| Basic Information | |
|---|---|
| Family ID | F063110 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MRDTGWLIVAIVTGVLAAVGWIARERWIMRRRRRR |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.77 % |
| % of genes near scaffold ends (potentially truncated) | 17.69 % |
| % of genes from short scaffolds (< 2000 bps) | 78.46 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.923 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.615 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.077 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.077 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.21% β-sheet: 0.00% Coil/Unstructured: 50.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF02558 | ApbA | 48.46 |
| PF13493 | DUF4118 | 22.31 |
| PF08546 | ApbA_C | 9.23 |
| PF01925 | TauE | 2.31 |
| PF00989 | PAS | 1.54 |
| PF01557 | FAA_hydrolase | 1.54 |
| PF02515 | CoA_transf_3 | 1.54 |
| PF09976 | TPR_21 | 0.77 |
| PF08448 | PAS_4 | 0.77 |
| PF00795 | CN_hydrolase | 0.77 |
| PF00483 | NTP_transferase | 0.77 |
| PF07589 | PEP-CTERM | 0.77 |
| PF13350 | Y_phosphatase3 | 0.77 |
| PF13492 | GAF_3 | 0.77 |
| PF00378 | ECH_1 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 9.23 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 2.31 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.92 % |
| Unclassified | root | N/A | 13.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0738894 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300000550|F24TB_10464066 | All Organisms → cellular organisms → Bacteria | 3427 | Open in IMG/M |
| 3300000891|JGI10214J12806_10237996 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300000891|JGI10214J12806_11628596 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300000956|JGI10216J12902_109125099 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300001431|F14TB_101845843 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300002122|C687J26623_10034508 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300003349|JGI26129J50193_1001097 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300003371|JGI26145J50221_1021990 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005340|Ga0070689_101517500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300005529|Ga0070741_10000675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 117362 | Open in IMG/M |
| 3300005536|Ga0070697_100140873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2028 | Open in IMG/M |
| 3300005543|Ga0070672_100143106 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300005713|Ga0066905_100030352 | Not Available | 3054 | Open in IMG/M |
| 3300005844|Ga0068862_100140000 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300005875|Ga0075293_1003746 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300005878|Ga0075297_1018533 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005937|Ga0081455_10002470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 21980 | Open in IMG/M |
| 3300005937|Ga0081455_10226716 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300006163|Ga0070715_10702032 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300006755|Ga0079222_10121271 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300006806|Ga0079220_10260220 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300006806|Ga0079220_10305738 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300006806|Ga0079220_11960346 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006845|Ga0075421_100823887 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300006846|Ga0075430_101809813 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006847|Ga0075431_101152651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella → Fischerella sp. PCC 9605 | 739 | Open in IMG/M |
