| Basic Information | |
|---|---|
| Family ID | F063108 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MCWEIDYKFFAEQKKAQEARIKQEQRAGVIDQLLSDANKQ |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.62 % |
| % of genes near scaffold ends (potentially truncated) | 95.38 % |
| % of genes from short scaffolds (< 2000 bps) | 95.38 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.846 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 6.15 |
| PF00106 | adh_short | 2.31 |
| PF04389 | Peptidase_M28 | 2.31 |
| PF01521 | Fe-S_biosyn | 2.31 |
| PF01329 | Pterin_4a | 1.54 |
| PF13460 | NAD_binding_10 | 1.54 |
| PF01266 | DAO | 1.54 |
| PF00536 | SAM_1 | 1.54 |
| PF07969 | Amidohydro_3 | 0.77 |
| PF00561 | Abhydrolase_1 | 0.77 |
| PF00313 | CSD | 0.77 |
| PF01027 | Bax1-I | 0.77 |
| PF01653 | DNA_ligase_aden | 0.77 |
| PF00166 | Cpn10 | 0.77 |
| PF07719 | TPR_2 | 0.77 |
| PF08240 | ADH_N | 0.77 |
| PF07690 | MFS_1 | 0.77 |
| PF10056 | DUF2293 | 0.77 |
| PF09926 | DUF2158 | 0.77 |
| PF00171 | Aldedh | 0.77 |
| PF03734 | YkuD | 0.77 |
| PF01048 | PNP_UDP_1 | 0.77 |
| PF02954 | HTH_8 | 0.77 |
| PF00271 | Helicase_C | 0.77 |
| PF02586 | SRAP | 0.77 |
| PF02566 | OsmC | 0.77 |
| PF07681 | DoxX | 0.77 |
| PF00578 | AhpC-TSA | 0.77 |
| PF13602 | ADH_zinc_N_2 | 0.77 |
| PF01741 | MscL | 0.77 |
| PF01979 | Amidohydro_1 | 0.77 |
| PF12071 | DUF3551 | 0.77 |
| PF04392 | ABC_sub_bind | 0.77 |
| PF00912 | Transgly | 0.77 |
| PF03401 | TctC | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 2.31 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 2.31 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 1.54 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.77 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.77 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.77 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.77 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.77 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.77 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.77 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.77 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.77 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.77 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.77 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.77 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.77 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.77 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.85 % |
| Unclassified | root | N/A | 16.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_285672_length_971_cov_5.557158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1003 | Open in IMG/M |
| 2166559005|cont_contig104899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300000443|F12B_10417592 | Not Available | 1144 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10053747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 895 | Open in IMG/M |
| 3300000890|JGI11643J12802_11882899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100094516 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300003659|JGI25404J52841_10109086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300005176|Ga0066679_10664660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 678 | Open in IMG/M |
