| Basic Information | |
|---|---|
| Family ID | F063169 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MESQLIDDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.31 % |
| % of genes near scaffold ends (potentially truncated) | 8.46 % |
| % of genes from short scaffolds (< 2000 bps) | 73.08 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.615 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (45.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.615 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF13730 | HTH_36 | 2.31 |
| PF02739 | 5_3_exonuc_N | 2.31 |
| PF08401 | ArdcN | 1.54 |
| PF07486 | Hydrolase_2 | 1.54 |
| PF03796 | DnaB_C | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 2.31 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 1.54 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 1.54 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.77 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.92 % |
| Unclassified | root | N/A | 13.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10057681 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10155321 | Not Available | 778 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10212619 | Not Available | 612 | Open in IMG/M |
| 3300001450|JGI24006J15134_10017064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 3407 | Open in IMG/M |
| 3300001450|JGI24006J15134_10049399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1729 | Open in IMG/M |
| 3300001450|JGI24006J15134_10191384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 632 | Open in IMG/M |
| 3300001460|JGI24003J15210_10010735 | All Organisms → cellular organisms → Bacteria | 3702 | Open in IMG/M |
| 3300001460|JGI24003J15210_10014016 | All Organisms → cellular organisms → Bacteria | 3170 | Open in IMG/M |
| 3300001460|JGI24003J15210_10032515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1889 | Open in IMG/M |
| 3300001472|JGI24004J15324_10037533 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| 3300001472|JGI24004J15324_10060261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1093 | Open in IMG/M |
| 3300001472|JGI24004J15324_10105968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 713 | Open in IMG/M |
| 3300001718|JGI24523J20078_1019102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 849 | Open in IMG/M |
| 3300001720|JGI24513J20088_1013879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 950 | Open in IMG/M |
| 3300002482|JGI25127J35165_1007754 | All Organisms → cellular organisms → Bacteria | 2783 | Open in IMG/M |
| 3300002482|JGI25127J35165_1009457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2493 | Open in IMG/M |
| 3300002482|JGI25127J35165_1027257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 1330 | Open in IMG/M |
| 3300002482|JGI25127J35165_1051870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 887 | Open in IMG/M |
| 3300004448|Ga0065861_1003893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1540 | Open in IMG/M |
| 3300004448|Ga0065861_1019209 | Not Available | 707 | Open in IMG/M |
| 3300004457|Ga0066224_1012102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 930 | Open in IMG/M |
| 3300004457|Ga0066224_1012136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1616 | Open in IMG/M |
| 3300004460|Ga0066222_1038373 | Not Available | 513 | Open in IMG/M |