| 3300006852|Ga0075433_10054732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3481 | Open in IMG/M |
| 3300006852|Ga0075433_10725757 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300006854|Ga0075425_100264444 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300006854|Ga0075425_101143893 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300006871|Ga0075434_100246677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1805 | Open in IMG/M |
| 3300006954|Ga0079219_10660779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
| 3300007255|Ga0099791_10311306 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300007265|Ga0099794_10758032 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009038|Ga0099829_10134265 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300009038|Ga0099829_10924534 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300009053|Ga0105095_10282261 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300009090|Ga0099827_10321476 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300009147|Ga0114129_10089947 | All Organisms → cellular organisms → Bacteria | 4255 | Open in IMG/M |
| 3300009147|Ga0114129_10317513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2072 | Open in IMG/M |
| 3300009147|Ga0114129_12118352 | Not Available | 678 | Open in IMG/M |
| 3300009162|Ga0075423_11865600 | Not Available | 649 | Open in IMG/M |
| 3300009176|Ga0105242_13321515 | Not Available | 500 | Open in IMG/M |
| 3300010362|Ga0126377_10611754 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300010362|Ga0126377_11084762 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300010362|Ga0126377_11684388 | Not Available | 709 | Open in IMG/M |
| 3300010371|Ga0134125_13088356 | Not Available | 504 | Open in IMG/M |
| 3300010397|Ga0134124_12174248 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300010399|Ga0134127_10267244 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300011419|Ga0137446_1012496 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300011433|Ga0137443_1254474 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300011436|Ga0137458_1020637 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300011442|Ga0137437_1121600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 898 | Open in IMG/M |
| 3300012133|Ga0137329_1051967 | Not Available | 537 | Open in IMG/M |
| 3300012203|Ga0137399_10669693 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300012927|Ga0137416_10045225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3048 | Open in IMG/M |
| 3300012929|Ga0137404_10356325 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300012931|Ga0153915_10187340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2265 | Open in IMG/M |
| 3300012931|Ga0153915_10576863 | Not Available | 1291 | Open in IMG/M |
| 3300012931|Ga0153915_10903826 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300012984|Ga0164309_11642987 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300013308|Ga0157375_11494151 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300014318|Ga0075351_1124832 | Not Available | 584 | Open in IMG/M |
| 3300014745|Ga0157377_11256891 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300014884|Ga0180104_1164827 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300015371|Ga0132258_10372593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3538 | Open in IMG/M |
