| Basic Information | |
|---|---|
| Family ID | F063058 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGTQVTPVLDGTR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.77 % |
| % of genes near scaffold ends (potentially truncated) | 35.38 % |
| % of genes from short scaffolds (< 2000 bps) | 82.31 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.923 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (19.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.769 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF02824 | TGS | 30.00 |
| PF04972 | BON | 27.69 |
| PF07973 | tRNA_SAD | 14.62 |
| PF00133 | tRNA-synt_1 | 6.15 |
| PF13620 | CarboxypepD_reg | 0.77 |
| PF13443 | HTH_26 | 0.77 |
| PF00587 | tRNA-synt_2b | 0.77 |
| PF10458 | Val_tRNA-synt_C | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.15 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.15 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.15 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 6.15 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.92 % |
| Unclassified | root | N/A | 43.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0706148 | Not Available | 612 | Open in IMG/M |
| 3300000890|JGI11643J12802_12271022 | Not Available | 595 | Open in IMG/M |
| 3300000953|JGI11615J12901_11144439 | Not Available | 618 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10102907 | Not Available | 524 | Open in IMG/M |
| 3300003319|soilL2_10057802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2310 | Open in IMG/M |
| 3300003324|soilH2_10061949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1386 | Open in IMG/M |
| 3300004114|Ga0062593_100118398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1922 | Open in IMG/M |
| 3300004114|Ga0062593_100487260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1138 | Open in IMG/M |
| 3300004114|Ga0062593_100576076 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1066 | Open in IMG/M |
| 3300004114|Ga0062593_100785885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 944 | Open in IMG/M |
| 3300004114|Ga0062593_100800339 | Not Available | 937 | Open in IMG/M |
| 3300004114|Ga0062593_101023519 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 849 | Open in IMG/M |
| 3300004463|Ga0063356_102805495 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 750 | Open in IMG/M |
| 3300004479|Ga0062595_101268772 | Not Available | 660 | Open in IMG/M |
| 3300004480|Ga0062592_102349802 | Not Available | 534 | Open in IMG/M |
| 3300004643|Ga0062591_100368222 | Not Available | 1171 | Open in IMG/M |
| 3300005327|Ga0070658_10092264 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
| 3300005327|Ga0070658_10627564 | Not Available | 932 | Open in IMG/M |
| 3300005329|Ga0070683_101475717 | Not Available | 654 | Open in IMG/M |
| 3300005334|Ga0068869_100798212 | Not Available | 811 | Open in IMG/M |
| 3300005339|Ga0070660_101347291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 606 | Open in IMG/M |
| 3300005340|Ga0070689_100527282 | Not Available | 1015 | Open in IMG/M |
| 3300005345|Ga0070692_10114016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1499 | Open in IMG/M |
| 3300005355|Ga0070671_100126029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2156 | Open in IMG/M |
| 3300005355|Ga0070671_100824126 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 809 | Open in IMG/M |
| 3300005364|Ga0070673_100084726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2578 | Open in IMG/M |
| 3300005406|Ga0070703_10427549 | Not Available | 582 | Open in IMG/M |
| 3300005456|Ga0070678_101867278 | Not Available | 567 | Open in IMG/M |
| 3300005471|Ga0070698_100629209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1014 | Open in IMG/M |
| 3300005526|Ga0073909_10059708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1410 | Open in IMG/M |
| 3300005548|Ga0070665_100041836 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4606 | Open in IMG/M |
| 3300005548|Ga0070665_102507803 | Not Available | 517 | Open in IMG/M |