| 3300004461|Ga0066223_1005288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1399 | Open in IMG/M |
| 3300004461|Ga0066223_1052509 | Not Available | 631 | Open in IMG/M |
| 3300005086|Ga0072334_11043559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 500 | Open in IMG/M |
| 3300006026|Ga0075478_10004009 | All Organisms → cellular organisms → Bacteria | 5241 | Open in IMG/M |
| 3300006026|Ga0075478_10013063 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
| 3300006026|Ga0075478_10232350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 557 | Open in IMG/M |
| 3300006027|Ga0075462_10049863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1331 | Open in IMG/M |
| 3300006027|Ga0075462_10221752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 565 | Open in IMG/M |
| 3300006029|Ga0075466_1043118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1357 | Open in IMG/M |
| 3300006735|Ga0098038_1011456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 3469 | Open in IMG/M |
| 3300006735|Ga0098038_1290097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 510 | Open in IMG/M |
| 3300006752|Ga0098048_1025552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1946 | Open in IMG/M |
| 3300006802|Ga0070749_10039885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2890 | Open in IMG/M |
| 3300006810|Ga0070754_10128439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 1228 | Open in IMG/M |
| 3300006810|Ga0070754_10132145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1207 | Open in IMG/M |
| 3300006868|Ga0075481_10333063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 526 | Open in IMG/M |
| 3300006919|Ga0070746_10275703 | Not Available | 779 | Open in IMG/M |
| 3300006929|Ga0098036_1150678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 711 | Open in IMG/M |
| 3300007229|Ga0075468_10058696 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300007345|Ga0070752_1177525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 861 | Open in IMG/M |
| 3300007346|Ga0070753_1230996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 676 | Open in IMG/M |
| 3300007539|Ga0099849_1037091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2067 | Open in IMG/M |
| 3300008012|Ga0075480_10423774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 652 | Open in IMG/M |
| 3300008012|Ga0075480_10517544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 573 | Open in IMG/M |
| 3300009172|Ga0114995_10225771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1037 | Open in IMG/M |
| 3300009422|Ga0114998_10221876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 895 | Open in IMG/M |
| 3300009422|Ga0114998_10335381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 707 | Open in IMG/M |
| 3300009422|Ga0114998_10527676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 554 | Open in IMG/M |
| 3300009422|Ga0114998_10623454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 508 | Open in IMG/M |
| 3300009512|Ga0115003_10512625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 702 | Open in IMG/M |
| 3300009603|Ga0114911_1157468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 635 | Open in IMG/M |
| 3300009705|Ga0115000_10100941 | Not Available | 1942 | Open in IMG/M |
| 3300009785|Ga0115001_10166090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1436 | Open in IMG/M |