| 3300015371|Ga0132258_11205045 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300017927|Ga0187824_10032022 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300017927|Ga0187824_10068834 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300017930|Ga0187825_10140609 | Not Available | 850 | Open in IMG/M |
| 3300017939|Ga0187775_10065157 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300017993|Ga0187823_10097396 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300017997|Ga0184610_1005960 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
| 3300018028|Ga0184608_10111447 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300018031|Ga0184634_10153604 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300018032|Ga0187788_10546327 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018053|Ga0184626_10012668 | All Organisms → cellular organisms → Bacteria | 3324 | Open in IMG/M |
| 3300018054|Ga0184621_10070795 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300018063|Ga0184637_10068077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2179 | Open in IMG/M |
| 3300018063|Ga0184637_10579298 | Not Available | 639 | Open in IMG/M |
| 3300018074|Ga0184640_10104279 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300018076|Ga0184609_10486630 | Not Available | 563 | Open in IMG/M |
| 3300018084|Ga0184629_10103093 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300018422|Ga0190265_10016006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5833 | Open in IMG/M |
| 3300018422|Ga0190265_10056069 | All Organisms → cellular organisms → Bacteria | 3470 | Open in IMG/M |
| 3300018422|Ga0190265_11091940 | Not Available | 918 | Open in IMG/M |
| 3300018422|Ga0190265_13412148 | Not Available | 530 | Open in IMG/M |
| 3300019360|Ga0187894_10055808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2288 | Open in IMG/M |
| 3300019878|Ga0193715_1119978 | Not Available | 509 | Open in IMG/M |
| 3300019882|Ga0193713_1045467 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300020003|Ga0193739_1096818 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300020022|Ga0193733_1172739 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300020170|Ga0179594_10131325 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300021078|Ga0210381_10064204 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1132 | Open in IMG/M |
| 3300021178|Ga0210408_10422474 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300023066|Ga0247793_1082917 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300023102|Ga0247754_1063184 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300025160|Ga0209109_10425090 | Not Available | 615 | Open in IMG/M |
| 3300025911|Ga0207654_10939480 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300025916|Ga0207663_10078538 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2152 | Open in IMG/M |
| 3300027383|Ga0209213_1036278 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300027388|Ga0208995_1078759 | Not Available | 577 | Open in IMG/M |
| 3300027650|Ga0256866_1114780 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300027882|Ga0209590_10647821 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300028536|Ga0137415_10143656 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
| 3300028592|Ga0247822_10402771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1067 | Open in IMG/M |