| 3300005577|Ga0068857_100569479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1068 | Open in IMG/M |
| 3300005616|Ga0068852_102719066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| 3300005840|Ga0068870_10936390 | Not Available | 614 | Open in IMG/M |
| 3300006169|Ga0082029_1412513 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1822 | Open in IMG/M |
| 3300006169|Ga0082029_1669335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1793 | Open in IMG/M |
| 3300006237|Ga0097621_100930524 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 811 | Open in IMG/M |
| 3300006844|Ga0075428_100040641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5115 | Open in IMG/M |
| 3300006844|Ga0075428_100100042 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3162 | Open in IMG/M |
| 3300006844|Ga0075428_100339972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1612 | Open in IMG/M |
| 3300006844|Ga0075428_101158265 | Not Available | 816 | Open in IMG/M |
| 3300006844|Ga0075428_101264069 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 777 | Open in IMG/M |
| 3300006845|Ga0075421_100020481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8313 | Open in IMG/M |
| 3300006845|Ga0075421_100022146 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8003 | Open in IMG/M |
| 3300006845|Ga0075421_100127144 | All Organisms → cellular organisms → Bacteria | 3196 | Open in IMG/M |
| 3300006845|Ga0075421_101874346 | Not Available | 643 | Open in IMG/M |
| 3300006846|Ga0075430_100001308 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 20082 | Open in IMG/M |
| 3300006846|Ga0075430_100676173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 851 | Open in IMG/M |
| 3300006847|Ga0075431_100498556 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1209 | Open in IMG/M |
| 3300006871|Ga0075434_101141290 | Not Available | 792 | Open in IMG/M |
| 3300006876|Ga0079217_10153831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1117 | Open in IMG/M |
| 3300006876|Ga0079217_10281590 | Not Available | 909 | Open in IMG/M |
| 3300006876|Ga0079217_11051614 | Not Available | 602 | Open in IMG/M |
| 3300006880|Ga0075429_101985580 | Not Available | 504 | Open in IMG/M |
| 3300006894|Ga0079215_10036991 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1797 | Open in IMG/M |
| 3300006954|Ga0079219_10466654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 869 | Open in IMG/M |
| 3300007004|Ga0079218_11993124 | Not Available | 662 | Open in IMG/M |
| 3300009100|Ga0075418_11372827 | Not Available | 766 | Open in IMG/M |
| 3300009156|Ga0111538_13479638 | Not Available | 546 | Open in IMG/M |
| 3300010042|Ga0126314_10417957 | Not Available | 967 | Open in IMG/M |
| 3300010044|Ga0126310_10444217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 935 | Open in IMG/M |
| 3300010045|Ga0126311_11739158 | Not Available | 527 | Open in IMG/M |
| 3300010166|Ga0126306_10119410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1928 | Open in IMG/M |
| 3300012519|Ga0157352_1079373 | Not Available | 546 | Open in IMG/M |
| 3300012911|Ga0157301_10447232 | Not Available | 512 | Open in IMG/M |
| 3300012971|Ga0126369_10579776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1189 | Open in IMG/M |
| 3300013104|Ga0157370_12122257 | Not Available | 503 | Open in IMG/M |
| 3300013105|Ga0157369_10991775 | Not Available | 860 | Open in IMG/M |
| 3300015262|Ga0182007_10028509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1917 | Open in IMG/M |
| 3300015371|Ga0132258_10012638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 17792 | Open in IMG/M |
| 3300015373|Ga0132257_100413334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1642 | Open in IMG/M |
| 3300015374|Ga0132255_104689737 | Not Available | 579 | Open in IMG/M |
| 3300017792|Ga0163161_10847302 | Not Available | 771 | Open in IMG/M |
| 3300018469|Ga0190270_10472419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1186 | Open in IMG/M |