| 3300009785|Ga0115001_10441727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 808 | Open in IMG/M |
| 3300010368|Ga0129324_10261602 | Not Available | 688 | Open in IMG/M |
| 3300011118|Ga0114922_11084190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 649 | Open in IMG/M |
| 3300017708|Ga0181369_1038366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 1105 | Open in IMG/M |
| 3300017709|Ga0181387_1015224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 1487 | Open in IMG/M |
| 3300017710|Ga0181403_1009103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2145 | Open in IMG/M |
| 3300017713|Ga0181391_1033197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1252 | Open in IMG/M |
| 3300017713|Ga0181391_1131865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 557 | Open in IMG/M |
| 3300017719|Ga0181390_1037843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 1473 | Open in IMG/M |
| 3300017720|Ga0181383_1122351 | Not Available | 698 | Open in IMG/M |
| 3300017725|Ga0181398_1030373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1329 | Open in IMG/M |
| 3300017735|Ga0181431_1013709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1917 | Open in IMG/M |
| 3300017735|Ga0181431_1117407 | Not Available | 594 | Open in IMG/M |
| 3300017735|Ga0181431_1155087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 508 | Open in IMG/M |
| 3300017755|Ga0181411_1040137 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300017759|Ga0181414_1090647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 807 | Open in IMG/M |
| 3300017763|Ga0181410_1023137 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300017764|Ga0181385_1085295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 970 | Open in IMG/M |
| 3300017765|Ga0181413_1057974 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300017765|Ga0181413_1258231 | Not Available | 512 | Open in IMG/M |
| 3300017769|Ga0187221_1221081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 542 | Open in IMG/M |
| 3300017782|Ga0181380_1013571 | All Organisms → cellular organisms → Bacteria | 3097 | Open in IMG/M |
| 3300017783|Ga0181379_1008279 | All Organisms → cellular organisms → Bacteria | 4416 | Open in IMG/M |
| 3300017783|Ga0181379_1215330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 670 | Open in IMG/M |
| 3300017786|Ga0181424_10181025 | Not Available | 898 | Open in IMG/M |
| 3300017786|Ga0181424_10298045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 669 | Open in IMG/M |
| 3300021335|Ga0213867_1032727 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300022071|Ga0212028_1001162 | All Organisms → cellular organisms → Bacteria | 2707 | Open in IMG/M |
| 3300022071|Ga0212028_1005981 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300022187|Ga0196899_1009076 | All Organisms → cellular organisms → Bacteria | 4013 | Open in IMG/M |
| 3300022187|Ga0196899_1011096 | All Organisms → cellular organisms → Bacteria | 3550 | Open in IMG/M |
| 3300022187|Ga0196899_1044532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1485 | Open in IMG/M |
| 3300025048|Ga0207905_1001122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5844 | Open in IMG/M |
| 3300025048|Ga0207905_1004109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2829 | Open in IMG/M |
| 3300025070|Ga0208667_1013604 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300025071|Ga0207896_1004306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 2629 | Open in IMG/M |
