NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F063058

Metagenome Family F063058

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063058
Family Type Metagenome
Number of Sequences 130
Average Sequence Length 44 residues
Representative Sequence MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGTQVTPVLDGTR
Number of Associated Samples 99
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.77 %
% of genes near scaffold ends (potentially truncated) 35.38 %
% of genes from short scaffolds (< 2000 bps) 82.31 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (56.923 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(19.231 % of family members)
Environment Ontology (ENVO) Unclassified
(36.923 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(60.769 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 38.89%    β-sheet: 0.00%    Coil/Unstructured: 61.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF02824TGS 30.00
PF04972BON 27.69
PF07973tRNA_SAD 14.62
PF00133tRNA-synt_1 6.15
PF13620CarboxypepD_reg 0.77
PF13443HTH_26 0.77
PF00587tRNA-synt_2b 0.77
PF10458Val_tRNA-synt_C 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.15
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.15
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.15
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 6.15


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms56.92 %
UnclassifiedrootN/A43.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0706148Not Available612Open in IMG/M
3300000890|JGI11643J12802_12271022Not Available595Open in IMG/M
3300000953|JGI11615J12901_11144439Not Available618Open in IMG/M
3300002899|JGIcombinedJ43975_10102907Not Available524Open in IMG/M
3300003319|soilL2_10057802All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2310Open in IMG/M
3300003324|soilH2_10061949All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1386Open in IMG/M
3300004114|Ga0062593_100118398All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1922Open in IMG/M
3300004114|Ga0062593_100487260All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1138Open in IMG/M
3300004114|Ga0062593_100576076All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1066Open in IMG/M
3300004114|Ga0062593_100785885All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium944Open in IMG/M
3300004114|Ga0062593_100800339Not Available937Open in IMG/M
3300004114|Ga0062593_101023519All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes849Open in IMG/M
3300004463|Ga0063356_102805495All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes750Open in IMG/M
3300004479|Ga0062595_101268772Not Available660Open in IMG/M
3300004480|Ga0062592_102349802Not Available534Open in IMG/M
3300004643|Ga0062591_100368222Not Available1171Open in IMG/M
3300005327|Ga0070658_10092264All Organisms → cellular organisms → Bacteria2497Open in IMG/M
3300005327|Ga0070658_10627564Not Available932Open in IMG/M
3300005329|Ga0070683_101475717Not Available654Open in IMG/M
3300005334|Ga0068869_100798212Not Available811Open in IMG/M
3300005339|Ga0070660_101347291All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes606Open in IMG/M
3300005340|Ga0070689_100527282Not Available1015Open in IMG/M
3300005345|Ga0070692_10114016All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1499Open in IMG/M
3300005355|Ga0070671_100126029All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2156Open in IMG/M
3300005355|Ga0070671_100824126All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes809Open in IMG/M
3300005364|Ga0070673_100084726All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2578Open in IMG/M
3300005406|Ga0070703_10427549Not Available582Open in IMG/M
3300005456|Ga0070678_101867278Not Available567Open in IMG/M
3300005471|Ga0070698_100629209All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1014Open in IMG/M
3300005526|Ga0073909_10059708All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1410Open in IMG/M
3300005548|Ga0070665_100041836All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4606Open in IMG/M
3300005548|Ga0070665_102507803Not Available517Open in IMG/M
3300005577|Ga0068857_100569479All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1068Open in IMG/M
3300005616|Ga0068852_102719066All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes514Open in IMG/M
3300005840|Ga0068870_10936390Not Available614Open in IMG/M