| 3300028792|Ga0307504_10160200 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300028792|Ga0307504_10244522 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300028792|Ga0307504_10282248 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300028792|Ga0307504_10477003 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300028803|Ga0307281_10217121 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300028828|Ga0307312_10188335 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300028828|Ga0307312_10415449 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300028878|Ga0307278_10174345 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10024800 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10071290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 917 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1023816 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300031720|Ga0307469_11187939 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031962|Ga0307479_10001888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19146 | Open in IMG/M |
| 3300032174|Ga0307470_10018555 | All Organisms → cellular organisms → Bacteria | 3078 | Open in IMG/M |
| 3300032180|Ga0307471_100007830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6920 | Open in IMG/M |
| 3300032180|Ga0307471_103429894 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300033233|Ga0334722_10101246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2188 | Open in IMG/M |
| 3300033412|Ga0310810_10007885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12202 | Open in IMG/M |
| 3300033432|Ga0326729_1002087 | All Organisms → cellular organisms → Bacteria | 4178 | Open in IMG/M |
| 3300033433|Ga0326726_10119210 | All Organisms → cellular organisms → Bacteria | 2381 | Open in IMG/M |
| 3300033433|Ga0326726_11159026 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300033513|Ga0316628_100113794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3073 | Open in IMG/M |
| 3300034155|Ga0370498_014913 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.08% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.31% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 2.31% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.54% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.54% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.54% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.77% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.77% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.77% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.77% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Host-Associated | Open in IMG/M |
| 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_07388941 | 2228664021 | Soil | GSSAGRRGRAMRELGWLAVAVVVGVLAAVGWVARERWIMRRRRR |
| F24TB_104640662 | 3300000550 | Soil | VRDLAWLVIAVVAGVLAVVGWVARERWLMRRRRRR* |
| JGI10214J12806_102379961 | 3300000891 | Soil | GRAMRELGWLAVAVVVGVLAAVGWVARERWIMRRRRR* |
| JGI10214J12806_116285961 | 3300000891 | Soil | VQPKGATMGDTGWLIVAIVTGVLAVVGWIARERWIMRRRRRR* |
| JGI10216J12902_1091250992 | 3300000956 | Soil | LMRDLVWLVVAVVAGVLAAVGWIARERWLMRRRRQR* |
| F14TB_1018458432 | 3300001431 | Soil | VRDLAWLVVAVVAGVLAVVGWVARERWLMRRRRRR* |
| C687J26623_100345082 | 3300002122 | Soil | MSETGWLVVAIVAGVLAAVGWVARERWIMRRRRRR* |
| JGI26129J50193_10010972 | 3300003349 | Arabidopsis Thaliana Rhizosphere | VWTAVRDLVWLVVAVVAGALAVVGWVARERWVMKRRRRX* |
| JGI26145J50221_10219901 | 3300003371 | Arabidopsis Thaliana Rhizosphere | VWTAVRDLVWLVVAVVAGALAVVGWVARERWVMKRRRRR* |
| Ga0070689_1015175001 | 3300005340 | Switchgrass Rhizosphere | KVDSGSSAGRRGRAMRELVWLAVAVVVGVLAAVGWVARERWIMRRRRR* |
| Ga0070741_1000067532 | 3300005529 | Surface Soil | MREVGWLVLAIVVGILAAVGWVARERWIMRRRRR* |
| Ga0070697_1001408733 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EERMETMRDVAWLIVAVVVGILAAWGWLARERWIMRRRR* |
| Ga0070672_1001431062 | 3300005543 | Miscanthus Rhizosphere | MRELGWLAVAVVVGVLAAVGWVARERWIMRRRRR* |
| Ga0066905_1000303522 | 3300005713 | Tropical Forest Soil | VRDLAWLVIAVVAGVLAVVGWVARERWLMRRRGRR* |