| 3300025120|Ga0209535_1013200 | All Organisms → cellular organisms → Bacteria | 4512 | Open in IMG/M |
| 3300025120|Ga0209535_1085279 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300025127|Ga0209348_1000655 | Not Available | 17621 | Open in IMG/M |
| 3300025127|Ga0209348_1007176 | All Organisms → cellular organisms → Bacteria | 4653 | Open in IMG/M |
| 3300025127|Ga0209348_1012490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 3344 | Open in IMG/M |
| 3300025127|Ga0209348_1029718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1970 | Open in IMG/M |
| 3300025127|Ga0209348_1031165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 1912 | Open in IMG/M |
| 3300025132|Ga0209232_1017545 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
| 3300025137|Ga0209336_10030567 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300025137|Ga0209336_10116293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 738 | Open in IMG/M |
| 3300025138|Ga0209634_1043014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2286 | Open in IMG/M |
| 3300025138|Ga0209634_1059583 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300025138|Ga0209634_1167324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 877 | Open in IMG/M |
| 3300025138|Ga0209634_1289608 | Not Available | 569 | Open in IMG/M |
| 3300025168|Ga0209337_1018809 | All Organisms → cellular organisms → Bacteria | 4079 | Open in IMG/M |
| 3300025168|Ga0209337_1154612 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300025168|Ga0209337_1241516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 699 | Open in IMG/M |
| 3300025168|Ga0209337_1314169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 558 | Open in IMG/M |
| 3300025508|Ga0208148_1035803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 1306 | Open in IMG/M |
| 3300025610|Ga0208149_1154481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 522 | Open in IMG/M |
| 3300025645|Ga0208643_1115701 | Not Available | 717 | Open in IMG/M |
| 3300025652|Ga0208134_1053410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 1270 | Open in IMG/M |
| 3300025853|Ga0208645_1031916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2725 | Open in IMG/M |
| 3300025853|Ga0208645_1157437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 856 | Open in IMG/M |
| 3300027687|Ga0209710_1014889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 4253 | Open in IMG/M |
| 3300027687|Ga0209710_1070356 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300027687|Ga0209710_1296966 | Not Available | 502 | Open in IMG/M |
| 3300027791|Ga0209830_10048043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2278 | Open in IMG/M |
| 3300027791|Ga0209830_10077597 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300028125|Ga0256368_1066483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 621 | Open in IMG/M |
| 3300029448|Ga0183755_1011780 | All Organisms → Viruses → Predicted Viral | 3362 | Open in IMG/M |
| 3300029448|Ga0183755_1019059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2329 | Open in IMG/M |
| 3300029787|Ga0183757_1006007 | All Organisms → cellular organisms → Bacteria | 3949 | Open in IMG/M |
| 3300031621|Ga0302114_10062120 | All Organisms → Viruses → Predicted Viral | 1807 | Open in IMG/M |