| 3300005440|Ga0070705_100626443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300005713|Ga0066905_101795253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300005713|Ga0066905_101909880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300005764|Ga0066903_100220110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 2876 | Open in IMG/M |
| 3300005764|Ga0066903_103303824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
| 3300006031|Ga0066651_10089225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1532 | Open in IMG/M |
| 3300006052|Ga0075029_101048141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300006163|Ga0070715_10755583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300006172|Ga0075018_10776703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300006871|Ga0075434_100549533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1174 | Open in IMG/M |
| 3300006953|Ga0074063_13132759 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006969|Ga0075419_10966450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300007076|Ga0075435_101557862 | Not Available | 580 | Open in IMG/M |
| 3300009088|Ga0099830_11436640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300009088|Ga0099830_11510228 | Not Available | 559 | Open in IMG/M |
| 3300009089|Ga0099828_11260359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300010046|Ga0126384_12313647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300010359|Ga0126376_11838726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300010360|Ga0126372_11580173 | Not Available | 694 | Open in IMG/M |
| 3300010398|Ga0126383_12161111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300010398|Ga0126383_13015710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300012180|Ga0153974_1012550 | Not Available | 1800 | Open in IMG/M |
| 3300012350|Ga0137372_10016541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6979 | Open in IMG/M |
| 3300012354|Ga0137366_10695949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300012354|Ga0137366_10767220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300012359|Ga0137385_11294327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300012948|Ga0126375_10082826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1842 | Open in IMG/M |
| 3300012971|Ga0126369_10395853 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300012985|Ga0164308_10864589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300012988|Ga0164306_11141540 | Not Available | 650 | Open in IMG/M |
| 3300014321|Ga0075353_1091560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300016270|Ga0182036_11305639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300016294|Ga0182041_10044098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2969 | Open in IMG/M |
| 3300016294|Ga0182041_10416933 | Not Available | 1146 | Open in IMG/M |
| 3300016294|Ga0182041_12213105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300016319|Ga0182033_11369985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300016357|Ga0182032_10656991 | Not Available | 877 | Open in IMG/M |
