| Basic Information | |
|---|---|
| Family ID | F063025 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LWKAGSAGRPKGVPTLGDFAAARTPGTDSAVYDADYARRMPSELY |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.33 % |
| % of genes near scaffold ends (potentially truncated) | 95.38 % |
| % of genes from short scaffolds (< 2000 bps) | 96.15 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.692 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.692 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.846 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.36% β-sheet: 0.00% Coil/Unstructured: 61.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 13.08 |
| PF03976 | PPK2 | 4.62 |
| PF00903 | Glyoxalase | 4.62 |
| PF04828 | GFA | 3.85 |
| PF05199 | GMC_oxred_C | 3.08 |
| PF07366 | SnoaL | 3.08 |
| PF04392 | ABC_sub_bind | 2.31 |
| PF07690 | MFS_1 | 1.54 |
| PF02518 | HATPase_c | 1.54 |
| PF08450 | SGL | 1.54 |
| PF02826 | 2-Hacid_dh_C | 1.54 |
| PF02801 | Ketoacyl-synt_C | 1.54 |
| PF00106 | adh_short | 1.54 |
| PF03401 | TctC | 0.77 |
| PF13410 | GST_C_2 | 0.77 |
| PF01243 | Putative_PNPOx | 0.77 |
| PF00805 | Pentapeptide | 0.77 |
| PF00043 | GST_C | 0.77 |
| PF00211 | Guanylate_cyc | 0.77 |
| PF00005 | ABC_tran | 0.77 |
| PF00144 | Beta-lactamase | 0.77 |
| PF02082 | Rrf2 | 0.77 |
| PF13417 | GST_N_3 | 0.77 |
| PF07883 | Cupin_2 | 0.77 |
| PF00561 | Abhydrolase_1 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 13.08 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 4.62 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 3.85 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 3.08 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.31 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.54 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.54 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.77 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.77 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.77 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.77 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.77 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.77 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.77 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.77 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.77 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.77 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.77 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.77 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.77 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.77 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.69 % |
| Unclassified | root | N/A | 22.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100052255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3722 | Open in IMG/M |
| 3300004080|Ga0062385_11286771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300004082|Ga0062384_100139816 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300005178|Ga0066688_11006286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300005332|Ga0066388_103255271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300005332|Ga0066388_104775367 | Not Available | 689 | Open in IMG/M |
| 3300005555|Ga0066692_10287071 | Not Available | 1042 | Open in IMG/M |