| 3300031622|Ga0302126_10230254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 648 | Open in IMG/M |
| 3300031626|Ga0302121_10003396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 6722 | Open in IMG/M |
| 3300032373|Ga0316204_10779001 | Not Available | 688 | Open in IMG/M |
| 3300033742|Ga0314858_142328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 615 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 45.38% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.54% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.92% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 5.38% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.31% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.31% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.54% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.77% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.77% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.77% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.77% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.77% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100576813 | 3300000116 | Marine | MQSQLIDDILKHLDEFEKTGDWFHFSLALDALDDLKREIES* |
| DelMOSpr2010_101553214 | 3300000116 | Marine | MQGQLIDEVLQHLDEFEKTGDWYHFSLALDALDDLKKQIESI* |
| DelMOSpr2010_102126191 | 3300000116 | Marine | MQRQLIDDILQHLDEFEKTGDWYHFSLALDALDDLKKQIESI* |
| JGI24006J15134_100170642 | 3300001450 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKREIES* |
| JGI24006J15134_100493995 | 3300001450 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKKQIESI* |
| JGI24006J15134_101913842 | 3300001450 | Marine | MQRELIDDILRHLDKFENTGDWYHFSLALDALDDLKREIENQ* |
| JGI24003J15210_100107357 | 3300001460 | Marine | MQSELINDIVQYLESFEKTGDWFHFSLALDALDDLKREIENQ* |
| JGI24003J15210_100140163 | 3300001460 | Marine | MQRQLINDIVQHLESFERTGDWYHFSLALDALEDLKREIENQ* |
| JGI24003J15210_100325152 | 3300001460 | Marine | MQRELIEDILKYLDKFEKTGDWFHFSLALDALDDLKKQIESI* |
| JGI24004J15324_100375332 | 3300001472 | Marine | MQSELINEVLQCLDKFEKTGDWYHFSLALDALDDLKREIENH* |
| JGI24004J15324_100602613 | 3300001472 | Marine | MQSQLIDDILQHLDKFENTGDWFHFSLALDALDDLKKQIESI* |
| JGI24004J15324_101059682 | 3300001472 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALXALDDLKREIES* |
| JGI24523J20078_10191021 | 3300001718 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKREIE |
| JGI24513J20088_10138791 | 3300001720 | Marine | MQGQLIDDILRHLDKFEKTGDWFHFSLALDALDDLKKQIESI* |
| JGI25127J35165_10077545 | 3300002482 | Marine | MESQLIDDILKHLNEFEKTGDWFHFSLALDALDDLKKQIESNNNEK* |
| JGI25127J35165_10094573 | 3300002482 | Marine | MESQLIEDVLRYLDEFEKTGDWYHFSLALDALDDLKNKIENN* |
| JGI25127J35165_10272574 | 3300002482 | Marine | MESQLIDDVLRYLDEFEKTGDWYHFSLALDALDDLKNEIENN* |
| JGI25127J35165_10518703 | 3300002482 | Marine | MQSQLIDDVLRYLDQFEKTGDWFHFSLALDALDDLKNEIESNNNE* |
| Ga0065861_10038932 | 3300004448 | Marine | MQSELIDEVLRHLDKFENTGDWFHFSLALDALDDLKKQIESI* |
| Ga0065861_10192091 | 3300004448 | Marine | ECIKMQRELIEDILKYLDKFEKTGDWFHFSLALDALDDLKRAIENE* |
| Ga0066224_10121022 | 3300004457 | Marine | MQRELIEDILKYLDKFEKTGDWFHFSLALDALDDLKRAIENE* |
| Ga0066224_10121364 | 3300004457 | Marine | MQRELIDDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESI* |
| Ga0066222_10383731 | 3300004460 | Marine | MQSELINEVLQCLDKFEKTGDWFHFSLALDALDDLKRAIENE* |