| 3300016357|Ga0182032_11552672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300016371|Ga0182034_11543914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300016404|Ga0182037_10478570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300016422|Ga0182039_10798731 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300016422|Ga0182039_11342597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300016445|Ga0182038_11137327 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300017822|Ga0187802_10112643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 1027 | Open in IMG/M |
| 3300017972|Ga0187781_10909896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300017995|Ga0187816_10219879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 827 | Open in IMG/M |
| 3300018007|Ga0187805_10029581 | All Organisms → cellular organisms → Bacteria | 2429 | Open in IMG/M |
| 3300018090|Ga0187770_10167768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1679 | Open in IMG/M |
| 3300020583|Ga0210401_10860877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300021168|Ga0210406_10358476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1175 | Open in IMG/M |
| 3300021170|Ga0210400_10626611 | Not Available | 886 | Open in IMG/M |
| 3300021178|Ga0210408_10218851 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300021178|Ga0210408_10838851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300021405|Ga0210387_10994658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300021478|Ga0210402_10387136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1298 | Open in IMG/M |
| 3300021479|Ga0210410_10460014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1138 | Open in IMG/M |
| 3300025906|Ga0207699_10056640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2337 | Open in IMG/M |
| 3300025915|Ga0207693_10277758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1312 | Open in IMG/M |
| 3300025916|Ga0207663_10827668 | Not Available | 738 | Open in IMG/M |
| 3300025916|Ga0207663_11026165 | Not Available | 662 | Open in IMG/M |
| 3300025933|Ga0207706_10442678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1125 | Open in IMG/M |
| 3300025939|Ga0207665_11018913 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300026304|Ga0209240_1285627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 510 | Open in IMG/M |
| 3300026490|Ga0257153_1032270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1080 | Open in IMG/M |
| 3300026532|Ga0209160_1275026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300027023|Ga0207736_107273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300027041|Ga0209876_1023794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300027575|Ga0209525_1068689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300027651|Ga0209217_1030274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1697 | Open in IMG/M |
| 3300027654|Ga0209799_1092450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300027748|Ga0209689_1347176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300027894|Ga0209068_10786826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300028047|Ga0209526_10206105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1360 | Open in IMG/M |
| 3300028047|Ga0209526_10575364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300028536|Ga0137415_10445500 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300028718|Ga0307307_10144990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300028718|Ga0307307_10217722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300028791|Ga0307290_10279113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300031092|Ga0308204_10355110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300031544|Ga0318534_10544058 | Not Available | 662 | Open in IMG/M |