| 3300005713|Ga0066905_101654773 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005842|Ga0068858_101409889 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006173|Ga0070716_100286229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
| 3300006175|Ga0070712_101711069 | Not Available | 550 | Open in IMG/M |
| 3300006796|Ga0066665_11336216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 552 | Open in IMG/M |
| 3300006845|Ga0075421_102423280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300009098|Ga0105245_13197481 | Not Available | 508 | Open in IMG/M |
| 3300009143|Ga0099792_10040183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2225 | Open in IMG/M |
| 3300009525|Ga0116220_10582394 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010358|Ga0126370_11142437 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010360|Ga0126372_11993290 | Not Available | 627 | Open in IMG/M |
| 3300010361|Ga0126378_10858448 | Not Available | 1015 | Open in IMG/M |
| 3300010366|Ga0126379_11170769 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010366|Ga0126379_11559966 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010376|Ga0126381_102575734 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300010376|Ga0126381_103496308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| 3300010376|Ga0126381_104239069 | Not Available | 556 | Open in IMG/M |
| 3300010376|Ga0126381_104329612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 549 | Open in IMG/M |
| 3300010396|Ga0134126_10225940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2226 | Open in IMG/M |
| 3300011120|Ga0150983_15249503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300012205|Ga0137362_11066823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300012206|Ga0137380_11562297 | Not Available | 544 | Open in IMG/M |
| 3300012212|Ga0150985_113983123 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012363|Ga0137390_10231578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1833 | Open in IMG/M |
| 3300012924|Ga0137413_11636914 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012925|Ga0137419_11840525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300012931|Ga0153915_10822824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300014501|Ga0182024_11563940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 749 | Open in IMG/M |
| 3300014969|Ga0157376_12178236 | Not Available | 593 | Open in IMG/M |
| 3300016270|Ga0182036_10227001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1385 | Open in IMG/M |
| 3300016319|Ga0182033_11101248 | Not Available | 709 | Open in IMG/M |
| 3300016357|Ga0182032_11483114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300016404|Ga0182037_10314176 | Not Available | 1264 | Open in IMG/M |
| 3300016422|Ga0182039_12227263 | Not Available | 506 | Open in IMG/M |
| 3300016445|Ga0182038_10845208 | Not Available | 804 | Open in IMG/M |
| 3300017932|Ga0187814_10450426 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300017970|Ga0187783_11357917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300018058|Ga0187766_10023272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3567 | Open in IMG/M |
| 3300018085|Ga0187772_10828952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 669 | Open in IMG/M |