| 3300018476|Ga0190274_10082529 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2480 | Open in IMG/M |
| 3300019377|Ga0190264_11450784 | Not Available | 592 | Open in IMG/M |
| 3300019377|Ga0190264_11460940 | Not Available | 591 | Open in IMG/M |
| 3300021445|Ga0182009_10786768 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 520 | Open in IMG/M |
| 3300025321|Ga0207656_10143213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1128 | Open in IMG/M |
| 3300025899|Ga0207642_10093038 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1494 | Open in IMG/M |
| 3300025899|Ga0207642_10976993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 545 | Open in IMG/M |
| 3300025904|Ga0207647_10033497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3290 | Open in IMG/M |
| 3300025908|Ga0207643_10012073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4665 | Open in IMG/M |
| 3300025908|Ga0207643_11130160 | Not Available | 505 | Open in IMG/M |
| 3300025919|Ga0207657_10030520 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4892 | Open in IMG/M |
| 3300025920|Ga0207649_10203533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 1400 | Open in IMG/M |
| 3300025925|Ga0207650_10641910 | Not Available | 894 | Open in IMG/M |
| 3300025931|Ga0207644_10887906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 747 | Open in IMG/M |
| 3300025936|Ga0207670_10511387 | Not Available | 977 | Open in IMG/M |
| 3300025937|Ga0207669_10983865 | Not Available | 708 | Open in IMG/M |
| 3300025942|Ga0207689_10847722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 771 | Open in IMG/M |
| 3300025944|Ga0207661_11313807 | Not Available | 664 | Open in IMG/M |
| 3300025972|Ga0207668_11356488 | Not Available | 641 | Open in IMG/M |
| 3300026088|Ga0207641_10028269 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4632 | Open in IMG/M |
| 3300026088|Ga0207641_10941363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 859 | Open in IMG/M |
| 3300026088|Ga0207641_11116224 | Not Available | 787 | Open in IMG/M |
| 3300026116|Ga0207674_11346708 | Not Available | 683 | Open in IMG/M |
| 3300026121|Ga0207683_10148839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2112 | Open in IMG/M |
| 3300027637|Ga0209818_1102862 | Not Available | 758 | Open in IMG/M |
| 3300027691|Ga0209485_1012137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1853 | Open in IMG/M |
| 3300027750|Ga0209461_10094666 | Not Available | 670 | Open in IMG/M |
| 3300027880|Ga0209481_10258968 | Not Available | 877 | Open in IMG/M |
| 3300027880|Ga0209481_10298558 | Not Available | 817 | Open in IMG/M |
| 3300027886|Ga0209486_10496169 | Not Available | 758 | Open in IMG/M |
| 3300027886|Ga0209486_10585400 | Not Available | 705 | Open in IMG/M |
| 3300027907|Ga0207428_10298650 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1192 | Open in IMG/M |
| 3300027907|Ga0207428_11177204 | Not Available | 534 | Open in IMG/M |
| 3300027907|Ga0207428_11278827 | Not Available | 509 | Open in IMG/M |
| 3300027909|Ga0209382_10008747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 12740 | Open in IMG/M |
| 3300027909|Ga0209382_10120127 | All Organisms → cellular organisms → Bacteria | 3065 | Open in IMG/M |
| 3300027909|Ga0209382_10266901 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1939 | Open in IMG/M |
| 3300027909|Ga0209382_10799695 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1004 | Open in IMG/M |
| 3300028379|Ga0268266_10062964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3202 | Open in IMG/M |
| 3300028592|Ga0247822_11628572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
| 3300031538|Ga0310888_10027755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2459 | Open in IMG/M |
| 3300031548|Ga0307408_102092101 | Not Available | 546 | Open in IMG/M |
| 3300031731|Ga0307405_10311979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1198 | Open in IMG/M |
| (restricted) 3300031825|Ga0255338_1000107 | All Organisms → cellular organisms → Bacteria | 378180 | Open in IMG/M |