| 3300031545|Ga0318541_10845501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300031546|Ga0318538_10476572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300031668|Ga0318542_10279975 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300031681|Ga0318572_10989006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300031764|Ga0318535_10454467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300031764|Ga0318535_10528373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300031765|Ga0318554_10539014 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300031782|Ga0318552_10130622 | Not Available | 1255 | Open in IMG/M |
| 3300031792|Ga0318529_10255050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300031798|Ga0318523_10186451 | Not Available | 1035 | Open in IMG/M |
| 3300031821|Ga0318567_10300146 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031821|Ga0318567_10550666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300031833|Ga0310917_10144677 | Not Available | 1564 | Open in IMG/M |
| 3300031845|Ga0318511_10415285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031846|Ga0318512_10084023 | Not Available | 1476 | Open in IMG/M |
| 3300031890|Ga0306925_10360791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1560 | Open in IMG/M |
| 3300031890|Ga0306925_10365615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1548 | Open in IMG/M |
| 3300031890|Ga0306925_11572872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031893|Ga0318536_10493955 | Not Available | 615 | Open in IMG/M |
| 3300031894|Ga0318522_10227654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300031896|Ga0318551_10694757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300031897|Ga0318520_10563515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300031910|Ga0306923_10646671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1182 | Open in IMG/M |
| 3300031910|Ga0306923_10680532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1147 | Open in IMG/M |
| 3300031910|Ga0306923_12535077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300031942|Ga0310916_10334820 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300031942|Ga0310916_10856283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300031954|Ga0306926_10313747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1940 | Open in IMG/M |
| 3300031954|Ga0306926_11210131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 887 | Open in IMG/M |
| 3300031954|Ga0306926_12291039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300031959|Ga0318530_10237074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300031959|Ga0318530_10247826 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300032039|Ga0318559_10257098 | Not Available | 808 | Open in IMG/M |
| 3300032041|Ga0318549_10342856 | Not Available | 673 | Open in IMG/M |
| 3300032052|Ga0318506_10057584 | Not Available | 1585 | Open in IMG/M |
| 3300032067|Ga0318524_10328604 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300032091|Ga0318577_10116072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1262 | Open in IMG/M |
| 3300032160|Ga0311301_11333597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 903 | Open in IMG/M |