| 3300018089|Ga0187774_11067486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300020580|Ga0210403_10624610 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300020583|Ga0210401_10548909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1018 | Open in IMG/M |
| 3300020583|Ga0210401_10908650 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300020583|Ga0210401_11211184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300021178|Ga0210408_10288867 | Not Available | 1307 | Open in IMG/M |
| 3300021178|Ga0210408_11375357 | Not Available | 533 | Open in IMG/M |
| 3300021180|Ga0210396_10800670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300021404|Ga0210389_11548254 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300021405|Ga0210387_11770176 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300021406|Ga0210386_10870511 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300021432|Ga0210384_10471854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1130 | Open in IMG/M |
| 3300021432|Ga0210384_11199692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. PCC 7376 | 663 | Open in IMG/M |
| 3300021432|Ga0210384_11776032 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300021441|Ga0213871_10276375 | Not Available | 538 | Open in IMG/M |
| 3300021474|Ga0210390_10659564 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300021475|Ga0210392_10778778 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300021477|Ga0210398_10567503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 922 | Open in IMG/M |
| 3300021479|Ga0210410_10682604 | Not Available | 908 | Open in IMG/M |
| 3300021559|Ga0210409_10698036 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300021560|Ga0126371_11593006 | Not Available | 779 | Open in IMG/M |
| 3300022525|Ga0242656_1057209 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300022557|Ga0212123_10726287 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300022724|Ga0242665_10064485 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300025898|Ga0207692_10449953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 811 | Open in IMG/M |
| 3300025906|Ga0207699_10659881 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300025915|Ga0207693_10379443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1106 | Open in IMG/M |
| 3300026998|Ga0208369_1012072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300026999|Ga0207949_1019044 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300027680|Ga0207826_1021753 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300027698|Ga0209446_1044532 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300027701|Ga0209447_10130838 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300027737|Ga0209038_10193780 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300027867|Ga0209167_10794915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300027903|Ga0209488_10903918 | Not Available | 619 | Open in IMG/M |
| 3300029636|Ga0222749_10501037 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031474|Ga0170818_111970556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300031561|Ga0318528_10275671 | Not Available | 903 | Open in IMG/M |