| Ga0068862_1001400003 | 3300005844 | Switchgrass Rhizosphere | MGDTGWLIVAIVTGVLAAVGWIARERWIIRRRRR* |
| Ga0075293_10037462 | 3300005875 | Rice Paddy Soil | VRDLGWLLVAVVAGLLAAVGWIARERWIMRRRRR* |
| Ga0075297_10185332 | 3300005878 | Rice Paddy Soil | MDVRDLGWLLVAVVAGVLAAVGWIARERWIMRRRRR* |
| Ga0081455_1000247022 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDVGELGWLVVAVVAGVLAVAGWIVRERWVMRRRRRR* |
| Ga0081455_102267162 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRDLVWLVVAVVAGVLAAVGWIARERWLMRRRRQR* |
| Ga0070715_107020322 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | METIRDVVWLIVAVVVGILAAWGWLARERWIMRRRR* |
| Ga0079222_101212711 | 3300006755 | Agricultural Soil | MRELGWLVVAVVVGVLAAVGWVARERWIMRRRRR* |
| Ga0079220_102602202 | 3300006806 | Agricultural Soil | MDMRDLVWLLVAVVAGVLAAVGWIARERWIMRRRRR* |
| Ga0079220_103057382 | 3300006806 | Agricultural Soil | MRDLAWLIVAVTAGVLALVGWIARERWIMRRRRR* |
| Ga0079220_119603462 | 3300006806 | Agricultural Soil | MRELGWLVVAIVVGLVAAVGWVARERWIMRRRRR* |
| Ga0075421_1008238872 | 3300006845 | Populus Rhizosphere | MGDTGWLIVAIVTGVLAAVGWIARERWIMRRRRRR* |
| Ga0075430_1018098132 | 3300006846 | Populus Rhizosphere | GEGRRAMRELGWLVAAVVVGVLAAVGWVARERWIMRRRRR* |
| Ga0075431_1011526512 | 3300006847 | Populus Rhizosphere | MGDTGWLIVAIVTALLAAVGWIARERWIMRRRRRR* |
| Ga0075433_100547322 | 3300006852 | Populus Rhizosphere | MGTMRDVAWLIVALVAGILAAWGWLARERWIMRRRR* |
| Ga0075433_107257572 | 3300006852 | Populus Rhizosphere | METMRDVAWLIVAVVVGILAAWGWLARERWIMRRRR* |
| Ga0075425_1002644442 | 3300006854 | Populus Rhizosphere | METLRDVAWLIVAVVVGILAAWGWLARERWIMRRRR* |
| Ga0075425_1011438932 | 3300006854 | Populus Rhizosphere | MGTMRDVAWLIVAVVAGILAAWGWLARERWIMRRRR* |
| Ga0075434_1002466773 | 3300006871 | Populus Rhizosphere | MRELGWLVAAVVVGVLAAVGWVARERWIMRRRRR* |
| Ga0079219_106607791 | 3300006954 | Agricultural Soil | GKESLTRMRDLAWLIVAVTAGVLALVGWIARERWIMRRRRR* |
| Ga0099791_103113062 | 3300007255 | Vadose Zone Soil | MGDTGWLIVAIVTGVLAAVGWIARERWIMRRRRR* |
| Ga0099794_107580321 | 3300007265 | Vadose Zone Soil | MRDTGWLIVAIVGGVLAVIGWVARERWIIRRRRRR* |
| Ga0099829_101342652 | 3300009038 | Vadose Zone Soil | MGDTGWLIVAIVTGVLAVAGWIARERWIMRRRRR* |
| Ga0099829_109245342 | 3300009038 | Vadose Zone Soil | MGDTGWLIVAIVTGVLAVAGWIARERWIMRRRRRR* |
| Ga0105095_102822612 | 3300009053 | Freshwater Sediment | MRDTGWLIVAIVIGVLAVIGWIARERWIMRRRRRR* |
| Ga0099827_103214761 | 3300009090 | Vadose Zone Soil | MGDTGWLIVAIVSGVLAVIGWITRERWIIRRRRRR* |
| Ga0114129_100899472 | 3300009147 | Populus Rhizosphere | MGDTGWLIVAIVSGVLAIIGWVARERWIIRRRRRR* |
| Ga0114129_103175133 | 3300009147 | Populus Rhizosphere | GRRAMRELGWLVAAVVVGVLAAVGWVARERWIMRRRRR* |
| Ga0114129_121183522 | 3300009147 | Populus Rhizosphere | MSGRDLGWLAVAVIFGILIAVFYVTRELWIWRRRRKR* |
| Ga0075423_118656002 | 3300009162 | Populus Rhizosphere | MSGRDLGWLAVAVIFGILIAVFYVTREVWIHRRRKP* |
| Ga0105242_133215152 | 3300009176 | Miscanthus Rhizosphere | MRELVWLAVAVVVGVLAAVGWVARERWIMRRRRR* |
| Ga0126377_106117542 | 3300010362 | Tropical Forest Soil | MRDVVWLVVAVVAGVLAAVGWFARERWLMRRRRER* |
| Ga0126377_110847621 | 3300010362 | Tropical Forest Soil | MRELGWLVVVIVVGVLAAVGWVARERWIMRRRRR* |
| Ga0126377_116843882 | 3300010362 | Tropical Forest Soil | VRDFAWLVLAVVVGVLAVVGWVARERWLIRRRRRR* |
| Ga0134125_130883562 | 3300010371 | Terrestrial Soil | MGDTGWLIVAVVTGVLAVIGWIARERWIMRRRRRR* |
| Ga0134124_121742481 | 3300010397 | Terrestrial Soil | RPRPGRVTMRDLVWLVVAVVAGLLAAVGWIARERWIMRRRR* |
| Ga0134127_102672442 | 3300010399 | Terrestrial Soil | MGDTGWLIVAIVTGVLAVVGWIARERWIMRRRRRR* |
| Ga0137446_10124962 | 3300011419 | Soil | MGDTGWLIVAIVTGVLAVVGWIARERWIIRRRRRR* |