| 3300031892|Ga0310893_10168391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 864 | Open in IMG/M |
| 3300031903|Ga0307407_10747625 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 740 | Open in IMG/M |
| 3300031911|Ga0307412_10954453 | Not Available | 755 | Open in IMG/M |
| 3300031943|Ga0310885_10286208 | Not Available | 847 | Open in IMG/M |
| 3300031995|Ga0307409_100802356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 949 | Open in IMG/M |
| 3300032000|Ga0310903_10107867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1195 | Open in IMG/M |
| 3300032013|Ga0310906_10074392 | Not Available | 1775 | Open in IMG/M |
| 3300032017|Ga0310899_10099014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1173 | Open in IMG/M |
| 3300032074|Ga0308173_11838391 | Not Available | 571 | Open in IMG/M |
| 3300033412|Ga0310810_10312662 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1679 | Open in IMG/M |
| 3300034147|Ga0364925_0085528 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1107 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 19.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.15% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.54% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.54% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.77% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.77% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.77% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.77% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031825 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_07061482 | 2228664021 | Soil | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRFGTQVTPLLDGTR |
| JGI11643J12802_122710221 | 3300000890 | Soil | PPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR* |
| JGI11615J12901_111444392 | 3300000953 | Soil | MPPQDRVPIGRVIPWVVLVVLLIAGLILYFRYGAQVTPLLNGTR* |
| JGIcombinedJ43975_101029071 | 3300002899 | Soil | VSYPMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR* |
| soilL2_100578022 | 3300003319 | Sugarcane Root And Bulk Soil | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGAQVTPLLNSTR* |
| soilH2_100619491 | 3300003324 | Sugarcane Root And Bulk Soil | MPPQDRVPIGRVIPWVVLVVLLIAGLILYFRYGAQVTPLLDGTR* |
| Ga0062593_1001183982 | 3300004114 | Soil | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR* |
| Ga0062593_1004872601 | 3300004114 | Soil | MAPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR* |
| Ga0062593_1005760762 | 3300004114 | Soil | MPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR* |
| Ga0062593_1007858852 | 3300004114 | Soil | MPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR* |
| Ga0062593_1008003392 | 3300004114 | Soil | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGTQVTPVLDGTR* |
| Ga0062593_1010235191 | 3300004114 | Soil | MPPQERVPIGRVIPWVVLVVLLFAGLVLYFRYGSQVTSLIDGPR* |
| Ga0063356_1028054951 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPPQDRVPMGRVIPWVVLVVLLIAGLVLYFKYGTQVTPLLDGTR* |
| Ga0062595_1012687721 | 3300004479 | Soil | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR* |
| Ga0062592_1023498021 | 3300004480 | Soil | MPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQVTPLLDGTR* |
| Ga0062591_1003682221 | 3300004643 | Soil | MPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDATR* |
| Ga0070658_100922641 | 3300005327 | Corn Rhizosphere | LTLYHTMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR* |
| Ga0070658_106275642 | 3300005327 | Corn Rhizosphere | PQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR* |
| Ga0070683_1014757171 | 3300005329 | Corn Rhizosphere | LTVSHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR* |
| Ga0068869_1007982121 | 3300005334 | Miscanthus Rhizosphere | LTVSHTMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR* |
| Ga0070660_1013472911 | 3300005339 | Corn Rhizosphere | MPPQERVPIGRVIPWVILVVLLFAGLVLYFLYGSQVTSLIDGPR* |
| Ga0070689_1005272821 | 3300005340 | Switchgrass Rhizosphere | PMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLNSTR* |