| 3300031561|Ga0318528_10593038 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031564|Ga0318573_10242499 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300031572|Ga0318515_10285239 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300031573|Ga0310915_10156027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1580 | Open in IMG/M |
| 3300031668|Ga0318542_10576969 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031681|Ga0318572_10912423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300031682|Ga0318560_10343330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300031708|Ga0310686_103008812 | Not Available | 711 | Open in IMG/M |
| 3300031713|Ga0318496_10760861 | Not Available | 534 | Open in IMG/M |
| 3300031718|Ga0307474_10485587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300031718|Ga0307474_11331099 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031719|Ga0306917_10597349 | Not Available | 868 | Open in IMG/M |
| 3300031719|Ga0306917_10614456 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300031723|Ga0318493_10414139 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031753|Ga0307477_10992433 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031754|Ga0307475_10781476 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031768|Ga0318509_10521346 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031768|Ga0318509_10763678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300031769|Ga0318526_10329654 | Not Available | 624 | Open in IMG/M |
| 3300031777|Ga0318543_10329921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300031781|Ga0318547_10854366 | Not Available | 567 | Open in IMG/M |
| 3300031782|Ga0318552_10423344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
| 3300031835|Ga0318517_10335034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300031879|Ga0306919_10962270 | Not Available | 653 | Open in IMG/M |
| 3300031879|Ga0306919_11254740 | Not Available | 562 | Open in IMG/M |
| 3300031941|Ga0310912_10734748 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300031945|Ga0310913_10215199 | Not Available | 1345 | Open in IMG/M |
| 3300031946|Ga0310910_10414219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1068 | Open in IMG/M |
| 3300031947|Ga0310909_11191074 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031954|Ga0306926_12322629 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031959|Ga0318530_10134681 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300032001|Ga0306922_10374289 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300032001|Ga0306922_10572163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1199 | Open in IMG/M |
| 3300032001|Ga0306922_10754561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1020 | Open in IMG/M |
| 3300032025|Ga0318507_10363077 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300032043|Ga0318556_10288204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 858 | Open in IMG/M |
| 3300032044|Ga0318558_10515330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300032060|Ga0318505_10174068 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300032066|Ga0318514_10157247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1181 | Open in IMG/M |
| 3300032076|Ga0306924_12010253 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300032160|Ga0311301_12229513 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300032174|Ga0307470_11882289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300032261|Ga0306920_100647267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1561 | Open in IMG/M |
