| Basic Information | |
|---|---|
| Family ID | F063068 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MNEGQFFLAVALMLPALYWTMKFIVWFAEKVERKK |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.08 % |
| % of genes near scaffold ends (potentially truncated) | 19.23 % |
| % of genes from short scaffolds (< 2000 bps) | 76.15 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (48.462 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (40.769 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.769 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF00565 | SNase | 1.54 |
| PF00149 | Metallophos | 0.77 |
| PF13884 | Peptidase_S74 | 0.77 |
| PF00293 | NUDIX | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.15 % |
| Unclassified | root | N/A | 33.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10240189 | Not Available | 577 | Open in IMG/M |
| 3300000947|BBAY92_10182291 | Not Available | 548 | Open in IMG/M |
| 3300001939|GOS2225_1005481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1025 | Open in IMG/M |
| 3300001949|GOS2238_1010096 | All Organisms → Viruses → Predicted Viral | 1499 | Open in IMG/M |
| 3300001964|GOS2234_1011938 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
| 3300001966|GOS2245_1018182 | Not Available | 930 | Open in IMG/M |
| 3300001966|GOS2245_1069593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1171 | Open in IMG/M |
| 3300001971|GOS2215_10130371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 831 | Open in IMG/M |
| 3300005514|Ga0066866_10001436 | Not Available | 9791 | Open in IMG/M |
| 3300005514|Ga0066866_10008030 | Not Available | 4272 | Open in IMG/M |
| 3300005514|Ga0066866_10344125 | Not Available | 504 | Open in IMG/M |
| 3300005523|Ga0066865_10174738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 800 | Open in IMG/M |
| 3300005604|Ga0066852_10077924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1202 | Open in IMG/M |
| 3300006166|Ga0066836_10389154 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300006318|Ga0068475_1056800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 2119 | Open in IMG/M |
| 3300006735|Ga0098038_1026285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 2192 | Open in IMG/M |
| 3300006735|Ga0098038_1048225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1544 | Open in IMG/M |
| 3300006735|Ga0098038_1065951 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
| 3300006735|Ga0098038_1099963 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300006737|Ga0098037_1037306 | Not Available | 1778 | Open in IMG/M |
| 3300006737|Ga0098037_1138911 | Not Available | 821 | Open in IMG/M |
| 3300006749|Ga0098042_1002685 | All Organisms → cellular organisms → Bacteria | 6407 | Open in IMG/M |
| 3300006749|Ga0098042_1006718 | All Organisms → Viruses → Predicted Viral | 3804 | Open in IMG/M |
| 3300006749|Ga0098042_1030195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1543 | Open in IMG/M |
| 3300006749|Ga0098042_1108421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 699 | Open in IMG/M |
| 3300006789|Ga0098054_1070583 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
| 3300006921|Ga0098060_1005989 | All Organisms → cellular organisms → Bacteria | 4199 | Open in IMG/M |
| 3300006928|Ga0098041_1006707 | All Organisms → cellular organisms → Bacteria | 3902 | Open in IMG/M |