3300006169|Ga0082029_1412513All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1822Open in IMG/M
3300006169|Ga0082029_1669335All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1793Open in IMG/M
3300006237|Ga0097621_100930524All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes811Open in IMG/M
3300006844|Ga0075428_100040641All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes5115Open in IMG/M
3300006844|Ga0075428_100100042All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3162Open in IMG/M
3300006844|Ga0075428_100339972All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1612Open in IMG/M
3300006844|Ga0075428_101158265Not Available816Open in IMG/M
3300006844|Ga0075428_101264069All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes777Open in IMG/M
3300006845|Ga0075421_100020481All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis8313Open in IMG/M
3300006845|Ga0075421_100022146All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis8003Open in IMG/M
3300006845|Ga0075421_100127144All Organisms → cellular organisms → Bacteria3196Open in IMG/M
3300006845|Ga0075421_101874346Not Available643Open in IMG/M
3300006846|Ga0075430_100001308All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis20082Open in IMG/M
3300006846|Ga0075430_100676173All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes851Open in IMG/M
3300006847|Ga0075431_100498556All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1209Open in IMG/M
3300006871|Ga0075434_101141290Not Available792Open in IMG/M
3300006876|Ga0079217_10153831All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1117Open in IMG/M
3300006876|Ga0079217_10281590Not Available909Open in IMG/M
3300006876|Ga0079217_11051614Not Available602Open in IMG/M
3300006880|Ga0075429_101985580Not Available504Open in IMG/M
3300006894|Ga0079215_10036991All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1797Open in IMG/M
3300006954|Ga0079219_10466654All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes869Open in IMG/M
3300007004|Ga0079218_11993124Not Available662Open in IMG/M
3300009100|Ga0075418_11372827Not Available766Open in IMG/M
3300009156|Ga0111538_13479638Not Available546Open in IMG/M
3300010042|Ga0126314_10417957Not Available967Open in IMG/M
3300010044|Ga0126310_10444217All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes935Open in IMG/M
3300010045|Ga0126311_11739158Not Available527Open in IMG/M
3300010166|Ga0126306_10119410All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1928Open in IMG/M
3300012519|Ga0157352_1079373Not Available546Open in IMG/M
3300012911|Ga0157301_10447232Not Available512Open in IMG/M
3300012971|Ga0126369_10579776All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1189Open in IMG/M
3300013104|Ga0157370_12122257Not Available503Open in IMG/M
3300013105|Ga0157369_10991775Not Available860Open in IMG/M
3300015262|Ga0182007_10028509All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1917Open in IMG/M
3300015371|Ga0132258_10012638All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis17792Open in IMG/M
3300015373|Ga0132257_100413334All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1642Open in IMG/M
3300015374|Ga0132255_104689737Not Available579Open in IMG/M
3300017792|Ga0163161_10847302Not Available771Open in IMG/M
3300018469|Ga0190270_10472419All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1186Open in IMG/M
3300018476|Ga0190274_10082529All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2480Open in IMG/M
3300019377|Ga0190264_11450784Not Available592Open in IMG/M
3300019377|Ga0190264_11460940Not Available591Open in IMG/M
3300021445|Ga0182009_10786768All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes520Open in IMG/M
3300025321|Ga0207656_10143213All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1128Open in IMG/M
3300025899|Ga0207642_10093038All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1494Open in IMG/M
3300025899|Ga0207642_10976993All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes545Open in IMG/M
3300025904|Ga0207647_10033497All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3290Open in IMG/M
3300025908|Ga0207643_10012073All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4665Open in IMG/M
3300025908|Ga0207643_11130160Not Available505Open in IMG/M
3300025919|Ga0207657_10030520All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae4892Open in IMG/M