| 3300032770|Ga0335085_11843792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300033290|Ga0318519_11003880 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.54% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.77% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.77% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.77% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1000522556 | 3300002245 | Forest Soil | SAGRPKGVPTLGNFAAARTPGTDSATFDADYARRMPNELY* |
| Ga0062385_112867711 | 3300004080 | Bog Forest Soil | KAASVGRPKGVPTLGDFAAARTPGTDSATYDADYARRMPSELY* |
| Ga0062384_1001398161 | 3300004082 | Bog Forest Soil | KAGSGDRPNGIPTLGDFAAARTPGIDSSAYDADYARRMPSELY* |
| Ga0066688_110062861 | 3300005178 | Soil | SGGRPEGVPTLGDFAAARTPGTDSAAYDADYARRMPSELY* |
| Ga0066388_1032552711 | 3300005332 | Tropical Forest Soil | AGPGSRPESVPTLGDFAAARNPCIDRATFDAEYTKHIANELY* |
| Ga0066388_1047753671 | 3300005332 | Tropical Forest Soil | AGRPKGVPTLGDFAAARTPGTDSAIYDADYARRMPSELY* |
| Ga0066692_102870711 | 3300005555 | Soil | EGGSVGRSKVVPMPGDFVDARTPGIDSAAFEADDARRMPNELY* |
| Ga0066905_1016547732 | 3300005713 | Tropical Forest Soil | RPQGVPTLGDFAAARTPGLDSAGLDEAFKERFPNELY* |
| Ga0068858_1014098891 | 3300005842 | Switchgrass Rhizosphere | VRSDLWKAGTGRRPEGVPTLGDFTAARNPGIDSSVYDAEYAERIVKELY* |
| Ga0070716_1002862292 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LEVRAPGLWRAGKGDRPKGVPTLGDFAAARTPGIDSSAYDADYARRMPSELY* |
| Ga0070712_1017110692 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VEGRQGRPAQGVPTLGDFAAARTPGIDSSAYDADYARRMPVNFI |
| Ga0066665_113362162 | 3300006796 | Soil | KALVRSGLWKAGKGDRPKGVPTLGDFATARTPGTDSSAYDADYARRMPSELY* |
| Ga0075421_1024232802 | 3300006845 | Populus Rhizosphere | QVRSDLWNAANGGRPQGVPTLGDFAAARDPGTNSAAFDAEYSRRIPNELY* |
| Ga0105245_131974812 | 3300009098 | Miscanthus Rhizosphere | VRSDLWKASSGDRPKGVPTLGDFAAARTPGIDSSTFDADYARRMPSELY* |
| Ga0099792_100401833 | 3300009143 | Vadose Zone Soil | DLWRAGSAGRPKVVPTLGDFAAARTPGTDSATFDADYARRMPNELY* |
| Ga0116220_105823941 | 3300009525 | Peatlands Soil | IRSNFWKSAERGRPKGVPTIGAFAAARNPGTDGAAYDEEYAKRLPEELY* |
| Ga0126370_111424371 | 3300010358 | Tropical Forest Soil | CPEALVRSNLWKTGSGERRKGVPTLGDFAAARTPGIDSSAYDADYARRMPSELY* |
| Ga0126372_119932901 | 3300010360 | Tropical Forest Soil | GRPKGVPTLGEFAAARTPGTNSAVYDADYARRMPSELY* |
| Ga0126378_108584481 | 3300010361 | Tropical Forest Soil | GSAGRPKDVPTLGDFAAARTPGTDSAVYDADYARRMPSELY* |
| Ga0126379_111707692 | 3300010366 | Tropical Forest Soil | VRSNLWKASTGERPKGVPTLGDFAAARTSGIDSAAYDADYARRMPGELY* |
| Ga0126379_115599661 | 3300010366 | Tropical Forest Soil | KALVRSNLWKAGSGDRPKDVPTLGDFAAARTPGIDSAAYDADYVRRMPSELY* |
| Ga0126381_1025757341 | 3300010376 | Tropical Forest Soil | GLWQAGSRGRPQGVPTLGDFAAARFPETDGAAYDAAYAQRIPNELY* |
| Ga0126381_1034963082 | 3300010376 | Tropical Forest Soil | IRSDLWRVVGGSRPEGVPTLGDFAAARNPGIDSGTFDADYAKRIAKELY* |
| Ga0126381_1042390691 | 3300010376 | Tropical Forest Soil | PKDVPTLGDFAAARTPGTDSAVYDADYARRMPSELY* |
| Ga0126381_1043296121 | 3300010376 | Tropical Forest Soil | AAGRPEGVPTHGDFAAARNPGTDGATYDAEYAVRMPGELY* |
| Ga0134126_102259401 | 3300010396 | Terrestrial Soil | PKALVRSDLWKASSGDRPKGVPTLGDFAAARTPGIDSSTFDADYARRMPSELY* |