| 3300006928|Ga0098041_1168566 | Not Available | 703 | Open in IMG/M |
| 3300006929|Ga0098036_1189055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 626 | Open in IMG/M |
| 3300006990|Ga0098046_1026791 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300006990|Ga0098046_1066974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 820 | Open in IMG/M |
| 3300007116|Ga0101667_1109241 | Not Available | 504 | Open in IMG/M |
| 3300007508|Ga0105011_1165590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 692 | Open in IMG/M |
| 3300007760|Ga0105018_1160317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 594 | Open in IMG/M |
| 3300007765|Ga0105010_1113069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 829 | Open in IMG/M |
| 3300008050|Ga0098052_1228289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 716 | Open in IMG/M |
| 3300008624|Ga0115652_1024307 | Not Available | 2394 | Open in IMG/M |
| 3300009108|Ga0117920_1001288 | Not Available | 21423 | Open in IMG/M |
| 3300009435|Ga0115546_1147292 | Not Available | 832 | Open in IMG/M |
| 3300009481|Ga0114932_10009933 | Not Available | 7423 | Open in IMG/M |
| 3300009481|Ga0114932_10013043 | Not Available | 6141 | Open in IMG/M |
| 3300009481|Ga0114932_10078232 | All Organisms → Viruses → Predicted Viral | 2078 | Open in IMG/M |
| 3300009481|Ga0114932_10091961 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300009481|Ga0114932_10472985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 739 | Open in IMG/M |
| 3300009481|Ga0114932_10573112 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 661 | Open in IMG/M |
| 3300009507|Ga0115572_10397585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 771 | Open in IMG/M |
| 3300009550|Ga0115013_10014143 | All Organisms → Viruses → Predicted Viral | 4199 | Open in IMG/M |
| 3300009593|Ga0115011_10273441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1275 | Open in IMG/M |
| 3300009703|Ga0114933_10002015 | Not Available | 21741 | Open in IMG/M |
| 3300009703|Ga0114933_10297794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1071 | Open in IMG/M |
| 3300009703|Ga0114933_10362351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 954 | Open in IMG/M |
| 3300009790|Ga0115012_10129220 | Not Available | 1800 | Open in IMG/M |
| 3300009790|Ga0115012_10277641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1254 | Open in IMG/M |
| 3300009790|Ga0115012_11861998 | Not Available | 529 | Open in IMG/M |
| 3300010148|Ga0098043_1051650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1257 | Open in IMG/M |
| 3300010883|Ga0133547_10979751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1639 | Open in IMG/M |
| 3300011258|Ga0151677_1013520 | Not Available | 1383 | Open in IMG/M |
| 3300012919|Ga0160422_10754847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 623 | Open in IMG/M |
| 3300012920|Ga0160423_10109579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1949 | Open in IMG/M |
| 3300012920|Ga0160423_10193261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1419 | Open in IMG/M |
| 3300012928|Ga0163110_10349449 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300012928|Ga0163110_10638141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 825 | Open in IMG/M |
| 3300012928|Ga0163110_11189689 | Not Available | 612 | Open in IMG/M |