| Ga0066223_10052882 | 3300004461 | Marine | MQSQLISDIVQYLESFERTGDWFHFSLALDALDDLKREIENQ* |
| Ga0066223_10525091 | 3300004461 | Marine | MQRQLINDIVQYLESFERTGDWFHFSLALDALDDLKREIENQ* |
| Ga0072334_110435592 | 3300005086 | Water | MQSQLIDDILKHLDEFEKTGDWFHFSLALDALDDLKKEIESIIK* |
| Ga0075478_100040097 | 3300006026 | Aqueous | MQSQLIDDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESNNNE* |
| Ga0075478_100130634 | 3300006026 | Aqueous | MQSELINEVLQCLDKFEKTGDWFHFSLALNALDDLKRAIENE* |
| Ga0075478_102323502 | 3300006026 | Aqueous | MESQLIDDILSHLDQFEKTGDWFHFSLALDALDDLKKQIKSNNNE* |
| Ga0075462_100498632 | 3300006027 | Aqueous | MESQLIDDILSHLDKFEKTGDWFHFSLALDALDDLKKQIESNNNE* |
| Ga0075462_102217522 | 3300006027 | Aqueous | MQGQLIDEVLQHLDKFENTGDWYHFSLALDALDDLKREIENQ* |
| Ga0075466_10431182 | 3300006029 | Aqueous | MESQLINDIVQYLESFERTGDWFHFSLALDALDDLKREIENQ* |
| Ga0098038_10114567 | 3300006735 | Marine | MENQLIDDILRHLNEFEKTGDWFYFSLALDALDDLKKEIENN* |
| Ga0098038_12900972 | 3300006735 | Marine | MESQLIDDILSHLDEFEKTGDWFHFSLALDALDDLKKEIENN* |
| Ga0098048_10255524 | 3300006752 | Marine | MQSELINEVLQCLDKFEKTGDWFHFSLALDALDDLKRAIENA* |
| Ga0070749_100398857 | 3300006802 | Aqueous | MESQLIDDILSHLDKFEKTGDWFYFSLALDALDDLKKQIKSNNNE* |
| Ga0070754_101284392 | 3300006810 | Aqueous | MQNQLIDDILSHLDKFEKTGDWFHFSLALDALDDLKKEIENN* |
| Ga0070754_101321452 | 3300006810 | Aqueous | MESELIEDILKHLDEFEKTGDWFHFSLALDALDDLKREIENQ* |
| Ga0075481_103330632 | 3300006868 | Aqueous | MESQLIDDILSHLDKFEKTGDWFYFSLALDALDDLKNEIESNNNG* |
| Ga0070746_102757031 | 3300006919 | Aqueous | ISLMESQLIDDILSHLDQFEKTGDWFQFSLALDALDDLRKEIENN* |
| Ga0098036_11506783 | 3300006929 | Marine | MESQLIDDILSHLDEFEKTGDWFHFSLALDALDDLKIKIESNNNE* |
| Ga0075468_100586963 | 3300007229 | Aqueous | MESQLINEVLQCLDKFEKTGDWFHFSLALDALDDLKRAIENE* |
| Ga0070752_11775254 | 3300007345 | Aqueous | MQSQLIDDILSHLDQFEKTGDWFHFSLALDALDDLKKQIKSNNNE* |
| Ga0070753_12309962 | 3300007346 | Aqueous | MESELIEDILQHLDEFEKTGDWFHFSLALDALDDLKREIENQ* |
| Ga0099849_10370917 | 3300007539 | Aqueous | MQSELIDEVLRHLDKFENTGDWFHFSLALDALDDLKREIENQ* |
| Ga0075480_104237743 | 3300008012 | Aqueous | MQRQLIDDILQQLDEFEKTGDWFHFSLALDALDDLKREIES* |
| Ga0075480_105175442 | 3300008012 | Aqueous | MESQLIDDILSHLDNFEKTGDWFHVSLALDALDDLKREIENQ* |
| Ga0114995_102257712 | 3300009172 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKRKIENA* |
| Ga0114998_102218762 | 3300009422 | Marine | MQSQLIDEVLQHLDKFENTGDWYHFSLALDALDDLKREIENQ* |
| Ga0114998_103353812 | 3300009422 | Marine | MQGELIEDILKYLDKFEKTGDWFHFSLALDALDDLKREIENQ* |
| Ga0114998_105276761 | 3300009422 | Marine | MQSELIDEVLRHLDKFENTGDWFHFSLALDALDDLKREIES* |
| Ga0114998_106234542 | 3300009422 | Marine | MQKQLINEVLQCLDKFEKTGDWFHFSLALDALDDLKREIENA* |
| Ga0115003_105126253 | 3300009512 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKKQIES* |
| Ga0114911_11574682 | 3300009603 | Deep Ocean | MESQLIDDILSHLDKFEKTGDWFHFSLALDALDDLKNEIESI* |
| Ga0115000_101009418 | 3300009705 | Marine | MQSQLIDEVLQHLDKFENTGDWYHFSLALDALDDLKKQIESI* |
| Ga0115001_101660904 | 3300009785 | Marine | MQRQLINDILSHLNKFEKTGDWFHFSLALDALDDLKREIAS* |
| Ga0115001_104417272 | 3300009785 | Marine | MQKQLINEVLQCLDKFEKTGDWFHFSLALDALDDLKKQI |
| Ga0129324_102616023 | 3300010368 | Freshwater To Marine Saline Gradient | MQRQLIDDILKHLDKFEKTGDWFHFSLALDALDDLKKQIKSNNNE* |
| Ga0114922_110841902 | 3300011118 | Deep Subsurface | MQRELIEDILQHLDEFEKTGDWFHFSLALDALDDLKREIENQ* |