| Ga0150983_152495032 | 3300011120 | Forest Soil | KGVPTLGDFAAARTPGTDSSAYDADYARRLPSELY* |
| Ga0137362_110668231 | 3300012205 | Vadose Zone Soil | GVPTLRDFAAARTPGTDSTTYDADYARRMPSELY* |
| Ga0137380_115622972 | 3300012206 | Vadose Zone Soil | AFVRSRLWQAGSRGRPEGVPTLGDFAAARTPGTDSAAYDADYARRMPSELY* |
| Ga0150985_1139831232 | 3300012212 | Avena Fatua Rhizosphere | WRAGTGERPKGVPTLGDFAAARAPGIDSADYDADYARRMPSELY* |
| Ga0137390_102315781 | 3300012363 | Vadose Zone Soil | PKGAPTLGDFAAARTPGTDSAAFDVDYARRMPSELY* |
| Ga0137413_116369142 | 3300012924 | Vadose Zone Soil | LVRSDLWEAGSGERPKGVPTLGDFAAARTPGTDSSVYDADYARRMPSELY* |
| Ga0137419_118405251 | 3300012925 | Vadose Zone Soil | LVRSDLWKAGSGDRPKGVPTLGDFAAARTPGTDSSTYDADYARRMPSELY* |
| Ga0153915_108228241 | 3300012931 | Freshwater Wetlands | RKAGADGRPKGVPTIGAFAAARNPGTDGAAYDAEYAKRLPDELY* |
| Ga0182024_115639401 | 3300014501 | Permafrost | LVRSNLWKAGKGSRPEGVPTLGDFAAARQPGTDSGAYDADYAKRMPNELY* |
| Ga0157376_121782361 | 3300014969 | Miscanthus Rhizosphere | PQGVPTLGDFAAARRPGIDSAALDEELKELFPKQLY* |
| Ga0182036_102270011 | 3300016270 | Soil | GRPKGVPTLGDFAAARTPGTDSAVYDADYARRMPSELY |
| Ga0182033_111012481 | 3300016319 | Soil | DLWEASSAGRPKGVPTLGDFAAARTPGTDSAVYDADYARRMPSELY |
| Ga0182032_114831142 | 3300016357 | Soil | ALVRSDLWQAGSRGRPQGVPTLGDFAAARFPETDGAAYDAAYAKRIPNELY |
| Ga0182037_103141761 | 3300016404 | Soil | LWKAGSAGRPKGVPTLGDFAAARTPGTDSAVYDADYARRMPSELY |
| Ga0182039_122272631 | 3300016422 | Soil | AGGAGRPKGVPTLGDFAAARTPGTDAATYDAEYAHRMPNELY |
| Ga0182038_108452082 | 3300016445 | Soil | IRSDLWGAAVAGRPKGAPTLGDFAAARSPGTDPAVYDADYARRMPNELY |
| Ga0187814_104504262 | 3300017932 | Freshwater Sediment | LWRAAGAGRPKGVPTLGDFAAARNPGTDGATYDAEYAKRMPDELY |
| Ga0187783_113579172 | 3300017970 | Tropical Peatland | PKALVRSNLWQAGMARRPEGVPTLGDFAAARDPTTDRAAFDAAYAKRIPEELY |
| Ga0187822_102207171 | 3300017994 | Freshwater Sediment | LWKAGSGGRPQGVPTFGDFTAARKPGTDSAVFDVAYTKRMSSELY |
| Ga0187766_100232721 | 3300018058 | Tropical Peatland | LRSQLWKSGEGPRPKGVPTLGDFAAARNPGTSGADFDADYAQRVVKELY |
| Ga0187772_108289522 | 3300018085 | Tropical Peatland | GSTARPKNVPTLGGFYAARYPDVDSAAYDAEYNDRMPTELY |
| Ga0187774_110674863 | 3300018089 | Tropical Peatland | GRPKGVPTLGEFAAARTPGTDSATYDADYARRMPNELY |
| Ga0210403_106246102 | 3300020580 | Soil | DLWKAGRGDRPKGVPTLGDFAAARTPGTDSSTYDADYARRMPSELY |
| Ga0210401_105489093 | 3300020583 | Soil | LVRSDLWKAGSGDRPKGIPTLGDFAAARTPGIDSSAYDADYARRMPSELY |
| Ga0210401_109086502 | 3300020583 | Soil | LVRSDLWKAGSGDRPNGIPTLGDFAAARTPGIDSSAYDADYARRMPSELY |
| Ga0210401_112111841 | 3300020583 | Soil | ALVRSDLWKAGKGDRPKGVPTLGDFAAARTPGIDSSAYDADYARRMPSELY |
| Ga0210408_102888671 | 3300021178 | Soil | NLWRAGSGDRPKGVPTLGDFAGARTPGTDSSTYDADYARRMPSELY |
| Ga0210408_113753571 | 3300021178 | Soil | LVRSDLWKAGKGDRPRGVPTLGEFAAARTPGTDSSAYDADYARRMPSELY |
| Ga0210396_108006701 | 3300021180 | Soil | RPKGIPTLGDFAAARTPGIDSSAYDADYARRMPSELY |
| Ga0210389_115482542 | 3300021404 | Soil | WKAGRGDRPKGVPTLGDFAAARTPGTDSSTYDADYARRMPSELY |
| Ga0210387_117701761 | 3300021405 | Soil | PKGVPTLGDFAAARAPGTDSSAYDADYARRMPNELY |
| Ga0210386_108705112 | 3300021406 | Soil | DRPKGVPTLGDFAAARTPGTDSSVYDADYARRMPSELY |
| Ga0210384_104718542 | 3300021432 | Soil | WKTDSRGRPEGVPTLGNFAAARTPGTDSAAYDADYARRMPNELY |
| Ga0210384_111996922 | 3300021432 | Soil | AGSIGRPKGAPTLGDFAAARTPGTDSAAFDADYVRRMPGELY |
| Ga0210384_117760322 | 3300021432 | Soil | SGDRPKGVPTLGDFAAARTPGTDSSVYDADYARRMPSELY |