| 3300012936|Ga0163109_10678159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 754 | Open in IMG/M |
| 3300017706|Ga0181377_1005338 | All Organisms → Viruses → Predicted Viral | 3441 | Open in IMG/M |
| 3300017708|Ga0181369_1012360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 2161 | Open in IMG/M |
| 3300017719|Ga0181390_1175392 | Not Available | 527 | Open in IMG/M |
| 3300017721|Ga0181373_1005398 | All Organisms → Viruses → Predicted Viral | 2450 | Open in IMG/M |
| 3300017751|Ga0187219_1129743 | Not Available | 740 | Open in IMG/M |
| 3300020249|Ga0211635_1018383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1222 | Open in IMG/M |
| 3300020250|Ga0211627_1009346 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300020258|Ga0211529_1008278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1718 | Open in IMG/M |
| 3300020259|Ga0211633_1021887 | Not Available | 1123 | Open in IMG/M |
| 3300020262|Ga0211537_1093377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 514 | Open in IMG/M |
| 3300020291|Ga0211524_1026244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 984 | Open in IMG/M |
| 3300020312|Ga0211542_1023698 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300020312|Ga0211542_1029474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1093 | Open in IMG/M |
| 3300020353|Ga0211613_1014325 | Not Available | 1813 | Open in IMG/M |
| 3300020353|Ga0211613_1052449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 953 | Open in IMG/M |
| 3300020362|Ga0211488_10103395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 840 | Open in IMG/M |
| 3300020362|Ga0211488_10108629 | Not Available | 813 | Open in IMG/M |
| 3300020363|Ga0211493_1087172 | Not Available | 801 | Open in IMG/M |
| 3300020374|Ga0211477_10005539 | All Organisms → cellular organisms → Bacteria | 6745 | Open in IMG/M |
| 3300020379|Ga0211652_10017973 | All Organisms → Viruses → Predicted Viral | 2118 | Open in IMG/M |
| 3300020385|Ga0211677_10019549 | All Organisms → Viruses → Predicted Viral | 3416 | Open in IMG/M |
| 3300020404|Ga0211659_10002649 | All Organisms → cellular organisms → Bacteria | 9566 | Open in IMG/M |
| 3300020410|Ga0211699_10141713 | Not Available | 904 | Open in IMG/M |
| 3300020411|Ga0211587_10178793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 893 | Open in IMG/M |
| 3300020416|Ga0211644_10057164 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
| 3300020416|Ga0211644_10074525 | All Organisms → Viruses → Predicted Viral | 1373 | Open in IMG/M |
| 3300020416|Ga0211644_10451709 | Not Available | 531 | Open in IMG/M |
| 3300020417|Ga0211528_10027055 | All Organisms → Viruses → Predicted Viral | 2752 | Open in IMG/M |
| 3300020421|Ga0211653_10001430 | Not Available | 13404 | Open in IMG/M |
| 3300020428|Ga0211521_10076444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1657 | Open in IMG/M |
| 3300020430|Ga0211622_10159661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 970 | Open in IMG/M |
| 3300020431|Ga0211554_10561388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 516 | Open in IMG/M |
| 3300020436|Ga0211708_10365584 | Not Available | 590 | Open in IMG/M |
| 3300020437|Ga0211539_10486115 | Not Available | 514 | Open in IMG/M |
| 3300020438|Ga0211576_10011418 | All Organisms → cellular organisms → Bacteria | 5607 | Open in IMG/M |
| 3300020442|Ga0211559_10214692 | Not Available | 907 | Open in IMG/M |