| 3300032261|Ga0306920_101918910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300033290|Ga0318519_10300806 | Not Available | 939 | Open in IMG/M |
| 3300033433|Ga0326726_12197154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300033887|Ga0334790_058352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1399 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.77% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.77% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.77% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.77% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.77% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.77% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.77% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027023 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027041 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_02693680 | 2140918013 | Soil | MEDPMCWEIDYKFFAELEKARETRKQEQRAGVIDSLLNEANKQSGQD |
| cont_0898.00006270 | 2166559005 | Simulated | MEDLMCWEIDYKLFAEQTKAQETRIKKEQHADVIDRLLNEA |
| F12B_104175921 | 3300000443 | Soil | WEIDYKFFAELEKARETRTKQEQRAGVIDSLLNEANKQSDK |
| AF_2010_repII_A001DRAFT_100537471 | 3300000793 | Forest Soil | MCWEIDYKFFAEQKKAKEIEQQRRAGVIDQLLNDAAKQ |
| JGI11643J12802_118828991 | 3300000890 | Soil | MCWEIDYKFFAEQKKAQDARIKQEKRAGVIDGLLNQANEQGE |
| JGIcombinedJ26739_1000945161 | 3300002245 | Forest Soil | MCWEIDYKFFAEQKKAHEARIKQQQRAGVLDQLLSEANKQADDTQT |
| JGI25404J52841_101090863 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MEDPMCWEIDYKFFAELEKARESRTKQEQRAGVIDSLLNEVNKQSEKT |
| Ga0066679_106646602 | 3300005176 | Soil | MCWEIDYKLFAEQKKAQEIRIDQERRAGVIDQLLNEANKQGE |
| Ga0070705_1006264431 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDSMCWEIDYKFFAEQRKAQEARIKQEQRAGVINQLLNEANQQGGTL* |
| Ga0066905_1017952531 | 3300005713 | Tropical Forest Soil | MCWEVDYKFLAELEKARETRIKQERRAGVIDNLLNEVNQQSDKTN |
| Ga0066905_1019098801 | 3300005713 | Tropical Forest Soil | MCWEINYKFLAELEKARETRIKQERRAGVIDNLLNEVNQQSDKTN |
| Ga0066903_1002201104 | 3300005764 | Tropical Forest Soil | MCWEIDYKLFAELEKARETKIKQEQPAVVIDKLLNEATKQSDKT |
| Ga0066903_1033038241 | 3300005764 | Tropical Forest Soil | MCWERDYKFFAEQKKAQESRIRGEQRSGVIHQLLNEANKQGEST |
| Ga0066651_100892252 | 3300006031 | Soil | MCWEIDYKFFAEQQKKAQEARIKQEQRAGVIDRLLTEANEQ |
| Ga0075029_1010481412 | 3300006052 | Watersheds | MCWEMDYRFFTEQKKAQETRIKEEQRAGVIDKLLSEANKQS |
| Ga0070715_107555832 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MCWEMDHRFFAEQKKAQETRIKEEQRAGVIDKLLSEAHKQS* |
| Ga0075018_107767031 | 3300006172 | Watersheds | MCYEIDYEIFAAQRKAQEARIKQEQRAGVIDQLLNEANKQ |
| Ga0075434_1005495333 | 3300006871 | Populus Rhizosphere | MCWEIDYKFFAEQKAQEARIKQEQRAGVIDQLRNEAHQQGDIPQVEEP |
| Ga0074063_131327591 | 3300006953 | Soil | MCWEIDYKFFAEQKKAQDARIKQEKRAGVIDGLLNQANEQGEK |
| Ga0075419_109664502 | 3300006969 | Populus Rhizosphere | MCWEIDYKLFADQTKAQETRIKKEQRADVIHRLLNEA |
| Ga0075435_1015578621 | 3300007076 | Populus Rhizosphere | MCWEIDYKFFAEQKKAQEARTKQQERAGVIDRLLNEAHQQG |
| Ga0099830_114366402 | 3300009088 | Vadose Zone Soil | MCYEIDYSIFASQKKAQEARIKQEQRAGVIDQLLSDAN |
| Ga0099830_115102281 | 3300009088 | Vadose Zone Soil | MCWEIDYKLFAEQKKAQESRIEQERRAGVIDQLLNEANKQGERSNV |
| Ga0099828_112603591 | 3300009089 | Vadose Zone Soil | MEDSMCYEIDYQIFAAQKKAQEARTKQERRAGVIDQLIKDAKLMT* |