| Ga0213871_102763751 | 3300021441 | Rhizosphere | RSDLWRAAAAGRPKGAPTLGDFAAARNPGTDPAAYDADLARRLPNELY |
| Ga0210390_106595642 | 3300021474 | Soil | DLWKAGRGDRPKGVPTLGDFAAARAPGTDSSAYDADYARRMPSELY |
| Ga0210392_107787782 | 3300021475 | Soil | KGIPTLGDFAAARTPGIDSSAYDADYARRMPSELY |
| Ga0210398_105675031 | 3300021477 | Soil | PKALIRSNLWKAGSGARPKSVPSLGDFAAARNPETDAETYNAEYLKRLPDELY |
| Ga0210410_106826042 | 3300021479 | Soil | RAGSAGRPKVVPTLGDFAAARTPGTDSATFDADYARRLPNELY |
| Ga0210409_106980362 | 3300021559 | Soil | WKAGSIGRPKGAPTLGDFAAARTPGTDSAAFDADYVRRMPGELY |
| Ga0126371_115930061 | 3300021560 | Tropical Forest Soil | GRPKAAPTLGDFAAARNPGTDPAVYDADLARRVPNELY |
| Ga0242656_10572091 | 3300022525 | Soil | LVRSDLWKAGKGDRPKGVPTLGDFAAARTPGTDSSAYDADYARRMPSELY |
| Ga0212123_107262871 | 3300022557 | Iron-Sulfur Acid Spring | SQLWKAAGAGRPEGVPTLGAFTAARNPDADAATYDAEYARRMPNELY |
| Ga0242665_100644851 | 3300022724 | Soil | KGAPTLGDFAAARTPGTDSSAYDADYARRMPSELY |
| Ga0207692_104499531 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LVRSDLWKAGRGDRPKGAPTLGDFAAARTPGTDSSAYDADYARRMPNELY |
| Ga0207699_106598812 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLPKGLPTLGDFAAARAPGTDSSAYDADYARRMPSELY |
| Ga0207693_103794431 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GRPKGVPTLGDFVTARDPGTDSAAFDAAYSQRIPNELY |
| Ga0208369_10120721 | 3300026998 | Forest Soil | RPKGVPTLGDFAAARTPGTDSSAYDADYARRMPGELY |
| Ga0207949_10190442 | 3300026999 | Forest Soil | KAGKGDRPKGVPTLGDFAAARTPGTDSSAYDADYARRMPSELY |
| Ga0207826_10217533 | 3300027680 | Tropical Forest Soil | VRSDLWQAGSRGRPQGVPTLGDFAAARFPETDGAAYDAAYAKRIPNELY |
| Ga0209446_10445321 | 3300027698 | Bog Forest Soil | LVRSNLWRAAGGGRPKEAPTLGDFAAARNPGTDADAYNAEYAQRMPRELY |
| Ga0209447_101308381 | 3300027701 | Bog Forest Soil | ALVRSDLWRAAGAGRPKEAPTLGDFTAARNPGTDAAAYDAEYAQRMPSELY |
| Ga0209038_101937802 | 3300027737 | Bog Forest Soil | GRPEAAPTLGEFSAARNPGTDAAAYDAEYAERMPRELY |
| Ga0209167_107949151 | 3300027867 | Surface Soil | RPEGVPTLGAFAAARDPKSDKAAIDAAYAARVMDELY |
| Ga0209488_109039181 | 3300027903 | Vadose Zone Soil | MRNYGKRLIRKALVRSDLWKAGSIGRPKGAPTLGDFAAARTPRTDSAAFDADYALRMPSELY |
| Ga0222749_105010371 | 3300029636 | Soil | HRPKGVPTLGDFAAARTPGTDSSTFDADYARRMPSELY |
| Ga0170818_1119705562 | 3300031474 | Forest Soil | WKAGKGDRPKGVPTLGDFAAARTPGTDSSAYDADYARRMPNELY |
| Ga0318528_102756712 | 3300031561 | Soil | PKALIRSDLWGAAAAGRPKGAPTLGDFAAARNPGTDPAAYDADYARRMPNELY |
| Ga0318528_105930382 | 3300031561 | Soil | LWKASSSERPKGVPTLGDFAAARTPGIDSSAYDADYARRMPSELY |
| Ga0318573_102424992 | 3300031564 | Soil | PKALVRSNLWRAAGDGRPKEAPTLGDFAAARNPGADASAYDAEYAKRMPGELY |
| Ga0318515_102852391 | 3300031572 | Soil | GGRASGGRPEEAPTLGDFAAARNPGTDPAAYDAEYAKRMPGELY |
| Ga0310915_101560274 | 3300031573 | Soil | KGVPTLGDFAAARTPGTDPAAYDADLVRRMPNELY |
| Ga0318542_105769691 | 3300031668 | Soil | LVRSNLWRAAGDGRPKEAPTLGDFAAARNPGADASAYDAEYAKRMPGELY |
| Ga0318572_109124232 | 3300031681 | Soil | GRPQGVPTLGDFAAARFPETDGAAYDAAYAKRIPNELY |
| Ga0318560_103433303 | 3300031682 | Soil | WKAGSAGRPQGVPTLGDFAAARTPGTDSATYDADYAHRMPSELY |
| Ga0310686_1030088122 | 3300031708 | Soil | VEGNRPKGVPTLGDFAAARTPGTDSSAYDADYARRMPSELY |
| Ga0318496_107608611 | 3300031713 | Soil | KGVPTLGDFAAARAPGTDAAAYDADLARRLPNELY |
| Ga0307474_104855871 | 3300031718 | Hardwood Forest Soil | SGNRPKGVPTPGDFAAARAPGTDSSAYDADYARRMPSELY |