| 3300020445|Ga0211564_10294633 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 800 | Open in IMG/M |
| 3300020454|Ga0211548_10673071 | Not Available | 504 | Open in IMG/M |
| 3300020457|Ga0211643_10079895 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300020464|Ga0211694_10155343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 927 | Open in IMG/M |
| 3300020468|Ga0211475_10220664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 947 | Open in IMG/M |
| 3300020470|Ga0211543_10074786 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300020470|Ga0211543_10354378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 708 | Open in IMG/M |
| 3300020478|Ga0211503_10060594 | Not Available | 2318 | Open in IMG/M |
| 3300020595|Ga0206126_10097093 | Not Available | 1465 | Open in IMG/M |
| 3300024344|Ga0209992_10100804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1296 | Open in IMG/M |
| 3300024344|Ga0209992_10419923 | Not Available | 525 | Open in IMG/M |
| 3300025070|Ga0208667_1058330 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 608 | Open in IMG/M |
| 3300025083|Ga0208791_1073574 | Not Available | 561 | Open in IMG/M |
| 3300025086|Ga0208157_1014234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 2546 | Open in IMG/M |
| 3300025101|Ga0208159_1032369 | Not Available | 1178 | Open in IMG/M |
| 3300025102|Ga0208666_1040693 | Not Available | 1350 | Open in IMG/M |
| 3300025128|Ga0208919_1049337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1450 | Open in IMG/M |
| 3300025132|Ga0209232_1017193 | All Organisms → Viruses → Predicted Viral | 2878 | Open in IMG/M |
| 3300025132|Ga0209232_1181681 | Not Available | 653 | Open in IMG/M |
| 3300025151|Ga0209645_1068381 | Not Available | 1203 | Open in IMG/M |
| 3300025151|Ga0209645_1073369 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300025151|Ga0209645_1151708 | Not Available | 714 | Open in IMG/M |
| 3300026209|Ga0207989_1000085 | Not Available | 53400 | Open in IMG/M |
| 3300026209|Ga0207989_1085180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 809 | Open in IMG/M |
| 3300027906|Ga0209404_10376463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 921 | Open in IMG/M |
| 3300029319|Ga0183748_1015953 | All Organisms → Viruses → Predicted Viral | 2845 | Open in IMG/M |
| 3300029319|Ga0183748_1036541 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1523 | Open in IMG/M |
| 3300029319|Ga0183748_1067887 | Not Available | 930 | Open in IMG/M |
| 3300029448|Ga0183755_1019261 | All Organisms → Viruses → Predicted Viral | 2308 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 40.77% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 33.08% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 8.46% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.62% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.62% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.54% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.54% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.77% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.77% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.77% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.77% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.77% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.77% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001939 | Marine microbial communities from Block Island, New York, USA - GS009 | Environmental | Open in IMG/M |