| Ga0137443_12544742 | 3300011433 | Soil | GDTGWLIVAIVAGVLAVIGWIARERWIMRRRRRR* |
| Ga0137458_10206372 | 3300011436 | Soil | MGDTGWLIVAIVTGVLAVVGWIARERCIIRRRRRR* |
| Ga0137437_11216002 | 3300011442 | Soil | MGDTGWLIVAIVAGVLAVIGWIVRERWIIRRRRRR* |
| Ga0137329_10519671 | 3300012133 | Soil | MGDTGWLIVAIVTGVLAAAGWIARERWIMRRRRR* |
| Ga0137399_106696932 | 3300012203 | Vadose Zone Soil | MGDTGWLIVAIVGGVLAVIGWVARERWIIRRRRRR* |
| Ga0137416_100452254 | 3300012927 | Vadose Zone Soil | MGDTGWLIVAIVGSVLAVIGWVARERWIIRRRRRR* |
| Ga0137404_103563252 | 3300012929 | Vadose Zone Soil | MGDTGWLIVAIVSGVLAVIGWVARERWIIRRRRRR* |
| Ga0153915_101873402 | 3300012931 | Freshwater Wetlands | MDMRDLVWLVVAIVAGLLAAVGWIARERWVMRRRRR* |
| Ga0153915_105768631 | 3300012931 | Freshwater Wetlands | MEGRDLGWLLVAVVAGLLAAVGWIVRERWIMRRRRR* |
| Ga0153915_109038262 | 3300012931 | Freshwater Wetlands | MDMRDLVWLLVAVGAGLLAAVGWIVRERWIMRRRRR* |
| Ga0164309_116429871 | 3300012984 | Soil | PRRGRVTMRDLAWLVVAVVAGLLAAVGWIARERWIMRRRR* |
| Ga0157375_114941511 | 3300013308 | Miscanthus Rhizosphere | RAMRELGWLVAAVVVGVLAAVGWGARGRWIMRRRRR* |
| Ga0075351_11248322 | 3300014318 | Natural And Restored Wetlands | MRDTAWLIVAIVAGVLTIVGWIVRERWIIRRRRR* |
| Ga0157377_112568911 | 3300014745 | Miscanthus Rhizosphere | MRDLGWLAVAVVVGVLAAVGWVARERWIMRRRRR* |
| Ga0180104_11648271 | 3300014884 | Soil | MRDTGWLIVAIVTGVLAAVGWIARERWIMRRRRRR* |
| Ga0132258_103725935 | 3300015371 | Arabidopsis Rhizosphere | VSELGWLIVAIVALVGFGAIWIAREVWLQRRRRRRR* |
| Ga0132258_112050452 | 3300015371 | Arabidopsis Rhizosphere | MDMRDLGWLVVAVVAAVLAAVGWIARERWIMRRRRRR* |
| Ga0187824_100320221 | 3300017927 | Freshwater Sediment | MDMRDLVWLLVAVVAGVLAAVGWIARERWIMRRRR |
| Ga0187824_100688341 | 3300017927 | Freshwater Sediment | MEMRDLVWLLVAVVAGVLAAVGWIARERWIMRRRR |
| Ga0187825_101406091 | 3300017930 | Freshwater Sediment | MDMRDLVWLLVAVVAGVLAAVGWIARERWIMRRRRR |
| Ga0187775_100651572 | 3300017939 | Tropical Peatland | MRDVVWLIVAVVAGILAAVGWVARERWLMRRRRGR |
| Ga0187823_100973962 | 3300017993 | Freshwater Sediment | MDMRDLVWLLVAVVVGVLAAVGWIARERWIMRRRRR |
| Ga0184610_10059602 | 3300017997 | Groundwater Sediment | MGDIGWLIVAIVTGVLAVVGWIARERWIMRRRRRR |
| Ga0184608_101114472 | 3300018028 | Groundwater Sediment | MGDTGWLIVAIVSGVLAVIGWVARERWIIRRRRRR |
| Ga0184634_101536042 | 3300018031 | Groundwater Sediment | MGDTGWLIVAIVTGVLAVVGWIARERWIIRRRRRR |
| Ga0187788_105463272 | 3300018032 | Tropical Peatland | MRDVVWLIVAVVAGILAAVGWVARKRWLMRRRRGR |
| Ga0184626_100126682 | 3300018053 | Groundwater Sediment | MGDIGWLIVAIVTAVLAVVGWIARERWIMRRRRRR |
| Ga0184621_100707951 | 3300018054 | Groundwater Sediment | MGDTGWLIVAIVSGVLAVIGWVARERWLIRRRRRR |
| Ga0184637_100680771 | 3300018063 | Groundwater Sediment | MGETAWLIVAITTGVLAAIGWIARERWIIRPRRRR |
| Ga0184637_105792982 | 3300018063 | Groundwater Sediment | MGDIGWLIVAIVTGVLAVVGWIARERWIIRRRRRR |
| Ga0184640_101042792 | 3300018074 | Groundwater Sediment | MGDTGWLIVAIVTGVLAVVGWIVRERWIIRRRRRR |
| Ga0184609_104866302 | 3300018076 | Groundwater Sediment | MGDTGWLIVAIVTGVLAAVGWIARERWIMRRRRRR |
| Ga0184629_101030932 | 3300018084 | Groundwater Sediment | MGDTGWLIVAIVTGVLAVAGWIARERWIMRRRRRR |
| Ga0190265_100160064 | 3300018422 | Soil | MSETGWLVVAITTGVLAAIGWVARERWVMRRRRRR |
| Ga0190265_100560692 | 3300018422 | Soil | MGDTGWLIVAIVSGVLAVVGWIARERWVMRRRRRR |
| Ga0190265_110919401 | 3300018422 | Soil | MGDIGWLVVAIVAGLLTVIGWIARERWIIRRRRRR |
| Ga0190265_134121481 | 3300018422 | Soil | VGDTGWLIVAIVSGVLAVVGWIARERWIMRRRRRRR |
| Ga0187894_100558082 | 3300019360 | Microbial Mat On Rocks | MGDTGWLIVAIVTGVLAAAGWIARERWIMRRRRRR |