| Ga0307474_113310991 | 3300031718 | Hardwood Forest Soil | SDLWRAAGAGRPEAAPTLGEFSAARNPGTDAAAYDAEYAQRMPRELY |
| Ga0306917_105973491 | 3300031719 | Soil | KGVPTLGDFAAARTPGTDAATYDAEYAHRMPNELY |
| Ga0306917_106144562 | 3300031719 | Soil | PKALVRSNLWKAGSGDRPKSVPTLGDFAAARTPGTDSAAYDADYARRMPSELY |
| Ga0318493_104141391 | 3300031723 | Soil | PKALVRSNLWRAAGGGRPEEAPTLGDFAAARNPGTDAAAYDAEYAKRMPGELY |
| Ga0307477_109924332 | 3300031753 | Hardwood Forest Soil | RPEAAPTLGEFSAARNPGTDAAAYDAEYAQRMPRELY |
| Ga0307475_107814761 | 3300031754 | Hardwood Forest Soil | GDRPKGVPTLGDFAAARTPGTDSSAYNADYARRMPNELY |
| Ga0318509_105213462 | 3300031768 | Soil | WRAASGGRPKEAPTLGDFAAARNPGTDPAAYDAEYAKRMPGELY |
| Ga0318509_107636782 | 3300031768 | Soil | DLWNAGSAGRPKGVPTLGDFAAARTPGTDSATYDADYARRMPSELY |
| Ga0318526_103296542 | 3300031769 | Soil | LVRSDLWKAGSDGRPKGVPTLGDFAAARAPGTDAAAYDADLARRLPNELY |
| Ga0318543_103299211 | 3300031777 | Soil | AGSAGRPRGVPTLGDFAAARTPGTDSTAYDADYAHRMPSELY |
| Ga0318547_108543663 | 3300031781 | Soil | PKGVPTLGDFAAARTPGTDAATYDAEYAHRMPNELY |
| Ga0318552_104233442 | 3300031782 | Soil | DLWKAGSAGRPRGVPTLGDFAAARTPGTDSTAYDADYAHRMPSELY |
| Ga0318517_103350341 | 3300031835 | Soil | WRAAGAGRPKAAPTLGEFSAARNPGTDAAAYDAEYAQRMPRELY |
| Ga0306919_109622701 | 3300031879 | Soil | AGRPKGVPTLGDFAAARTPGTDPAAYDADLVRRMPNELY |
| Ga0306919_112547401 | 3300031879 | Soil | WKAGSVGRPTGVPTLGDFAAARTPGTDSVTYDAEYVRRMPSELY |
| Ga0310912_107347481 | 3300031941 | Soil | LVRSNLWKASSSERPKGVPTLGDFAAARTPGIDSSAYDADYARRMPSELY |
| Ga0310913_102151993 | 3300031945 | Soil | RSDLWKAGSVGRPKGVPTLGDFAAARTPGTDAAAYNADLARRMPGELY |
| Ga0310910_104142193 | 3300031946 | Soil | KAGSIGRPKGVPTLGDFAAARTPGTDSATYDADYARRMPSELY |
| Ga0310909_111910742 | 3300031947 | Soil | SSSERPKGVPTLGDFAAARTPGIDSSAYDADYARRMPSELY |
| Ga0306926_123226292 | 3300031954 | Soil | AAGGGRPEEAPTLGDFAAARNPGTDAAAYDAEYAKRMPGELY |
| Ga0318530_101346812 | 3300031959 | Soil | WRAAGAGRPESAPTLGDFAAARNPGTDADTYNAEYAQRMPNELY |
| Ga0306922_103742892 | 3300032001 | Soil | NLWKAGSGDRPKSVPTLGDFAAARTPGTDSAAYDADYARRMPSELY |
| Ga0306922_105721634 | 3300032001 | Soil | DLWKAGSAGRPQGVPTLGDFAAARTPGTDSATYDADYAHRMPSELY |
| Ga0306922_107545613 | 3300032001 | Soil | PWKAGSVGRPTGVPTLGDFAAARTPGTDSVTYDAEYVRRMPSELY |
| Ga0318507_103630772 | 3300032025 | Soil | NLWKASSSERPKGVPTLGDFAAARTPGIDSSAYDADYARRMPSELY |
| Ga0318556_102882041 | 3300032043 | Soil | KAGSAGRPQGVPTLGDFAAARTPGTDSATYDADYAHRMQSELY |
| Ga0318558_105153301 | 3300032044 | Soil | PKAAPTLGEFSAARNPGTDAAAYDAEYAQRMPRELY |
| Ga0318505_101740681 | 3300032060 | Soil | LVRSNLWRAAGRGRPEEAPTLGDFAAARNPGTDAAAYDAEYAKRMPGELY |
| Ga0318514_101572471 | 3300032066 | Soil | GSAGRPQGVPTLGDFAAARTPGTDSATYDADYAHRMPSELY |
| Ga0306924_120102531 | 3300032076 | Soil | RAASGGRPKEAPTLGDFAAARNPGTDPAAYDAEYAKRMPGELY |
| Ga0311301_122295132 | 3300032160 | Peatlands Soil | IRSNFWKSAERGRPKGVPTIGAFAAARNPGTDGAAYDEEYAKRLPEELY |
| Ga0307470_118822891 | 3300032174 | Hardwood Forest Soil | CPKALVRSNLWKSGSQGRPEGVPTLGDFAAARTPGTDSAAYDADLARRIPNELY |
| Ga0306920_1006472674 | 3300032261 | Soil | SDLWKAGSVGRPTGVPTLGDFAAARTPGTDSVTYDAEYVRRMPSELY |
| Ga0335085_118437922 | 3300032770 | Soil | AGRPKGVPTIGAFAAARNPEMDCDTYDAEYAKRMAEELY |
| Ga0318519_110038802 | 3300033290 | Soil | WKAGSGDRPKSVPTLGDFAAARTPGTDSAAYDADYARRMPSELY |
| ⦗Top⦘ |