| 3300001949 | Marine microbial communities from Panama City, Panama - GS022 | Environmental | Open in IMG/M |
| 3300001964 | Marine microbial communities from Rosario Bank, Honduras - GS018 | Environmental | Open in IMG/M |
| 3300001966 | Marine microbial communities from Roca Redonda, Equador - GS030 | Environmental | Open in IMG/M |
| 3300001971 | Marine microbial communities from the Sargasso Sea - GS000c | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006318 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0200m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007116 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3 | Environmental | Open in IMG/M |
| 3300007508 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007760 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300007765 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008624 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009108 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300020249 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556038-ERR599056) | Environmental | Open in IMG/M |
| 3300020250 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555986-ERR599129) | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020259 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556041-ERR599103) | Environmental | Open in IMG/M |
| 3300020262 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556100-ERR599172) | Environmental | Open in IMG/M |
| 3300020291 | Marine microbial communities from Tara Oceans - TARA_B100000315 (ERX556069-ERR599031) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020353 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX556093-ERR598998) | Environmental | Open in IMG/M |
| 3300020362 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX556035-ERR599049) | Environmental | Open in IMG/M |
| 3300020363 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX555958-ERR599173) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300026209 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102401892 | 3300000101 | Marine | MNEGQFFLAVVVLLPALYYTMKLIVWFSDKMEEKNEKK* |
| BBAY92_101822912 | 3300000947 | Macroalgal Surface | MGEWQFFLALAIMLPALYLTLKFIVWFAEKLERKK* |
| GOS2225_10054812 | 3300001939 | Marine | MGEWQFFLALGIMLPALYWTLKFIVWFAEKVERKK* |
| GOS2238_10100962 | 3300001949 | Marine | MGEWQFFLALVVMLPALYWTLKGIVWFADKVERKK* |
| GOS2234_10119382 | 3300001964 | Marine | MGEWQFFLALGVMLPALYLTLKFIVWFADKVERKK* |
| GOS2245_10181822 | 3300001966 | Marine | MSEWQFFLALVAMLPALYFTMKFIVWFAEKVERKK* |
| GOS2245_10695932 | 3300001966 | Marine | MSEWQFFLALGVMLPALYLTLKFIVWLADKIEKKK* |
| GOS2215_101303711 | 3300001971 | Marine | MNEGQFFLAVALLLPALYWTMKAIVWFAEKIEKKK* |
| Ga0066866_100014363 | 3300005514 | Marine | MSELQFFFAIAVMLPSLYFTLKFIVWVSEKIERKNEKK* |
| Ga0066866_100080303 | 3300005514 | Marine | MNEGQFFLAVAALLPALYYTMKLIVWFSEKMEEKNEKK* |
| Ga0066866_103441252 | 3300005514 | Marine | MNELQFFFTIAVMLPALYYTMKLIVWFSEKMEEKNEKK* |
| Ga0066865_101747382 | 3300005523 | Marine | MGEWQFFLALGIMLPALYYTMRFIVWFADKMEEKNEKK* |
| Ga0066852_100779241 | 3300005604 | Marine | MSELQSFFAIAVMLPSLYFTLKFIVWVSEKIERKNEKK* |
| Ga0066836_103891542 | 3300006166 | Marine | MNEGQFFLAVVVLLPALYWTLKFIVWFAEKVESKNEKK* |