| Ga0193715_11199782 | 3300019878 | Soil | MGDTGWLIVAIVSGVLAVIGWVARERWVIRRRRRR |
| Ga0193713_10454672 | 3300019882 | Soil | MEDTGWLIVAIVSGVLAVIGWVARERWIIRRRRRR |
| Ga0193739_10968181 | 3300020003 | Soil | MGDTGWLIVAIVTGVLAVVGWIARERWIMRRRRRR |
| Ga0193733_11727391 | 3300020022 | Soil | RPGRVTMRDLVWLVVAVVAGLLAVVGWIVRERWIMRRRR |
| Ga0179594_101313252 | 3300020170 | Vadose Zone Soil | MRDTGWLIVAIVGGVLAVIGWVARERWIIRRRRRR |
| Ga0210381_100642041 | 3300021078 | Groundwater Sediment | MGDTGWLIVAIVSGVLAVIGWVVRERWIIRRRRRR |
| Ga0210408_104224742 | 3300021178 | Soil | MVTMRDVAWLIVAVVVGILAAWGWLARERWIMRRRR |
| Ga0247793_10829172 | 3300023066 | Soil | LPRPDVWTAVRDLVWLVVAVVAGALAVVGWVARERWVMKRRRRR |
| Ga0247754_10631842 | 3300023102 | Soil | VWTAVRDLVWLVVAVVAGALAVVGWVARERWVMKRRRRR |
| Ga0209109_104250901 | 3300025160 | Soil | MSETGWLVVAIVAGVLAAVGWVARERWIMRRRRRR |
| Ga0207654_109394801 | 3300025911 | Corn Rhizosphere | AGRRGRAMRELGWLAVAVVVGVLAAVGWVARERWIMRRRRR |
| Ga0207663_100785382 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTMRDVAWLIVAVVVGILAAWGWLARERWIMRRR |
| Ga0209213_10362782 | 3300027383 | Forest Soil | MGDTGWLIVAIVSGVLVVIGWVARERWIIRRRRRR |
| Ga0208995_10787592 | 3300027388 | Forest Soil | MGDTGWLIVAIVGGVLAVIGWVARERWIIRRRRRR |
| Ga0256866_11147801 | 3300027650 | Soil | MRDTAWLIVAIVAGVLAAIGWIARERWIMRRRRRR |
| Ga0209590_106478211 | 3300027882 | Vadose Zone Soil | MGDTGWLIVAIVSGVLAVIGWITRERWIIRRRRRR |
| Ga0137415_101436563 | 3300028536 | Vadose Zone Soil | MGDTGWLIVAIVGSVLAVIGWVARERWIIRRRRRR |
| Ga0247822_104027712 | 3300028592 | Soil | MSDTGWLIVAIVTGVLAAAGWIARERWIMRRRRRR |
| Ga0307504_101602002 | 3300028792 | Soil | MGDTGWLIVAIVTGVLAAVGWIARERWIMRRRGRR |
| Ga0307504_102445221 | 3300028792 | Soil | KEEPIMRDLVWLIVAVVAGVLAAVGWIARERWIMRRRRRR |
| Ga0307504_102822481 | 3300028792 | Soil | MDMRELVWLLVAVVAGVLAAVGWIARERWIMRRRRR |
| Ga0307504_104770032 | 3300028792 | Soil | MRDLVWLIVAVVAGVLAAVGWIARERWIMRRRRRR |
| Ga0307281_102171212 | 3300028803 | Soil | MGDTGWLIVAIVTGVAAVVGWIARERWIMRRRRRR |
| Ga0307312_101883352 | 3300028828 | Soil | MGDTGWLIVAIVSGVLAVIGWVARERWLIRRRRPR |
| Ga0307312_104154492 | 3300028828 | Soil | PARPGRVTMRDLVWLVVAVVAGLLAVVGWIARERWIMRRRR |
| Ga0307278_101743451 | 3300028878 | Soil | TEDEMGDTGWLIVAIVSGVLAVIGWVARERWLIRRRRRR |
| (restricted) Ga0255310_100248002 | 3300031197 | Sandy Soil | MSDTGWLIVAIVAGVLAAVGWIARERWIMRRRRRR |
| (restricted) Ga0255310_100712901 | 3300031197 | Sandy Soil | MDTRDLLWLLVAVVAGVLAAVGWIARERWIMRRRRR |
| (restricted) Ga0255312_10238162 | 3300031248 | Sandy Soil | MRDTGWLIVAIVTGVLAVIGWIARERWIMRRRRRR |
| Ga0307469_111879392 | 3300031720 | Hardwood Forest Soil | MGTMRDVAWLIVAVVVGILVAWGWLARERWIMRRRR |
| Ga0307479_100018888 | 3300031962 | Hardwood Forest Soil | METMRDVAWLIVAVVVVILAAWGWLARERWIMRRRR |
| Ga0307470_100185552 | 3300032174 | Hardwood Forest Soil | MGDTGWLIVANVAGVLTIVGWIVRERWIIRRRRQR |
| Ga0307471_1000078304 | 3300032180 | Hardwood Forest Soil | MGDTGWLIVAIVAGVLTIVGWIVRERWIIRRRRQR |
| Ga0307471_1034298942 | 3300032180 | Hardwood Forest Soil | VRDLAWLVIAVVAGVLALVGWVARERWLMRRRRRR |
| Ga0334722_101012461 | 3300033233 | Sediment | MGDTGWLIVAIVAGLLAAIGWVVRERWIIRRRRRR |
| Ga0310810_100078852 | 3300033412 | Soil | METRDLAWLVVAVVAAVLAAVGWIARERWIMRRRRR |
| Ga0326729_10020872 | 3300033432 | Peat Soil | MDMRELVWLLVALGAGVLAAVGWIARERWIMRRRRR |
| Ga0326726_101192102 | 3300033433 | Peat Soil | MDKRDLVWLLVAVVAGLLAAVGWIARERWIMRRRGR |
| Ga0326726_111590262 | 3300033433 | Peat Soil | MDMRELVWLLVALVAGVLAAVGWIARERWIMRRRRR |
| Ga0316628_1001137941 | 3300033513 | Soil | MEGRDLVWLLVAVVAGLLAAVGWIARERWIMRRRRR |
| Ga0370498_014913_471_581 | 3300034155 | Untreated Peat Soil | MGDTGWLIIAIVAGVLTVVGWIARERWIIRRRRRRR |
| ⦗Top⦘ |