| Ga0070692_101140162 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLNSTR* |
| Ga0070671_1001260291 | 3300005355 | Switchgrass Rhizosphere | MPPQERIPIGRVIPWVVLVVLLLAGLVLYFRYGPQVTSLLDGTR* |
| Ga0070671_1008241262 | 3300005355 | Switchgrass Rhizosphere | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPVLNSTR* |
| Ga0070673_1000847263 | 3300005364 | Switchgrass Rhizosphere | MPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDG |
| Ga0070703_104275492 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LELTVSYPMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR* |
| Ga0070678_1018672781 | 3300005456 | Miscanthus Rhizosphere | MPPQERVPIGRVIPWVILVVLLFAGLVLYFRYGSQVTSLLDGPR* |
| Ga0070698_1006292091 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGTKVTPLLDGTR* |
| Ga0073909_100597082 | 3300005526 | Surface Soil | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGGQVTPLLDSTR* |
| Ga0070665_1000418363 | 3300005548 | Switchgrass Rhizosphere | MPPQDRVPIGRVIPWVVLVLLLIAGVVLYFRYGTQITPLLDGTR* |
| Ga0070665_1025078032 | 3300005548 | Switchgrass Rhizosphere | LYHTMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR* |
| Ga0068857_1005694792 | 3300005577 | Corn Rhizosphere | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTP |
| Ga0068852_1027190662 | 3300005616 | Corn Rhizosphere | MPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITP |
| Ga0068870_109363902 | 3300005840 | Miscanthus Rhizosphere | TVSHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR* |
| Ga0082029_14125132 | 3300006169 | Termite Nest | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTRVTPILDSTR* |
| Ga0082029_16693353 | 3300006169 | Termite Nest | MPPQDRVPIGRVIPWVILVVLLIVGLVLYFQYGADVTPLVDGTR* |
| Ga0097621_1009305241 | 3300006237 | Miscanthus Rhizosphere | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLQHALSG |
| Ga0075428_1000406413 | 3300006844 | Populus Rhizosphere | MPPQDRAPIGRVIPWVVLIVLLLAGLVLYFRYGARVTPILDSTR* |
| Ga0075428_1001000422 | 3300006844 | Populus Rhizosphere | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPILDSTR* |
| Ga0075428_1003399722 | 3300006844 | Populus Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRFGTQVTPLLDGTR* |
| Ga0075428_1011582652 | 3300006844 | Populus Rhizosphere | IGRVIPWVVLIVLLLAGLVLYFRYGTGVTPVLNSTR* |
| Ga0075428_1012640691 | 3300006844 | Populus Rhizosphere | MPPQDRIPIGRVIPWVVLVVLLIGGLVLYFTYGSRVTPLLDGTR* |
| Ga0075421_1000204816 | 3300006845 | Populus Rhizosphere | MLPQDRVPIGRVIPWVILVVLLVVGLVLYFQYGADVTPLVDGTR* |
| Ga0075421_1000221464 | 3300006845 | Populus Rhizosphere | MPPQDRVPIGRVIPWVILVVLLVVGLVLYFRYGADVTPLVDGTR* |
| Ga0075421_1001271442 | 3300006845 | Populus Rhizosphere | MPPQDRVPIGRVIPWVVLLVLLVAGVVLYFRYGTQITPLLDGTR* |
| Ga0075421_1018743461 | 3300006845 | Populus Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYLRYGVQVTPLLDGTR* |
| Ga0075430_1000013089 | 3300006846 | Populus Rhizosphere | MPPQDRVPIGRVIPWVILVVLLIAGLVLYFSYGSDVTPLLDGTR* |
| Ga0075430_1006761731 | 3300006846 | Populus Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYLRYGVQVTPLLDGT |
| Ga0075431_1004985561 | 3300006847 | Populus Rhizosphere | MPPQDRIPIGRVIPWVVLVVLLIGGLVLYFTYGSRVTPLLDGT |
| Ga0075434_1011412902 | 3300006871 | Populus Rhizosphere | VPIGRVIPWVVLVILLVAGLVLYFRYGNQVTPLLDGTR* |
| Ga0079217_101538312 | 3300006876 | Agricultural Soil | MPPQERVPIGRVIPWVILVVLLIAGLVLYFSYGSDVTPLLDGSR* |
| Ga0079217_102815902 | 3300006876 | Agricultural Soil | MPPQDRVPIGRVIPWVILVVLLLAGIVLYFRYGTQVTPLLDGTP* |
| Ga0079217_110516142 | 3300006876 | Agricultural Soil | MPPQDRVPLGRVIPWVVLVVLLITGLVLYFRYGTQVTPLLDGTR* |
| Ga0075429_1019855802 | 3300006880 | Populus Rhizosphere | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTGVTPVLNSTR* |
| Ga0079215_100369912 | 3300006894 | Agricultural Soil | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGAQVTPLLDGTR* |
| Ga0079219_104666541 | 3300006954 | Agricultural Soil | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFLYGGHVTPLLDGT |
| Ga0079218_119931242 | 3300007004 | Agricultural Soil | IGRVIPWVVLVVLLLAGLVLYLRYGAQVTPLLNGTR* |
| Ga0075418_113728272 | 3300009100 | Populus Rhizosphere | MPPQDRIPIGRVIPWVVLVVLLIEGLVLYFTYGSRVTPLLDGTR* |
| Ga0111538_134796382 | 3300009156 | Populus Rhizosphere | RVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR* |
| Ga0126314_104179571 | 3300010042 | Serpentine Soil | GRVIPWVVVLVLLIAGVVLYLRYGTQMTPLLDGTR* |
| Ga0126310_104442171 | 3300010044 | Serpentine Soil | MPPQERVPIGRVIPWVVLVVLLFAGLVLYFRYGSQVTSLLDGPR* |
| Ga0126311_117391581 | 3300010045 | Serpentine Soil | HTMPPQERVPIGRVIPWVILVVLLFAGLVLYFRYGPQVTSLLDGPR* |
| Ga0126306_101194101 | 3300010166 | Serpentine Soil | MPPQDRVPIGRVIPWVVLVALLIAGVVLYFRYGTQITPLLDGTR* |
| Ga0157352_10793731 | 3300012519 | Unplanted Soil | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGARVTPILDSTR* |
| Ga0157301_104472321 | 3300012911 | Soil | MPPQDRVPIGRVIPWIVLVVLLLAGVVLYFRYGTQVTPLLDGTC* |
| Ga0126369_105797762 | 3300012971 | Tropical Forest Soil | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVAPVLDSTR* |
| Ga0157370_121222571 | 3300013104 | Corn Rhizosphere | MAPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLDSTR* |
| Ga0157369_109917752 | 3300013105 | Corn Rhizosphere | MAPQDRVPIGRVIPLVVLVVLLLAGLVLYFRYGTQVAPVLDSTR* |
| Ga0182007_100285092 | 3300015262 | Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFLYGRQVTPLLDGTR* |
| Ga0132258_100126388 | 3300015371 | Arabidopsis Rhizosphere | MSPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGGQVTPLLDSTR* |
| Ga0132257_1004133341 | 3300015373 | Arabidopsis Rhizosphere | MPPQDRAPIGRVIPWVVLVVLLLAGLVLYFRYGARVTPILDSTR* |
| Ga0132255_1046897371 | 3300015374 | Arabidopsis Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLVAGLVLYFRYGGQVTPLLDGTR* |
| Ga0163161_108473022 | 3300017792 | Switchgrass Rhizosphere | MPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR |
| Ga0190270_104724192 | 3300018469 | Soil | MPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQVTPLLDGTR |
| Ga0190274_100825291 | 3300018476 | Soil | MPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR |
| Ga0190264_114507841 | 3300019377 | Soil | MPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGAGTTPLLDGTR |
| Ga0190264_114609401 | 3300019377 | Soil | MSPQDRVPIGRVIPWVVLVVLLIAGLVLYFRFVTQVTPLLDATR |
| Ga0182009_107867681 | 3300021445 | Soil | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLD |
| Ga0207656_101432132 | 3300025321 | Corn Rhizosphere | MAPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR |
| Ga0207642_100930382 | 3300025899 | Miscanthus Rhizosphere | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPVLNSTR |
| Ga0207642_109769932 | 3300025899 | Miscanthus Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQV |
| Ga0207647_100334973 | 3300025904 | Corn Rhizosphere | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR |
| Ga0207643_100120733 | 3300025908 | Miscanthus Rhizosphere | MPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDATR |
| Ga0207643_111301601 | 3300025908 | Miscanthus Rhizosphere | APQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR |
| Ga0207657_100305204 | 3300025919 | Corn Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLNSTR |
| Ga0207649_102035332 | 3300025920 | Corn Rhizosphere | QSMPPQERVPIGRVIPWVVLVVLLFAGLVLYFRYGSQVTSLIDGPR |
| Ga0207650_106419102 | 3300025925 | Switchgrass Rhizosphere | TVSHTMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR |
| Ga0207644_108879062 | 3300025931 | Switchgrass Rhizosphere | MPPQERVPIGRVIPWVILVVLLFAGLVLYFRYGSQVTSLLDGPR |
| Ga0207670_105113872 | 3300025936 | Switchgrass Rhizosphere | LTVYHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVTPVLNSTR |
| Ga0207669_109838652 | 3300025937 | Miscanthus Rhizosphere | QDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPVLNSTR |
| Ga0207689_108477221 | 3300025942 | Miscanthus Rhizosphere | MPPQERVPIGRVIPWVILVVLLFAGLVLYFRYGSQVTSLLDGP |
| Ga0207661_113138071 | 3300025944 | Corn Rhizosphere | LTVSHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR |
| Ga0207668_113564882 | 3300025972 | Switchgrass Rhizosphere | MPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGTQVTSLLD |
| Ga0207641_100282693 | 3300026088 | Switchgrass Rhizosphere | SYPMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTEVTPVLNSTR |
| Ga0207641_109413632 | 3300026088 | Switchgrass Rhizosphere | MPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLD |
| Ga0207641_111162242 | 3300026088 | Switchgrass Rhizosphere | LLLTLYHTMPPQERIPIGRVIPWVVLVVLLFAGLVLYFRYGPQVTSLLDGTR |
| Ga0207674_113467082 | 3300026116 | Corn Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFLYGRQVTPLLDGTR |
| Ga0207683_101488393 | 3300026121 | Miscanthus Rhizosphere | MPPQERVPIGRVIPWVVLVVLLFAGLVLYFRYGSQVTSLLDGPR |
| Ga0209818_11028621 | 3300027637 | Agricultural Soil | QDRVPIGRVIPWVILVVLLLAGIVLYFRYGTQVTPLLDGTP |
| Ga0209485_10121373 | 3300027691 | Agricultural Soil | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGAQVTPLLDGTR |
| Ga0209461_100946662 | 3300027750 | Agave | MPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQITPLLDGTR |
| Ga0209481_102589681 | 3300027880 | Populus Rhizosphere | TMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDGTR |
| Ga0209481_102985581 | 3300027880 | Populus Rhizosphere | HPMPPQDRAPIGRVIPWVVLIVLLLAGLVLYFRYGARVTPILDSTR |
| Ga0209486_104961692 | 3300027886 | Agricultural Soil | MPPQDRVPMGRVIPWVVLVVLLIAGLVLYFKYGTQVTPLLDGTR |
| Ga0209486_105854001 | 3300027886 | Agricultural Soil | MPPQDRVPIGRVIPWVILVVLLLAGIVLYFRYGTQVTPLLDGTP |
| Ga0207428_102986501 | 3300027907 | Populus Rhizosphere | MPPQDRAPIGRVIPWVVLIVLLLAGLVLYFRYGARVTPILDSTR |
| Ga0207428_111772042 | 3300027907 | Populus Rhizosphere | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTGVTP |
| Ga0207428_112788272 | 3300027907 | Populus Rhizosphere | EGHLELTVSHPMPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTGVTPVLNSTR |
| Ga0209382_100087479 | 3300027909 | Populus Rhizosphere | MLPQDRVPIGRVIPWVILVVLLVVGLVLYFQYGADVTPLVDGTR |
| Ga0209382_101201273 | 3300027909 | Populus Rhizosphere | MPPQDRVPIGRVIPWVILVVLLVVGLVLYFRYGADVTPLVDGTR |
| Ga0209382_102669013 | 3300027909 | Populus Rhizosphere | MPPQDRVPIGRVIPWVVLLVLLVAGVVLYFRYGTQITPLLDGTR |
| Ga0209382_107996952 | 3300027909 | Populus Rhizosphere | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTQVTPILDSTR |
| Ga0268266_100629642 | 3300028379 | Switchgrass Rhizosphere | MPPQDRVPIGRVIPWVVLVLLLIAGVVLYFRYGTQITPLLDGTR |
| Ga0247822_116285721 | 3300028592 | Soil | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTGVTPVLNSTR |
| Ga0310888_100277553 | 3300031538 | Soil | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGGQVTPLLDSTR |
| Ga0307408_1020921011 | 3300031548 | Rhizosphere | GRVIPWVVLVVLLIAGVVLYFRYGTQVTPLLDGTR |
| Ga0307405_103119792 | 3300031731 | Rhizosphere | MPPQDRVPIGRVIPWVVVLVLLIAGVVLYLRYGTQITPLLDGTR |
| (restricted) Ga0255338_1000107168 | 3300031825 | Sandy Soil | VPTGRVIPWVILLVLLVAGLVLYFRYGGGVSPLLDGTR |
| Ga0310893_101683912 | 3300031892 | Soil | MPPQDRVPIGRVIPWVVLIVLLLAGLVLYFRYGTE |
| Ga0307407_107476252 | 3300031903 | Rhizosphere | MPPQDRVPMGRVIPWVVLVLLLIAGLVLYFKYGTQVTPLLDGTR |
| Ga0307412_109544532 | 3300031911 | Rhizosphere | MPSPDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQVTPLLDGTR |
| Ga0310885_102862082 | 3300031943 | Soil | MPPQDRVPIGRVIPWVVLVVLLLAGLVLYLRYGAQVTPLLDGTR |
| Ga0307409_1008023562 | 3300031995 | Rhizosphere | MPPQDRVPIGRVIPWVVLVVLLIAGLVLYFRYGTKVTPVLDGTR |
| Ga0310903_101078671 | 3300032000 | Soil | MPPQDRVPIGRVIPWIVLIVLLLAGLVLYFRYGTEVTPVLNSTR |
| Ga0310906_100743922 | 3300032013 | Soil | HLELTVSHTMPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLDATR |
| Ga0310899_100990142 | 3300032017 | Soil | MPPQDRVPIGRVIPWVVLLVLLIAGVVLYFRYGTQITPLLD |
| Ga0308173_118383911 | 3300032074 | Soil | LELTVSHPMPPQDRVPIGRVIPWVVLVVLLLAGLVLYFRYGTQVAPVLDSTR |
| Ga0310810_103126622 | 3300033412 | Soil | MPPQDRVPIGRVIPWVVLIVLLIAGLVLYFRYGSHATPLLDGTR |
| Ga0364925_0085528_541_675 | 3300034147 | Sediment | MPPQDRVPIGRVIPWVVLVVLLIAGVVLYFRYGTQVTPLIDGTR |
| ⦗Top⦘ |