| Ga0068475_10568002 | 3300006318 | Marine | MNELQFFFALAVMLPSLYFTLKFIVWFSDKIESKNEKK* |
| Ga0098038_10262852 | 3300006735 | Marine | MEEWQFFLVIALMLPALYYTMKFIVWFSEKVERKR* |
| Ga0098038_10482254 | 3300006735 | Marine | MDEWQFFLVIALMLPALYYTMKFIVWFSERVERKK* |
| Ga0098038_10659512 | 3300006735 | Marine | MNEGQFFLAIALLVPALYYTMKFIVWFAEKVENRK* |
| Ga0098038_10999632 | 3300006735 | Marine | EVMSEWQFFLVIALMLPALYYTMKLIVWFAERVERKK* |
| Ga0098037_10373063 | 3300006737 | Marine | MGEGQFFLAIALLVPALYYTMKFIVWFAEKVENRK* |
| Ga0098037_11389112 | 3300006737 | Marine | MSEWQFFLVIALMLPALYYTMKLIVWFAERVERKK* |
| Ga0098042_10026852 | 3300006749 | Marine | MSEWQFFLVIALMLPALYYTMKFIVWFAERVERKK* |
| Ga0098042_10067183 | 3300006749 | Marine | MEEWQFFLVIALMLPALYYTMKFIVWFSERVERKK* |
| Ga0098042_10301952 | 3300006749 | Marine | MGEGQFFLAIALLVPALYYTMKFIVWFAEKVEKRK* |
| Ga0098042_11084212 | 3300006749 | Marine | MGEWQFFLALGVMLPALYWTLKFIVWFADKVERKK* |
| Ga0098054_10705832 | 3300006789 | Marine | MSEWQFFLVIALMLPALYYTMKFIVWFSEKVERKR* |
| Ga0098060_10059891 | 3300006921 | Marine | GKIMDEWQFFLVIALMLPALYYTMKFIVWFSERVERKK* |
| Ga0098041_10067071 | 3300006928 | Marine | IYGGKIMDEWQFFLVIALMLPALYYTMKFIVWFSERVERKK* |
| Ga0098041_11685662 | 3300006928 | Marine | MMGEWQFFLALAVMLPALYWTLKLIVWFAEKVERKK* |
| Ga0098036_11890551 | 3300006929 | Marine | KIMSEWQFFLVIALMLPALYYTMKLIVWFAERVERKK* |
| Ga0098046_10267913 | 3300006990 | Marine | YGDKIMSEWQFFLVIALMLPALYYTMKFIVWFAERVERKK* |
| Ga0098046_10669742 | 3300006990 | Marine | YGDKIMSEWQFFLVIALMLPALYYTMKLIVWFAERVERKK* |
| Ga0101667_11092412 | 3300007116 | Volcanic Co2 Seep Seawater | MGEWQFFLALGVMLPALYWTLKFIVWFADKVERKK*KKYS |
| Ga0105011_11655902 | 3300007508 | Marine | MKELQFFFTLAVMLPALYFTLKFIVWIAEKIESKK* |
| Ga0105018_11603172 | 3300007760 | Marine | MSELQFFFALAVMLPSLYFTLKFIVWIAEKIESKK* |
| Ga0105010_11130692 | 3300007765 | Marine | MSELQFFFALAVMLPALYFTLKFIVWFAEKIESKK* |
| Ga0098052_12282892 | 3300008050 | Marine | ELQFFFTLAIMLPALYFTMKFIVWLSEKIENKNEKK* |
| Ga0115652_10243072 | 3300008624 | Marine | MSELQFFFTLAAMLPALYFTMKFVVWIAEKIESKK* |
| Ga0117920_10012884 | 3300009108 | Marine | MSELQFFFTLAVMLPALYFTLKFIVWIAEKIESKK* |
| Ga0115546_11472922 | 3300009435 | Pelagic Marine | MNEGQFFLAVATLLPALYYTMKLIVWFSEKMEEKNEKK* |
| Ga0114932_100099336 | 3300009481 | Deep Subsurface | MIDKWQFFLALLALVPSLYFTMKFIVWFAEKVEDKK* |
| Ga0114932_100130434 | 3300009481 | Deep Subsurface | MSELQFFLAVAALLPALYLTMTFIVWFSDKMEGKNEKK* |
| Ga0114932_100782322 | 3300009481 | Deep Subsurface | MNEGQFFLAVAALLPALYYTMKLIVWFADKMEEKNEKK* |
| Ga0114932_100919614 | 3300009481 | Deep Subsurface | GQFFLAVAAMLPALYYTMKLIVWFSDKMEEKNEKK* |
| Ga0114932_104729852 | 3300009481 | Deep Subsurface | MNEGQFFLAVAALLPALYYTMKLIVWFADKKEEKNEKK* |
| Ga0114932_105731121 | 3300009481 | Deep Subsurface | MNEGQFFLAVAAMLPALYYTMKLIVWFSDKMEEKNEKK* |
| Ga0115572_103975851 | 3300009507 | Pelagic Marine | MNEGQFFLAVAALLPALYYTMKLIVWFSDKMEEKNEKK* |
| Ga0115013_100141435 | 3300009550 | Marine | MSEWQFFLAVALMLPALYWTMKFIVWFAERVERKK* |
| Ga0115011_102734412 | 3300009593 | Marine | MNEGQFFLAVAALLPALYWTLKFIVWFAEKVESKNEKK* |
| Ga0114933_1000201516 | 3300009703 | Deep Subsurface | MIDEWQFFLALLALVPSLYFTMKFIVWFAEKVEDKK* |
| Ga0114933_102977942 | 3300009703 | Deep Subsurface | MNELQFFLALLVLLPSLYWTVKFIVWFAEKIEGKK* |
| Ga0114933_103623511 | 3300009703 | Deep Subsurface | NEGQFFLAVAALLPALYYTMKLIVWFSEKMEEKNEKK* |