| Ga0126384_123136472 | 3300010046 | Tropical Forest Soil | MEDLMCWEMDYKLFDELKKAEEARIKQEQRGEVITKLLNEANKQS |
| Ga0126376_118387262 | 3300010359 | Tropical Forest Soil | MEDIMCWEIDYKFFAEQKKAKEIEQQRRAGVIDQLQKEAQKQDDKSNV |
| Ga0126372_115801732 | 3300010360 | Tropical Forest Soil | MCWEIDYKFFAEQKKAHEARTKQEQRAGVIDRLLN |
| Ga0126383_121611111 | 3300010398 | Tropical Forest Soil | MCWERDYKFFAEQKKAQETRIKQERRAGVIDRLLNEANRQ |
| Ga0126383_130157101 | 3300010398 | Tropical Forest Soil | MEDIMCWEIDYKFFAEQKKAKEIEQQRRAGVIDQLLNDAAKQGDKQGDKQ |
| Ga0153974_10125503 | 3300012180 | Attine Ant Fungus Gardens | MEDSMCWEIDYKFFAEQRKAQETRIKQEQRAGVINQLLNEANQQGEK |
| Ga0137372_100165418 | 3300012350 | Vadose Zone Soil | MEDTMCWEIDYKFFAEQKKAKEIEQQRRAGVIDQLLNEAQKQDD |
| Ga0137366_106959492 | 3300012354 | Vadose Zone Soil | MEDTMCWEIDYKFFAEQKKAKEIEQQRRAGVIAQLLNEAQ |
| Ga0137366_107672201 | 3300012354 | Vadose Zone Soil | MCWEIDYKFFAEQKKAQERRITQQRRADLVDQLLNDANQQGKE |
| Ga0137385_112943271 | 3300012359 | Vadose Zone Soil | MCHEIDYIFFAEQQKAREARIKQEQRAGVINKLLNEATRAEQAT |
| Ga0126375_100828261 | 3300012948 | Tropical Forest Soil | MCWEVDYKFFAEQQKKAQDARIKQEQRAGVIDRLLNEANKQGEKTEV |
| Ga0126369_103958532 | 3300012971 | Tropical Forest Soil | MCWEIDYKFFAEQKQAQDARIKQEQRAGVIDRLLNQANEPGE |
| Ga0164308_108645891 | 3300012985 | Soil | MEDPMCWEIDYKFFAELEKARETRTKQEQRAGVIDSLLNEAN |
| Ga0164306_111415402 | 3300012988 | Soil | MCWEMDYRFFAEQKKAQETRIKEEQRAGVIDKLLSEANK |
| Ga0075353_10915601 | 3300014321 | Natural And Restored Wetlands | MEDSMCWEVDYKFFAELEKARETRKQEQRAGVIDSL |
| Ga0182036_113056392 | 3300016270 | Soil | MCWQIDYRFFADQKKAQEARIKREQRAGVIDQLLNEANKQGEKT |
| Ga0182041_100440988 | 3300016294 | Soil | MCWEMDYKLFDELKKAQEARIKQEQRGEVITKLLNEANKQSEKTDVAE |
| Ga0182041_104169332 | 3300016294 | Soil | MCCEIDYKLFAELEKARETKVKQEQRAGVIDHLLHEANKQ |
| Ga0182041_122131051 | 3300016294 | Soil | MCWETDYQFFAEQKKAQEARIKQEQRAGAIDQLLKDANKHGEKTN |
| Ga0182033_113699852 | 3300016319 | Soil | MCWEMDYKPFDELKKAQEARIKQEQRGEVITKLLNEANK |
| Ga0182032_106569911 | 3300016357 | Soil | MCWEIDYKFFAEQKKAQQTRIEQERRAGVIHQLLNEANKQGEPSN |
| Ga0182032_115526722 | 3300016357 | Soil | MCWQIDYRFFADQKKAQEARIKREQRAGVIDQLLNEANKQGEKTN |
| Ga0182034_115439142 | 3300016371 | Soil | MCWQIDYRFFADQKKAQEARIKREQRAGVIDQLLNEANK |
| Ga0182037_104785702 | 3300016404 | Soil | MCWEMDYKLFDELKKAQEARIKQEKRGEVIIKLLN |
| Ga0182039_107987312 | 3300016422 | Soil | MCWEIDYKFFAEQKKAQDTRINQEKRAGVIDRLLNQVKEQGQKTHV |
| Ga0182039_113425971 | 3300016422 | Soil | MCWEIDYKFFAEQQKAQEARIKQEQRSGVINQLLSDATKQ |
| Ga0182038_111373272 | 3300016445 | Soil | MCWEIDYKFFAEQKKAQDARIKQEKRAGVIDGLLN |
| Ga0187802_101126433 | 3300017822 | Freshwater Sediment | MCWEMDYRFFAEQKKAQETRIKEEQRAGVIDKLLSEANRQSESTDAT |
| Ga0187781_109098963 | 3300017972 | Tropical Peatland | MCWEMDYQFFTEHKKAQETQIKQQQRAGVIDKLLNEANKQAE |
| Ga0187816_102198791 | 3300017995 | Freshwater Sediment | MCWEMDYKLFAELRKEQEARTKQEQRGEVITKLLNEANKQSEKTH |
| Ga0187805_100295814 | 3300018007 | Freshwater Sediment | MCWEMDYKLFAEQKKAQETRVKQEHRAGVIDKLLNGANK |
| Ga0187770_101677684 | 3300018090 | Tropical Peatland | MCWELDYKLFAQQQKAQDARIEQERRRDGVVAKLLDDANKQSEKA |
| Ga0210401_108608771 | 3300020583 | Soil | MCYEIDYEIFAAQRKAQEARIKQEQRAGVIDQLLNEANKQGDDTKTEG |
| Ga0210406_103584763 | 3300021168 | Soil | MCWEIDYKFFAEQKKAQEARTKQQERAGVIDRLLNEAHQQGDTP |