| Ga0181369_10383665 | 3300017708 | Marine | MESELIDDILKHLDEFEKTGDWFHFSLALDALDDLKTKIESI |
| Ga0181387_10152242 | 3300017709 | Seawater | MQSQLINDIAQYLESFERTGDWFHFSLALDALDDLKREIENQ |
| Ga0181403_10091036 | 3300017710 | Seawater | MQRQLINDIVQYLESFERTGDWFHFSLALDALDDLKREIENQ |
| Ga0181391_10331974 | 3300017713 | Seawater | MQGELIEDILKYLDKFEKTGDWYHFSLALDALDDLKREIENH |
| Ga0181391_11318652 | 3300017713 | Seawater | MQRQLIDDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESNNNE |
| Ga0181390_10378436 | 3300017719 | Seawater | MESELIEDILQHLDKFENTGDWYHFSLALDALDDLKKQIESI |
| Ga0181383_11223512 | 3300017720 | Seawater | MESELIEDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0181398_10303732 | 3300017725 | Seawater | MQSELIDEVLQHLDEFEKTGDWYHFSLALDALDDLKRKIENQ |
| Ga0181431_10137093 | 3300017735 | Seawater | MQRQLIEDILQHLDEFEKTGDWFHFSLALDALDDLKREIES |
| Ga0181431_11174071 | 3300017735 | Seawater | SELIEDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0181431_11550872 | 3300017735 | Seawater | MDSELIEDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0181411_10401372 | 3300017755 | Seawater | MQSQLIDDILQHLDEFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0181414_10906473 | 3300017759 | Seawater | MKSQLIDDILSHLDKFEKTGDWFHFSLALDALDDLRKEIESI |
| Ga0181410_10231374 | 3300017763 | Seawater | MESELIEDILQHLDKFENTGDWFHFSLALDALDDLKKQIESNNNE |
| Ga0181385_10852952 | 3300017764 | Seawater | MESQLIDDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0181413_10579742 | 3300017765 | Seawater | MESELIEDILQHLDKFENTGDWFHFSLALDTLDDLKKQIESNNNE |
| Ga0181413_12582312 | 3300017765 | Seawater | IDDILQHLDKFENTGDWYHFSLALDALDDLKREFENQ |
| Ga0187221_12210812 | 3300017769 | Seawater | MQSQLIDDILRHLDQFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0181380_10135713 | 3300017782 | Seawater | MESELIEDILQHLDKFENTGDWYHFSLALDALDDLKKQIESNNNE |
| Ga0181379_10082795 | 3300017783 | Seawater | MQSQLIDDILRHLDQFEKTGDWFHFSLALDALDDLKIEIENQ |
| Ga0181379_12153302 | 3300017783 | Seawater | MESELIEDILQHLDKCEKTGDWFNFSLALDALDDLKREIENH |
| Ga0181424_101810251 | 3300017786 | Seawater | QRQLIEDILQHLDKFEKTGDWFHFSLALDALDDLKREIENQ |
| Ga0181424_102980452 | 3300017786 | Seawater | MQSELINEVLQCLDKFEKTGDWYHFSLALDALDDLKKAIENA |
| Ga0213867_10327273 | 3300021335 | Seawater | MQRQLIDDILKHLDKFEKTGDWFHFSLALDALDDLKKQIESIIK |
| Ga0212028_10011625 | 3300022071 | Aqueous | MQSQLIDDILQHLDEFEKTGDWFHFSLALDALDDLKKQIESNNNE |
| Ga0212028_10059812 | 3300022071 | Aqueous | MQSELINEVLQCLDKFEKTGDWFHFSLALNALDDLKRAIENE |
| Ga0196899_10090767 | 3300022187 | Aqueous | MQSQLIDDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESNNNE |
| Ga0196899_10110964 | 3300022187 | Aqueous | MQGQLIDEVLQHLDKFENTGDWYHFSLALDALDDLKREIENQ |
| Ga0196899_10445324 | 3300022187 | Aqueous | MESQLIDDILSHLDQFEKTGDWFHFSLALDALDDLKKQIKSNNNE |
| Ga0207905_100112214 | 3300025048 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKREIES |
| Ga0207905_10041098 | 3300025048 | Marine | MQRELIEDILKYLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0208667_10136042 | 3300025070 | Marine | MQSELINEVLQCLDKFEKTGDWFHFSLALDALDDLKRAIENA |
| Ga0207896_10043062 | 3300025071 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0209535_10132008 | 3300025120 | Marine | MQSELINDIVQYLESFEKTGDWFHFSLALDALDDLKREIENQ |
| Ga0209535_10852792 | 3300025120 | Marine | MQSELIEDILKYLDKFEKTGDWFHFSLALDALDDLKRKIENQ |