| Ga0115012_101292203 | 3300009790 | Marine | MNEGQFFLAIALLLPALYWTMKFIVWFAEKVERKK* |
| Ga0115012_102776412 | 3300009790 | Marine | MNELQFFFALAVMLPSLYFTLKFIVWISDKIESKNEKK* |
| Ga0115012_118619981 | 3300009790 | Marine | GGEIMGEWQFFLALGVMLPALYWTLKFIVWFADKVERKK* |
| Ga0098043_10516502 | 3300010148 | Marine | MGEWQFFLALSVMLPALYWTLKFIVWFAEKVERKK* |
| Ga0133547_109797512 | 3300010883 | Marine | MMNEGQFFLAVVVLLPALYYTMKLIVWFSDKMEEKNEKK* |
| Ga0151677_10135202 | 3300011258 | Marine | MGEWQFFLALGVMLPALYWTLKFIVWFAEKVERKK* |
| Ga0160422_107548472 | 3300012919 | Seawater | MGEWQFFLALAVMLPALYWTLKFIVWFADKVERKK* |
| Ga0160423_101095792 | 3300012920 | Surface Seawater | MGEWQFFLALAIMLPALYWTLKFIVWFAEKIERKK* |
| Ga0160423_101932612 | 3300012920 | Surface Seawater | MGEWQFFLALAIMLPALYWTLKLIVWFAEKVERKK* |
| Ga0163110_103494491 | 3300012928 | Surface Seawater | MMGEWQFFLALVVMLPALYWTLKGIVWFADKVERKK* |
| Ga0163110_106381412 | 3300012928 | Surface Seawater | MGEWQFFLALGVMLPALYWTLKLIVWFAEKIEGKK* |
| Ga0163110_111896892 | 3300012928 | Surface Seawater | MNEGQFFLAVALMLPALYFTMKGIVWFAEKIEKKK* |
| Ga0163109_106781592 | 3300012936 | Surface Seawater | MGEWQFFLALGVMLLSLYWTLKFIVWFADKVERKK* |
| Ga0181377_10053382 | 3300017706 | Marine | MGEWQFFLALAIMLPTLYWTLKFIVWFAEKMERKK |
| Ga0181369_10123602 | 3300017708 | Marine | MSEWQFFLVIALMLPALYYTMKLIVWFSERVERKK |
| Ga0181390_11753922 | 3300017719 | Seawater | MNEGQFFLAVVVLLPALYYTMKLIVWFSEKMEEKNEKK |
| Ga0181373_10053983 | 3300017721 | Marine | MDEWQFFLVIALMLPALYYTMKFIVWFAERVERKK |
| Ga0187219_11297432 | 3300017751 | Seawater | MMNEGQFFLAVVVLLPALYYTMKLIVWFSEKMEEKNEKK |
| Ga0211635_10183832 | 3300020249 | Marine | MNEGQFFLAVAALLPALYYTMKLIVWFSDKMEEKNEKK |
| Ga0211627_10093462 | 3300020250 | Marine | MNEGQFFLAVAALLPALYYTMKLIVWFSEKMEEKNEKK |
| Ga0211529_10082782 | 3300020258 | Marine | MGEWQFFLALGVMLPALYWTLKFIVWFAEKVERKK |
| Ga0211633_10218871 | 3300020259 | Marine | MNELQFFFALAVMLPSLYFTLKFIVWFSDKIESKNEKK |
| Ga0211537_10933772 | 3300020262 | Marine | MSELQFFFTLAAMLPALYFTMKFVVWIAEKIESKK |
| Ga0211524_10262442 | 3300020291 | Marine | IYGGEIMSELQFFFTLAAMLPALYFTMKFVVWIAEKIESKK |
| Ga0211542_10236982 | 3300020312 | Marine | MNEGQFFLALILMLPALYFTMKFIVWFAEKVEKKK |
| Ga0211542_10294742 | 3300020312 | Marine | MSEWQFFLALGVMLPALYFTLKFIVWLADKIEKKK |
| Ga0211613_10143252 | 3300020353 | Marine | MNELQFFFALAVMLPSLYFTLKFIVWISDKIESKNEKK |
| Ga0211613_10524492 | 3300020353 | Marine | MSELQFFLAVAALLPALYLTMTFIVWFSDKMEGKNEKK |
| Ga0211488_101033952 | 3300020362 | Marine | MSEWQFFLALGVMLPALYLTLKFIVWLADKIEKKK |
| Ga0211488_101086292 | 3300020362 | Marine | MGEWQFFLALGIMLPALYWTLKLIVWFAEKIERKK |
| Ga0211493_10871722 | 3300020363 | Marine | MNEGQFFLAVAALLPALYYTMKLIVWFSEKMEEKNY |
| Ga0211477_100055393 | 3300020374 | Marine | MIDKWQFFLALLALVPSLYFTMKFIVWFAEKVEDKK |
| Ga0211652_100179734 | 3300020379 | Marine | MSEWQFFLVIALMLPALYYTMKFIVWFAERVERKK |
| Ga0211677_100195492 | 3300020385 | Marine | MSEWQFFLVIALMLPALYWTMKFIVWFAERVERKK |
| Ga0211659_100026492 | 3300020404 | Marine | MSEWQFFLVIALMLPALYYTMKLIVWFAERVERKK |
| Ga0211699_101417132 | 3300020410 | Marine | MNEGQFFLAVALLLPALYWTMRFIVWFAEKVERKK |
| Ga0211587_101787932 | 3300020411 | Marine | MNELQFFFALAVMLPSLYFTLRFIVWISDKIERKNEKK |
| Ga0211644_100571642 | 3300020416 | Marine | MMGEWQFFLALAVMLPALYWTLKLIVWFAEKVERKK |
| Ga0211644_100745252 | 3300020416 | Marine | MGEWQFFLALAVMLPALYWTLKGIVWFAEKVERKK |