| Ga0210400_106266112 | 3300021170 | Soil | MCWEIDYKFFAEQKKAQEARTKQQERAGVIDRLLN |
| Ga0210408_102188512 | 3300021178 | Soil | MCWEIDYKSFAEQKKAQDARIKQEQRAGVIDGLLNQANEPG |
| Ga0210408_108388512 | 3300021178 | Soil | MCWEIDYKFLAEHKKAQETRIKQEQRVGIIDQLLNEAN |
| Ga0210387_109946581 | 3300021405 | Soil | MCYEIDYEIFAAQRKAQEARIKQEQRAGVIDQLLNEANKQGDDT |
| Ga0210402_103871363 | 3300021478 | Soil | MCWEIDYKFFAEQKKAQEARTKQEQRTGVIDRLLNEAHQQGDTPRVE |
| Ga0210410_104600141 | 3300021479 | Soil | MCYEIDYQIFAAQRKAQEARIKQEQRAGVIDQLLNEANKQ |
| Ga0207699_100566401 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MCWEIDYKFFAEQKKAQEARTKQQERAGVIDRLLNEAHQQGDTPQV |
| Ga0207693_102777582 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MCWEMDYEFFAEQKKAQEARIKQEQRAGVIDQLLNDANKQDQ |
| Ga0207663_108276682 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MCWEIDYKFFAEQKKAQEARTKQEQRTGVIDRLLNEAHQQGDTPRVEAP |
| Ga0207663_110261651 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MCWEMDYKFLAEREKAQEARAKQEQRAGVIDQLLNDANKQ |
| Ga0207706_104426782 | 3300025933 | Corn Rhizosphere | MCWEMDYRFFTEQKKAQETRIKEEQRAGVIDKLLSEASKQRESA |
| Ga0207665_110189131 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MCREIDYKFFAEQRKAQETRIKQEQRAGVINQLLNEANQQGGTL |
| Ga0209240_12856271 | 3300026304 | Grasslands Soil | MCWEIDYKFWTEQKRAQETRIKQEQRAGVIDQLLTEANKPAE |
| Ga0257153_10322701 | 3300026490 | Soil | MCWEIDYKFFEQQKKAQEARIKQEQRAGVIDRLLTEANEQG |
| Ga0209160_12750262 | 3300026532 | Soil | MCWEIDYKFFAEQKKAKEIEQQRRAGVIDQLLNEAQKQDDKV |
| Ga0207736_1072732 | 3300027023 | Tropical Forest Soil | MCWEMDYRFFAEQKKAQEKQEQRNEVISKLLNEANKPGEKTNVEE |
| Ga0209876_10237941 | 3300027041 | Groundwater Sand | MCWEMDYKFFAEQKKAQEARIKQEQRAGVIENLLREANKQGDK |
| Ga0209525_10686891 | 3300027575 | Forest Soil | MCWEIDYRFFAEQKKAQEARIKQERRAGVIDQLLDDANKQGDDTKTEG |
| Ga0209217_10302741 | 3300027651 | Forest Soil | MCYEIDYEIFAAQRKAQEARIKQEQRAGVIDQLLNEA |
| Ga0209799_10924501 | 3300027654 | Tropical Forest Soil | MCWEIDYKFFAEQKQAQDARIKQEQRAGVIDRLLNQANEPG |
| Ga0209689_13471761 | 3300027748 | Soil | MCWEIDYKFFAEQQKKAQEARVKQEQRAGIIDRLLTEANEQG |
| Ga0209068_107868261 | 3300027894 | Watersheds | MCYEIDYQIFAAQKKAQEARIKQEQRAGVIDQLLNEANKQS |
| Ga0209526_102061052 | 3300028047 | Forest Soil | MCYEIDYQIFAAQRKAQEARIKQEQRAGVIDQLLNEANKQG |
| Ga0209526_105753643 | 3300028047 | Forest Soil | MCYEIDYEIFAAQRKAQEARIKQEQRAGVIDQLLNEANKQG |
| Ga0137415_104455002 | 3300028536 | Vadose Zone Soil | MCWEIDYKFFEQQKKAQEARIKQEQRAGVIDQQLQRPVAVLHP |
| Ga0307307_101449902 | 3300028718 | Soil | MCWEIDYKLFAEQTKAQETRIKKEQRADVIHRLLNDANKQ |
| Ga0307307_102177221 | 3300028718 | Soil | MCWEIDYKFFAEQKKAQEARTKQEQRTGVIDRLLNEAHQQGDTPQVE |
| Ga0307290_102791132 | 3300028791 | Soil | MEDFMCWEIDYKFFAEREKARETRTKQEQRAGVIGGLLNEANKQSDKT |
| Ga0308204_103551101 | 3300031092 | Soil | MCWEIDYKFSAEQKEAQDARIKQEQRAGVIDRLLNRSQ |
| Ga0318534_105440581 | 3300031544 | Soil | MCWEMDYKLFDELKKAQEARIKQEQRGEVITKLLNEANK |
| Ga0318541_108455012 | 3300031545 | Soil | MCWEIDYKFFAEQKKAQQTRIEQERRAGVIHQLLNEANKQG |
| Ga0318538_104765722 | 3300031546 | Soil | MCWEMDYKLFDELKKAQEARIKQEQRGEVITKLLN |
| Ga0318542_102799752 | 3300031668 | Soil | MCWEIDYKFFAEQKKAQDARIKQEQRAGVIDRLLNQANEQG |
| Ga0318572_109890062 | 3300031681 | Soil | MCYEIDYLFFAEQQKAQEARKKQEQRAGVINKLLDEAT |
| Ga0318535_104544671 | 3300031764 | Soil | MCWEIDYKFFAEQKKAQQTRIEQERRAGVIHQLLNEAN |