3300025920|Ga0207649_10203533All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium1400Open in IMG/M
3300025925|Ga0207650_10641910Not Available894Open in IMG/M
3300025931|Ga0207644_10887906All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes747Open in IMG/M
3300025936|Ga0207670_10511387Not Available977Open in IMG/M
3300025937|Ga0207669_10983865Not Available708Open in IMG/M
3300025942|Ga0207689_10847722All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes771Open in IMG/M
3300025944|Ga0207661_11313807Not Available664Open in IMG/M
3300025972|Ga0207668_11356488Not Available641Open in IMG/M
3300026088|Ga0207641_10028269All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae4632Open in IMG/M
3300026088|Ga0207641_10941363All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes859Open in IMG/M
3300026088|Ga0207641_11116224Not Available787Open in IMG/M
3300026116|Ga0207674_11346708Not Available683Open in IMG/M
3300026121|Ga0207683_10148839All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2112Open in IMG/M
3300027637|Ga0209818_1102862Not Available758Open in IMG/M
3300027691|Ga0209485_1012137All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1853Open in IMG/M
3300027750|Ga0209461_10094666Not Available670Open in IMG/M
3300027880|Ga0209481_10258968Not Available877Open in IMG/M
3300027880|Ga0209481_10298558Not Available817Open in IMG/M
3300027886|Ga0209486_10496169Not Available758Open in IMG/M
3300027886|Ga0209486_10585400Not Available705Open in IMG/M
3300027907|Ga0207428_10298650All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1192Open in IMG/M
3300027907|Ga0207428_11177204Not Available534Open in IMG/M
3300027907|Ga0207428_11278827Not Available509Open in IMG/M
3300027909|Ga0209382_10008747All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis12740Open in IMG/M
3300027909|Ga0209382_10120127All Organisms → cellular organisms → Bacteria3065Open in IMG/M
3300027909|Ga0209382_10266901All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1939Open in IMG/M
3300027909|Ga0209382_10799695All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1004Open in IMG/M
3300028379|Ga0268266_10062964All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3202Open in IMG/M
3300028592|Ga0247822_11628572All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes548Open in IMG/M
3300031538|Ga0310888_10027755All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2459Open in IMG/M
3300031548|Ga0307408_102092101Not Available546Open in IMG/M
3300031731|Ga0307405_10311979All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1198Open in IMG/M
(restricted) 3300031825|Ga0255338_1000107All Organisms → cellular organisms → Bacteria378180Open in IMG/M
3300031892|Ga0310893_10168391All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes864Open in IMG/M
3300031903|Ga0307407_10747625All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes740Open in IMG/M
3300031911|Ga0307412_10954453Not Available755Open in IMG/M
3300031943|Ga0310885_10286208Not Available847Open in IMG/M
3300031995|Ga0307409_100802356All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae949Open in IMG/M
3300032000|Ga0310903_10107867All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1195Open in IMG/M
3300032013|Ga0310906_10074392Not Available1775Open in IMG/M
3300032017|Ga0310899_10099014All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1173Open in IMG/M
3300032074|Ga0308173_11838391Not Available571Open in IMG/M
3300033412|Ga0310810_10312662All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1679Open in IMG/M
3300034147|Ga0364925_0085528All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1107Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere19.23%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.15%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.62%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.31%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.54%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest1.54%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.54%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.54%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.77%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.77%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.77%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.77%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.77%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.77%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031825 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_070614822228664021SoilMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRFGTQVTPLLDGTR
JGI11643J12802_1227102213300000890SoilPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR*
JGI11615J12901_1114443923300000953SoilMPPQDRVPIGRVIPWVVLVVLLIAGLILYFRYGAQVTPLLNGTR*
JGIcombinedJ43975_1010290713300002899SoilVSYPMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR*
soilL2_1005780223300003319Sugarcane Root And Bulk SoilMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGAQVTPLLNSTR*
soilH2_1006194913300003324Sugarcane Root And Bulk SoilMPPQDRVPIGRVIPWVVLVVLLIAGLILYFRYGAQVTPLLDGTR*
Ga0062593_10011839823300004114SoilMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR*
Ga0062593_10048726013300004114SoilMAPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR*
Ga0062593_10057607623300004114SoilMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR*
Ga0062593_10078588523300004114SoilMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR*
Ga0062593_10080033923300004114SoilMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGTQVTPVLDGTR*
Ga0062593_10102351913300004114SoilMPPQERVPIGRVIPWVVLVVLLFAGLVLYFRYGSQVTSLIDGPR*
Ga0063356_10280549513300004463Arabidopsis Thaliana RhizosphereMPPQDRVPMGRVIPWVVLVVLLIAGLVLYFKYGTQVTPLLDGTR*
Ga0062595_10126877213300004479SoilMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR*
Ga0062592_10234980213300004480SoilMPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQVTPLLDGTR*
Ga0062591_10036822213300004643SoilMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDATR*
Ga0070658_1009226413300005327Corn RhizosphereLTLYHTMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR*
Ga0070658_1062756423300005327Corn RhizospherePQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR*
Ga0070683_10147571713300005329Corn RhizosphereLTVSHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR*
Ga0068869_10079821213300005334Miscanthus RhizosphereLTVSHTMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR*
Ga0070660_10134729113300005339Corn RhizosphereMPPQERVPIGRVIPWVILVVLLFAGLVLYFLYGSQVTSLIDGPR*
Ga0070689_10052728213300005340Switchgrass RhizospherePMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLNSTR*
Ga0070692_1011401623300005345Corn, Switchgrass And Miscanthus RhizosphereMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLNSTR*
Ga0070671_10012602913300005355Switchgrass RhizosphereMPPQERIPIGRVIPWVVLVVLLLAGLVLYFRYGPQVTSLLDGTR*
Ga0070671_10082412623300005355Switchgrass RhizosphereMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPVLNSTR*
Ga0070673_10008472633300005364Switchgrass RhizosphereMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDG
Ga0070703_1042754923300005406Corn, Switchgrass And Miscanthus RhizosphereLELTVSYPMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR*
Ga0070678_10186727813300005456Miscanthus RhizosphereMPPQERVPIGRVIPWVILVVLLFAGLVLYFRYGSQVTSLLDGPR*
Ga0070698_10062920913300005471Corn, Switchgrass And Miscanthus RhizosphereMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGTKVTPLLDGTR*
Ga0073909_1005970823300005526Surface SoilMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGGQVTPLLDSTR*
Ga0070665_10004183633300005548Switchgrass RhizosphereMPPQDRVPIGRVIPWVVLVLLLIAGVVLYFRYGTQITPLLDGTR*
Ga0070665_10250780323300005548Switchgrass RhizosphereLYHTMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR*
Ga0068857_10056947923300005577Corn RhizosphereMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTP
Ga0068852_10271906623300005616Corn RhizosphereMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITP
Ga0068870_1093639023300005840Miscanthus RhizosphereTVSHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR*
Ga0082029_141251323300006169Termite NestMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTRVTPILDSTR*
Ga0082029_166933533300006169Termite NestMPPQDRVPIGRVIPWVILVVLLIVGLVLYFQYGADVTPLVDGTR*
Ga0097621_10093052413300006237Miscanthus RhizosphereMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLQHALSG
Ga0075428_10004064133300006844Populus RhizosphereMPPQDRAPIGRVIPWVVLIVLLLAGLVLYFRYGARVTPILDSTR*
Ga0075428_10010004223300006844Populus RhizosphereMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPILDSTR*
Ga0075428_10033997223300006844Populus RhizosphereMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRFGTQVTPLLDGTR*
Ga0075428_10115826523300006844Populus RhizosphereIGRVIPWVVLIVLLLAGLVLYFRYGTGVTPVLNSTR*
Ga0075428_10126406913300006844Populus RhizosphereMPPQDRIPIGRVIPWVVLVVLLIGGLVLYFTYGSRVTPLLDGTR*
Ga0075421_10002048163300006845Populus RhizosphereMLPQDRVPIGRVIPWVILVVLLVVGLVLYFQYGADVTPLVDGTR*
Ga0075421_10002214643300006845Populus RhizosphereMPPQDRVPIGRVIPWVILVVLLVVGLVLYFRYGADVTPLVDGTR*
Ga0075421_10012714423300006845Populus RhizosphereMPPQDRVPIGRVIPWVVLLVLLVAGVVLYFRYGTQITPLLDGTR*
Ga0075421_10187434613300006845Populus RhizosphereMPPQDRVPIGRVIPWVVLVVLLIAGLVLYLRYGVQVTPLLDGTR*
Ga0075430_10000130893300006846Populus RhizosphereMPPQDRVPIGRVIPWVILVVLLIAGLVLYFSYGSDVTPLLDGTR*
Ga0075430_10067617313300006846Populus RhizosphereMPPQDRVPIGRVIPWVVLVVLLIAGLVLYLRYGVQVTPLLDGT
Ga0075431_10049855613300006847Populus RhizosphereMPPQDRIPIGRVIPWVVLVVLLIGGLVLYFTYGSRVTPLLDGT
Ga0075434_10114129023300006871Populus RhizosphereVPIGRVIPWVVLVILLVAGLVLYFRYGNQVTPLLDGTR*
Ga0079217_1015383123300006876Agricultural SoilMPPQERVPIGRVIPWVILVVLLIAGLVLYFSYGSDVTPLLDGSR*
Ga0079217_1028159023300006876Agricultural SoilMPPQDRVPIGRVIPWVILVVLLLAGIVLYFRYGTQVTPLLDGTP*
Ga0079217_1105161423300006876Agricultural SoilMPPQDRVPLGRVIPWVVLVVLLITGLVLYFRYGTQVTPLLDGTR*
Ga0075429_10198558023300006880Populus RhizosphereMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTGVTPVLNSTR*
Ga0079215_1003699123300006894Agricultural SoilMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGAQVTPLLDGTR*
Ga0079219_1046665413300006954Agricultural SoilMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFLYGGHVTPLLDGT
Ga0079218_1199312423300007004Agricultural SoilIGRVIPWVVLVVLLLAGLVLYLRYGAQVTPLLNGTR*
Ga0075418_1137282723300009100Populus RhizosphereMPPQDRIPIGRVIPWVVLVVLLIEGLVLYFTYGSRVTPLLDGTR*
Ga0111538_1347963823300009156Populus RhizosphereRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR*
Ga0126314_1041795713300010042Serpentine SoilGRVIPWVVVLVLLIAGVVLYLRYGTQMTPLLDGTR*
Ga0126310_1044421713300010044Serpentine SoilMPPQERVPIGRVIPWVVLVVLLFAGLVLYFRYGSQVTSLLDGPR*
Ga0126311_1173915813300010045Serpentine SoilHTMPPQERVPIGRVIPWVILVVLLFAGLVLYFRYGPQVTSLLDGPR*
Ga0126306_1011941013300010166Serpentine SoilMPPQDRVPIGRVIPWVVLVALLIAGVVLYFRYGTQITPLLDGTR*
Ga0157352_107937313300012519Unplanted SoilMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGARVTPILDSTR*
Ga0157301_1044723213300012911SoilMPPQDRVPIGRVIPWIVLVVLLLAGVVLYFRYGTQVTPLLDGTC*
Ga0126369_1057977623300012971Tropical Forest SoilMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVAPVLDSTR*
Ga0157370_1212225713300013104Corn RhizosphereMAPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLDSTR*
Ga0157369_1099177523300013105Corn RhizosphereMAPQDRVPIGRVIPLVVLVVLLLAGLVLYFRYGTQVAPVLDSTR*
Ga0182007_1002850923300015262RhizosphereMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFLYGRQVTPLLDGTR*
Ga0132258_1001263883300015371Arabidopsis RhizosphereMSPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGGQVTPLLDSTR*
Ga0132257_10041333413300015373Arabidopsis RhizosphereMPPQDRAPIGRVIPWVVLVVLLLAGLVLYFRYGARVTPILDSTR*
Ga0132255_10468973713300015374Arabidopsis RhizosphereMPPQDRVPIGRVIPWVVLVVLLVAGLVLYFRYGGQVTPLLDGTR*
Ga0163161_1084730223300017792Switchgrass RhizosphereMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR
Ga0190270_1047241923300018469SoilMPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQVTPLLDGTR
Ga0190274_1008252913300018476SoilMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR
Ga0190264_1145078413300019377SoilMPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGAGTTPLLDGTR
Ga0190264_1146094013300019377SoilMSPQDRVPIGRVIPWVVLVVLLIAGLVLYFRFVTQVTPLLDATR
Ga0182009_1078676813300021445SoilMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLD
Ga0207656_1014321323300025321Corn RhizosphereMAPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR
Ga0207642_1009303823300025899Miscanthus RhizosphereMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPVLNSTR
Ga0207642_1097699323300025899Miscanthus RhizosphereMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQV
Ga0207647_1003349733300025904Corn RhizosphereMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR
Ga0207643_1001207333300025908Miscanthus RhizosphereMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDATR
Ga0207643_1113016013300025908Miscanthus RhizosphereAPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR
Ga0207657_1003052043300025919Corn RhizosphereMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLNSTR
