSGSVTALCRAARTLKLV* |
| Ga0187825_102003412 | 3300017930 | Freshwater Sediment | ARMPLQDAVAAALDGSIAHATSVTALLRAARALKLI |
| Ga0066667_115807182 | 3300018433 | Grasslands Soil | AEGLTESARNPETYEQDMEVLRLPFTHALQAALEGQIVHSGSVTALCRAAHALELP |
| Ga0066667_120267122 | 3300018433 | Grasslands Soil | AEGLTESKRSPETYEQDMEVLRLPFGEALHAALEGQIVHSGSVTALSRAARALKLL |
| Ga0066669_105273421 | 3300018482 | Grasslands Soil | KPEKYEQDMEVLRLPFREALDAALDGQIVHSGSVTALCRAARALRLS |
| Ga0066669_123092292 | 3300018482 | Grasslands Soil | EVLRLPFAEALNAALEGEIVHSGSVTALCRAARALKLL |
| Ga0193730_10624321 | 3300020002 | Soil | TQSDRNPESYEQDMEVLRMPFADALEAALDGTIAHSGSVTALCRAARTLDLV |
| Ga0215015_104793821 | 3300021046 | Soil | MEVLRLPFVDAFNAALEGQIVHSGSVTALSRAARALKLV |
| Ga0215015_106956942 | 3300021046 | Soil | MCIRDSTASDRNPETYEQDMEVRRLPFKAALQAALDGAIAHSGSVTALVRAAHALKVL |
| Ga0215015_108045501 | 3300021046 | Soil | EQDMEVLRLPFKEAFEAAMTGEIAHSGSVTALSRTARALKLI |
| Ga0210384_116449171 | 3300021432 | Soil | PESYEQDMEVLRLPFQDALEAAMSGEIAHSGSVTALSRTARALKLI |
| Ga0208850_10819042 | 3300025457 | Arctic Peat Soil | NLETYEQDMEMLRLPFIEAFEAALGGQIAHSGSVTALTRAGRFLKLI |
| Ga0207646_100002471 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ESITESARAPETYEQDMEVLRLPFTEALNAALEGQIVHSGSITALCRAARALKLL |
| Ga0207646_102194083 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ESITESARAPETYEQDMEVLRLPFTEALNAALEGQIVHSGSITALCRAARALKLI |
| Ga0209468_10702331 | 3300026306 | Soil | ESLTEAARSPETYEQDMEVLRLPFTEALNAALEGQIVHSGSVTALCRAARALKLL |
| Ga0209265_11214432 | 3300026308 | Soil | RIPFSEALNAALEGEIVHSGSVTALCRAARALKLI |
| Ga0209154_11461331 | 3300026317 | Soil | QDMEVLRVPFIEALDAALEGQIVHSGSVTALCRAARGLKLI |
| Ga0209471_12597861 | 3300026318 | Soil | VLRLPFTDALQAALEGGIAHSGSITALVRAARALKLL |
| Ga0209687_10337181 | 3300026322 | Soil | DMEVLRLPFTEALNAALEGQIVHSGSVTALCRAARALKLV |
| Ga0209470_13105691 | 3300026324 | Soil | AYEQDMEVMRLPLQEALEAALSGDIGHSTSVTSLARAARALKLI |
| Ga0209470_13121462 | 3300026324 | Soil | YEQDMEVMRLPLQEALEAALSGDIGHSTSVTSLARAARALRLI |
| Ga0209801_11168772 | 3300026326 | Soil | EDLTEAARSPETYEQDMEVLRLPFDQALSAALEGQIVHSGSVTAVCRAARALKIL |
| Ga0209473_11501631 | 3300026330 | Soil | LTESARAPETYEQDMEVLRLPFTEALNAALEGQIVHSGSVTALCRAARALKLV |
| Ga0209377_10282423 | 3300026334 | Soil | ETYEQDMEVLRLPFVEALHAALDGGIAHSGSVTALVRAARALNLL |
| Ga0209377_11893272 | 3300026334 | Soil | EVMRLPFTEALNAALEGEIVHSGSVTALCRAARALSLL |
| Ga0257177_10182931 | 3300026480 | Soil | DMEVLRLPFAEALHAALDGGIAHSGSVTALVRAARALNLL |
| Ga0209378_12660121 | 3300026528 | Soil | EVMRLPLQEALEAALSGDIGHSTSVTSLARAARALKLI |
| Ga0209577_104761582 | 3300026552 | Soil | AEELEESERSPETYEQDMEMLRLPFPEAWSAALDGQIVHSGSVTALCRAARALKLL |
| Ga0208988_11539842 | 3300027633 | Forest Soil | EVLRLSFAEAFDAALDGQIVHSGSVTALSRAARALKLI |
| Ga0209217_10456901 | 3300027651 | Forest Soil | SPETYEQDMEVLRLPFTDALQAALEGDIAHSGSITALARAARALKLL |
| Ga0209580_101462601 | 3300027842 | Surface Soil | AERSPETYEQDMEVLRLPFAEAFQAAMQGGIAHSGSVTALTRAARALKLL |
| Ga0209701_100895221 | 3300027862 | Vadose Zone Soil | TGSDRNPETYEQDMEVRRLPFKEALQAALDGAIAHSGSVTALVRAAHALKLL |
| Ga0209069_108489822 | 3300027915 | Watersheds | ESERHPETYEQDMEVLRLPFGEALQAALDGQIVHAGSVTALTRAARALKLL |
| Ga0306926_112071212 | 3300031954 | Soil | ESARSPETYEQDMEVLRLSFRDALEAALDGQIMHSGSVTALCRAARSLRLI |
| Ga0307479_109923641 | 3300031962 | Hardwood Forest Soil | DRNPETYEQDMEVLRLPFAEALHAALDGGIAHSGSVTALVRAARALNLL |
| Ga0307471_1003756892 | 3300032180 | Hardwood Forest Soil | RERSPETYEQDMEMRRLPFADALKAALDGDIAHSGSITALMRAAHALKLL |
| ⦗Top⦘ |