| Ga0318535_105283731 | 3300031764 | Soil | MCWELDYKFFAEQKKAQETRIEQERRAGVIHHLLNEANK |
| Ga0318554_105390141 | 3300031765 | Soil | MCWEIDYKFFAEQKKAQDARIKQEQRAGVIDRLLNQAND |
| Ga0318552_101306224 | 3300031782 | Soil | MCWEIDYKFFAEQKKAKEIEQQRRAGVIDQLLNDAAK |
| Ga0318529_102550502 | 3300031792 | Soil | MCWERDYKFFAEQKKAQETQIKQARRAGLIDRLLNEANR |
| Ga0318523_101864513 | 3300031798 | Soil | MCWEMDYKLFDELKKAQEARIKQEQRGEVITKLLNEANKQS |
| Ga0318567_103001461 | 3300031821 | Soil | MCWEIDYKFFAEQKKAQDARIKQEQRAGVIDRLLNQANE |
| Ga0318567_105506661 | 3300031821 | Soil | MCWEIDYKFFAEQKKAQEARIKQEQRAGVIDQLLSDANKQ |
| Ga0310917_101446771 | 3300031833 | Soil | MCWEIDYKFFAEQQKKAQDARIKQEQRAGVIDRLLNDANQQSEKPDV |
| Ga0318511_104152852 | 3300031845 | Soil | MCWEIDYKFFAEQKKAQQTRIEQERRAGVIHQLLNEANKQGE |
| Ga0318512_100840234 | 3300031846 | Soil | MEELMCWEMDYKLFDELKKAQEARIKQEQRGEVITKLLNEANKQ |
| Ga0306925_103607911 | 3300031890 | Soil | MCWEMDDKLFDELKKAQEARIKQEQRGEVITKLLNEANKQ |
| Ga0306925_103656151 | 3300031890 | Soil | MCWERDYKFFAEQKKAQETQIKQARRAGRIDRLLNEAN |
| Ga0306925_115728721 | 3300031890 | Soil | MCWEIDYKFFAEQKKAQQTRIEQERRAGVIHQLLNEANKQ |
| Ga0318536_104939551 | 3300031893 | Soil | MCWEMDYKLFDELKKAQEARIKQEQRGEVITKLLNEANKQSEK |
| Ga0318522_102276541 | 3300031894 | Soil | MCWERDYKFFAEQKKAQETRIKQERRAGVIDRLLNEANRQGEN |
| Ga0318551_106947572 | 3300031896 | Soil | MCWERDYKFFAEQKKAQETRIKQERRAGVIDRLLNEANRQGENTAE |
| Ga0318520_105635151 | 3300031897 | Soil | MCWEMDYKLFSELRKEQEARTRQEQRGEVITKLLSEANKQSEKTNAE |
| Ga0306923_106466711 | 3300031910 | Soil | MCWERDYKFFAEQKKAQETQIKQARRAGRIDRLLNEANRQGEK |
| Ga0306923_106805321 | 3300031910 | Soil | MCWEMDDKLFDELKKAQEARIKQEQRGEVITKLLNE |
| Ga0306923_125350772 | 3300031910 | Soil | MCWEIDYKFFAEQQKAQEARIKQEQRSGVINQLLSDATKQGEKT |
| Ga0310916_103348202 | 3300031942 | Soil | MCWEIDYKFFAEQKKAQDARIKQEQRAGVIDRLLNQ |
| Ga0310916_108562832 | 3300031942 | Soil | FGAVPSRMEDIMCWEMDYEFVAAQKKAQEARIKQEQRAGVIDHLLNDANKHG |
| Ga0306926_103137471 | 3300031954 | Soil | MCWEMDYKLFSELRKEQEARTRQEQRGEVITKLLSEANKQSE |
| Ga0306926_112101311 | 3300031954 | Soil | MCYEIDYLFFAEQQKAQEARKKQEQRAGVINKLLDEATNQAEQPKVEAA |
| Ga0306926_122910391 | 3300031954 | Soil | MCWEIDYQFFAEQKKAQEARIKQEQRAGVIDQLLNDANKH |
| Ga0318530_102370742 | 3300031959 | Soil | MCWERDYKFFAEQKKAQETRIKQERRAGVIDRLLNEANR |
| Ga0318530_102478261 | 3300031959 | Soil | MCWEIDYKFFAEQKKAQDARIKQEQRAGVIDRLLNQANDQG |
| Ga0318559_102570983 | 3300032039 | Soil | MCWEMDYKLFDELKKAQEARIKKEQRGEVITNLLN |
| Ga0318549_103428561 | 3300032041 | Soil | MCWEMDYKLFDELKKAQEARIKQEQRGEAITKLLNEANKQ |
| Ga0318506_100575841 | 3300032052 | Soil | MCWEIDYKFFAEQKKAQQTRIEQERRAGVIHQLLNE |
| Ga0318524_103286041 | 3300032067 | Soil | MCWEIDYKFFAEQKKAQDARIKQEQRAGVIDRLLN |
| Ga0318577_101160723 | 3300032091 | Soil | MCWERDYKFFAEQKKAQETQIKQARRAGLIDRLLNEANRQGEKTAEET |
| Ga0311301_113335973 | 3300032160 | Peatlands Soil | MCWEMDYNFFAEQKKAQETRNKQEQRAGVIDDLLRQAN |
| Ga0306920_1019189102 | 3300032261 | Soil | MCWEMDYKLFDELKKAQEARIKQEQRGEVITKLLSEANKQSEKTDVA |
| Ga0318519_103008061 | 3300033290 | Soil | MCYEIDYLFFAEQQKAQEARKKQEQRAGVINKLLDEATNQAEQPKVEAAP |
| Ga0326726_121971542 | 3300033433 | Peat Soil | MCWEMDYKFFAEQKKAQEARIKQEQRAGIIENLLREANKQGDKTNV |
| Ga0334790_058352_279_413 | 3300033887 | Soil | MEDLMCWEMDYKLFAEQKKAQEIQVKQEQRAGVIDKLLNGAMLN |
| ⦗Top⦘ |