Ga0207649_1020353323300025920Corn RhizosphereQSMPPQERVPIGRVIPWVVLVVLLFAGLVLYFRYGSQVTSLIDGPR
Ga0207650_1064191023300025925Switchgrass RhizosphereTVSHTMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR
Ga0207644_1088790623300025931Switchgrass RhizosphereMPPQERVPIGRVIPWVILVVLLFAGLVLYFRYGSQVTSLLDGPR
Ga0207670_1051138723300025936Switchgrass RhizosphereLTVYHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLNSTR
Ga0207669_1098386523300025937Miscanthus RhizosphereQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPVLNSTR
Ga0207689_1084772213300025942Miscanthus RhizosphereMPPQERVPIGRVIPWVILVVLLFAGLVLYFRYGSQVTSLLDGP
Ga0207661_1131380713300025944Corn RhizosphereLTVSHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR
Ga0207668_1135648823300025972Switchgrass RhizosphereMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGTQVTSLLD
Ga0207641_1002826933300026088Switchgrass RhizosphereSYPMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR
Ga0207641_1094136323300026088Switchgrass RhizosphereMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLD
Ga0207641_1111622423300026088Switchgrass RhizosphereLLLTLYHTMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR
Ga0207674_1134670823300026116Corn RhizosphereMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFLYGRQVTPLLDGTR
Ga0207683_1014883933300026121Miscanthus RhizosphereMPPQERVPIGRVIPWVVLVVLLFAGLVLYFRYGSQVTSLLDGPR
Ga0209818_110286213300027637Agricultural SoilQDRVPIGRVIPWVILVVLLLAGIVLYFRYGTQVTPLLDGTP
Ga0209485_101213733300027691Agricultural SoilMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGAQVTPLLDGTR
Ga0209461_1009466623300027750AgaveMPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQITPLLDGTR
Ga0209481_1025896813300027880Populus RhizosphereTMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR
Ga0209481_1029855813300027880Populus RhizosphereHPMPPQDRAPIGRVIPWVVLIVLLLAGLVLYFRYGARVTPILDSTR
Ga0209486_1049616923300027886Agricultural SoilMPPQDRVPMGRVIPWVVLVVLLIAGLVLYFKYGTQVTPLLDGTR
Ga0209486_1058540013300027886Agricultural SoilMPPQDRVPIGRVIPWVILVVLLLAGIVLYFRYGTQVTPLLDGTP
Ga0207428_1029865013300027907Populus RhizosphereMPPQDRAPIGRVIPWVVLIVLLLAGLVLYFRYGARVTPILDSTR
Ga0207428_1117720423300027907Populus RhizosphereMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTGVTP
Ga0207428_1127882723300027907Populus RhizosphereEGHLELTVSHPMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTGVTPVLNSTR
Ga0209382_1000874793300027909Populus RhizosphereMLPQDRVPIGRVIPWVILVVLLVVGLVLYFQYGADVTPLVDGTR
Ga0209382_1012012733300027909Populus RhizosphereMPPQDRVPIGRVIPWVILVVLLVVGLVLYFRYGADVTPLVDGTR
Ga0209382_1026690133300027909Populus RhizosphereMPPQDRVPIGRVIPWVVLLVLLVAGVVLYFRYGTQITPLLDGTR
Ga0209382_1079969523300027909Populus RhizosphereMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPILDSTR
Ga0268266_1006296423300028379Switchgrass RhizosphereMPPQDRVPIGRVIPWVVLVLLLIAGVVLYFRYGTQITPLLDGTR
Ga0247822_1162857213300028592SoilMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTGVTPVLNSTR
Ga0310888_1002775533300031538SoilMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGGQVTPLLDSTR
Ga0307408_10209210113300031548RhizosphereGRVIPWVVLVVLLIAGVVLYFRYGTQVTPLLDGTR
Ga0307405_1031197923300031731RhizosphereMPPQDRVPIGRVIPWVVVLVLLIAGVVLYLRYGTQITPLLDGTR
(restricted) Ga0255338_10001071683300031825Sandy SoilVPTGRVIPWVILLVLLVAGLVLYFRYGGGVSPLLDGTR
Ga0310893_1016839123300031892SoilMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTE
Ga0307407_1074762523300031903RhizosphereMPPQDRVPMGRVIPWVVLVLLLIAGLVLYFKYGTQVTPLLDGTR
Ga0307412_1095445323300031911RhizosphereMPSPDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQVTPLLDGTR
Ga0310885_1028620823300031943SoilMPPQDRVPIGRVIPWVVLVVLLLAGLVLYLRYGAQVTPLLDGTR
Ga0307409_10080235623300031995RhizosphereMPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGTKVTPVLDGTR
Ga0310903_1010786713300032000SoilMPPQDRVPIGRVIPWIVLIVLLLAGLVLYFRYGTEVTPVLNSTR
Ga0310906_1007439223300032013SoilHLELTVSHTMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDATR
Ga0310899_1009901423300032017SoilMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLD
Ga0308173_1183839113300032074SoilLELTVSHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR
Ga0310810_1031266223300033412SoilMPPQDRVPIGRVIPWVVLIVLLIAGLVLYFRYGSHATPLLDGTR
Ga0364925_0085528_541_6753300034147SedimentMPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQVTPLIDGTR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.