| Ga0209348_10006554 | 3300025127 | Marine | MESQLIDDILSHLDEFEKTGDWFHFSLALDALDDLKKQIESIIK |
| Ga0209348_10071766 | 3300025127 | Marine | MESQLIDDILKHLNEFEKTGDWFHFSLALDALDDLKKQIESNNNEK |
| Ga0209348_10124904 | 3300025127 | Marine | MESQLIDDILSHLDEFEKTGDWFHFSLALDALDDLRKEIESIIK |
| Ga0209348_10297182 | 3300025127 | Marine | MESQLIEDVLRYLDEFEKTGDWYHFSLALDALDDLKNKIENN |
| Ga0209348_10311652 | 3300025127 | Marine | MESQLIDDVLRYLDEFEKTGDWYHFSLALDALDDLKNEIENN |
| Ga0209232_10175457 | 3300025132 | Marine | MESQLIDDILSHLDKFEKTGDWFHFSLALDALDDLKNKIESI |
| Ga0209336_100305672 | 3300025137 | Marine | MQSELINEVLQCLDKFEKTGDWYHFSLALDALDDLKREIENH |
| Ga0209336_101162933 | 3300025137 | Marine | MQSQLIDDILQHLDKFENTGDWFHFSLALDALDDLKKQIESI |
| Ga0209634_10430142 | 3300025138 | Marine | VFTKMQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKREIES |
| Ga0209634_10595834 | 3300025138 | Marine | MQGQLIDDILRHLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0209634_11673242 | 3300025138 | Marine | MQSQLISDIVQYLESFERTGDWFHFSLALDALDDLKREIENQ |
| Ga0209634_12896081 | 3300025138 | Marine | MQRELIEDILQYLESFERTGDWFHFSLALDALDDLKREFENQ |
| Ga0209337_10188095 | 3300025168 | Marine | MQSELINDIVQHLESFERTGDWFHFSLALDALDDLKSEIENQ |
| Ga0209337_11546121 | 3300025168 | Marine | MQGELIEDILKYLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0209337_12415161 | 3300025168 | Marine | MQRELIDDILRHLDKFENTGDWYHFSLALDALDDLKREIENQ |
| Ga0209337_13141692 | 3300025168 | Marine | MQRELIEDILKYLDKFEKTGDWFHFSLALDALDDL |
| Ga0208148_10358032 | 3300025508 | Aqueous | MQSELINEVLQCLDKFEKTGDWFHFSLALDALDDLKRAIENE |
| Ga0208149_11544812 | 3300025610 | Aqueous | MESQLIDDILSHLDKFEKTGDWFYFSLALDALDDLKKQIKSNNNE |
| Ga0208643_11157013 | 3300025645 | Aqueous | DDILQHLDKFEKTGDWFHFSLALDALDDLKRAIENE |
| Ga0208134_10534102 | 3300025652 | Aqueous | MESQLINEVLQCLDKFEKTGDWFHFSLALDALDDLKRAIENE |
| Ga0208645_10319166 | 3300025853 | Aqueous | MESQLIDDILSHLDKFEKTGDWFYFSLALDALDDLKNEIESNNNG |
| Ga0208645_11574372 | 3300025853 | Aqueous | MESELIEDILKHLDEFEKTGDWFHFSLALDALDDLKREIENQ |
| Ga0209710_10148893 | 3300027687 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKRKIENA |
| Ga0209710_10703562 | 3300027687 | Marine | MQSQLIDEVLQHLDKFENTGDWYHFSLALDALDDLKREIENQ |
| Ga0209710_12969663 | 3300027687 | Marine | MQRELIDDILQHLDKFEKTGDWFHFSLALDALDDLKKQIESI |
| Ga0209830_100480431 | 3300027791 | Marine | MQGELIEDILKYLDKFEKTGDWFHFSLALDALDDL |
| Ga0209830_100775974 | 3300027791 | Marine | MQSELIDEVLRHLDKFENTGDWFHFSLALDALDDLKREIES |
| Ga0256368_10664832 | 3300028125 | Sea-Ice Brine | MQRELIEDILKHLDEFENTGDWFHFSLALDALDDLKKQIESINE |
| Ga0183755_10117807 | 3300029448 | Marine | MESQLIDDILSHLDKFEKTGDWFHFSLALDALDDLKNEIESI |
| Ga0183755_10190593 | 3300029448 | Marine | MESQLIDDILQHLDEFEKTGDWFHFSLALDALDDLKNEIES |
| Ga0183757_10060075 | 3300029787 | Marine | MESQLIDDILQHLDEFEKTGDWFHFSLALDALDDLKREIENQ |
| Ga0302114_100621202 | 3300031621 | Marine | MQSELIDEVLRHLDKFEKTGDWFHFSLALDALDDLKKQIES |
| Ga0302126_102302542 | 3300031622 | Marine | MQSELIEDILKYLDKFEKTGDWFHFSLALDALDDLKKQIESIIK |
| Ga0302121_100033967 | 3300031626 | Marine | MQSELIEDILKYLDKFEKTGDWFHFSLALDALDDLKREIENQ |
| Ga0316204_107790013 | 3300032373 | Microbial Mat | MQSELIDEVLRHLDKFENTGDWFHFSLALDALDDLKREIENQ |
| Ga0314858_142328_153_281 | 3300033742 | Sea-Ice Brine | MQSELINDIVQHLESFERTGDWFHFSLALDALDDLKRKIENQ |
| ⦗Top⦘ |