| Ga0211644_104517092 | 3300020416 | Marine | MGEWQFFLALAVMLPALYWTLKGIVWFADKVERKK |
| Ga0211528_100270552 | 3300020417 | Marine | MNEGQFFLALALMIPALYFTMKAIVWFAEKVEKKK |
| Ga0211653_1000143021 | 3300020421 | Marine | DKIMSEWQFFLVIALMLPALYYTMKFIVWFAERVERKK |
| Ga0211521_100764442 | 3300020428 | Marine | MIDEWQFFLALLALVPSLYFTMKFIVWFAEKVEDKK |
| Ga0211622_101596611 | 3300020430 | Marine | MGEWQFFLALVVMLPALYWTLKGIVWFADKVERKK |
| Ga0211554_105613881 | 3300020431 | Marine | MMNEGQFFLAVVVLLPALYYTMKLIVWFSDKMEEKNEKK |
| Ga0211708_103655841 | 3300020436 | Marine | MNEGQFFLAIALLLPALYWTMKFIVWFAEKVERKK |
| Ga0211539_104861152 | 3300020437 | Marine | MGEWQFFLALGIMLPALYWTLKFIVWFADKVERKK |
| Ga0211576_100114182 | 3300020438 | Marine | MDEWQFFLALAIMLPALYWTLKFIVWFAEKVERKK |
| Ga0211559_102146922 | 3300020442 | Marine | MNEGQFFLAVALMLPALYFTMKGIVWFAEKIEKKK |
| Ga0211564_102946332 | 3300020445 | Marine | MNELQFFFTIAVMLPALYYTMKLIVWFSEKMEEKNEKK |
| Ga0211548_106730712 | 3300020454 | Marine | MNEGQFFLAVALMLPALYWTMKFIVWFAEKVERKK |
| Ga0211643_100798954 | 3300020457 | Marine | GKIMGEWQFFLALGVMLPALYWTLKLIVWFAEKIEGKK |
| Ga0211694_101553432 | 3300020464 | Marine | MNEGQFFLAVVLMLPALYWTMRFIVWFAEKVERKK |
| Ga0211475_102206642 | 3300020468 | Marine | MIDEWQFFLALLALVPSLYFTMKFIVWFAEKVEGKK |
| Ga0211543_100747864 | 3300020470 | Marine | GGEIMSEWQFFLALVVMLPALYLTLKFIVWFADKIESKNEKK |
| Ga0211543_103543782 | 3300020470 | Marine | MNELQFFFTIAVMLPALYLTMKFIVWISEKIESKNEKK |
| Ga0211503_100605941 | 3300020478 | Marine | MSELQFFVAVAALLPALYFTLRFIVWISDKIERKNEKK |
| Ga0206126_100970932 | 3300020595 | Seawater | MNEWQFFLTVAALLPALYYTMKLIVWFSEKMEEKNEKK |
| Ga0209992_101008043 | 3300024344 | Deep Subsurface | HGDKMIDEWQFFLALLALVPSLYFTMKFIVWFAEKVEDKK |
| Ga0209992_104199232 | 3300024344 | Deep Subsurface | MNEGQFFLAVAAMLPALYYTMKLIVWFSDKMEEKNEKK |
| Ga0208667_10583302 | 3300025070 | Marine | MGEWQFFLALGIMLPALYWTLKFIVWFAEKVERKK |
| Ga0208791_10735742 | 3300025083 | Marine | MGEGQFFLAIALLVPALYYTMKFIVWFAEKVEKRK |
| Ga0208157_10142342 | 3300025086 | Marine | MDEWQFFLVIALMLPALYYTMKFIVWFSERVERKK |
| Ga0208159_10323691 | 3300025101 | Marine | MEEWQFFLVIALMLPALYYTMKFIVWFSERVERKK |
| Ga0208666_10406932 | 3300025102 | Marine | MEEWQFFLVIALMLPALYYTMKFIVWFSEKVERKR |
| Ga0208919_10493373 | 3300025128 | Marine | GKIMDEWQFFLVIALMLPALYYTMKFIVWLSERVERKK |
| Ga0209232_10171934 | 3300025132 | Marine | MGEGQFFLAIALLLPALYYTMKFIVWFAEKVERKK |
| Ga0209232_11816811 | 3300025132 | Marine | MGEGQFFLAIALLVPALYYTMKFIVWFAEKVEKRKXK |
| Ga0209645_10683812 | 3300025151 | Marine | MGEWQFFLALAIMLPALYWTLKFIVWFAEKIERKK |
| Ga0209645_10733692 | 3300025151 | Marine | MSEWQFFLALVAMLPALYFTMKFIVWFAEKVERKK |
| Ga0209645_11517081 | 3300025151 | Marine | MNEGQFFLALALMLPALYWTMKFIVWFAEKVEKKK |
| Ga0207989_100008537 | 3300026209 | Marine | MSELQFFFAIAVMLPSLYFTLKFIVWVSEKIERKNEKK |
| Ga0207989_10851801 | 3300026209 | Marine | EGQFFLAVAALLPALYYTMKLIVWFSEKMEEKNEKK |
| Ga0209404_103764632 | 3300027906 | Marine | MNELQFFFAIAVMLPSLYFTLKFIVWISEKIESKNEKK |
| Ga0183748_10159532 | 3300029319 | Marine | MGEWQFFLALAIMLPALYWTLKFIVWFAEKVERKK |
| Ga0183748_10365412 | 3300029319 | Marine | MNEGQFFLALILMLPALYFTMKFIVWFAEKIEKKK |
| Ga0183748_10678872 | 3300029319 | Marine | MNEGQFFLALILMIPALYFTMKGIVWFAEKIEKKK |
| Ga0183755_10192612 | 3300029448 | Marine | MNEGQFFLAVAALLPALYYTMKLIVWFADKMEEKNEKK |
| ⦗Top⦘ |