| Basic Information | |
|---|---|
| Family ID | F063021 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PPPGMTALAPGRFGPLADDVLISRGLWQYAHYYDPAGSAP |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.17 % |
| % of genes near scaffold ends (potentially truncated) | 87.69 % |
| % of genes from short scaffolds (< 2000 bps) | 86.92 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.615 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.154 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 0.00% Coil/Unstructured: 70.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 14.62 |
| PF00583 | Acetyltransf_1 | 13.08 |
| PF00144 | Beta-lactamase | 10.77 |
| PF04672 | Methyltransf_19 | 4.62 |
| PF00501 | AMP-binding | 3.08 |
| PF00248 | Aldo_ket_red | 3.08 |
| PF00589 | Phage_integrase | 2.31 |
| PF12697 | Abhydrolase_6 | 2.31 |
| PF01266 | DAO | 2.31 |
| PF01210 | NAD_Gly3P_dh_N | 1.54 |
| PF13412 | HTH_24 | 1.54 |
| PF00072 | Response_reg | 1.54 |
| PF11954 | DUF3471 | 0.77 |
| PF01844 | HNH | 0.77 |
| PF03466 | LysR_substrate | 0.77 |
| PF04185 | Phosphoesterase | 0.77 |
| PF13404 | HTH_AsnC-type | 0.77 |
| PF13649 | Methyltransf_25 | 0.77 |
| PF00296 | Bac_luciferase | 0.77 |
| PF03328 | HpcH_HpaI | 0.77 |
| PF07969 | Amidohydro_3 | 0.77 |
| PF13420 | Acetyltransf_4 | 0.77 |
| PF01740 | STAS | 0.77 |
| PF13354 | Beta-lactamase2 | 0.77 |
| PF00805 | Pentapeptide | 0.77 |
| PF12902 | Ferritin-like | 0.77 |
| PF06736 | TMEM175 | 0.77 |
| PF01145 | Band_7 | 0.77 |
| PF03091 | CutA1 | 0.77 |
| PF00196 | GerE | 0.77 |
| PF00582 | Usp | 0.77 |
| PF12847 | Methyltransf_18 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 10.77 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 10.77 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 10.77 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.77 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 0.77 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.77 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.77 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.77 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.77 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.38 % |
| Unclassified | root | N/A | 34.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig02546 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 2170459010|GIO7OMY02HKH98 | Not Available | 500 | Open in IMG/M |
| 3300000955|JGI1027J12803_108544767 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300005332|Ga0066388_102189264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 997 | Open in IMG/M |
| 3300005332|Ga0066388_106810582 | Not Available | 575 | Open in IMG/M |
| 3300005336|Ga0070680_101683760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 550 | Open in IMG/M |
| 3300005355|Ga0070671_100427701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300005435|Ga0070714_100476240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1188 | Open in IMG/M |
| 3300005587|Ga0066654_10506133 | Not Available | 663 | Open in IMG/M |
| 3300005617|Ga0068859_101075083 | Not Available | 885 | Open in IMG/M |
| 3300005764|Ga0066903_100624512 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300005764|Ga0066903_102826552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 942 | Open in IMG/M |
| 3300005834|Ga0068851_10451550 | Not Available | 764 | Open in IMG/M |
| 3300006047|Ga0075024_100534002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 620 | Open in IMG/M |
| 3300006086|Ga0075019_10317445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 941 | Open in IMG/M |
| 3300006173|Ga0070716_100397068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 990 | Open in IMG/M |
| 3300006804|Ga0079221_10184989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
| 3300006804|Ga0079221_10228495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 1041 | Open in IMG/M |
| 3300006904|Ga0075424_102206129 | Not Available | 580 | Open in IMG/M |
| 3300006914|Ga0075436_100650495 | Not Available | 779 | Open in IMG/M |
| 3300006954|Ga0079219_11160879 | Not Available | 663 | Open in IMG/M |
| 3300009137|Ga0066709_103379858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300009148|Ga0105243_10474689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1179 | Open in IMG/M |
| 3300009700|Ga0116217_10428829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 837 | Open in IMG/M |
| 3300009792|Ga0126374_10675099 | Not Available | 773 | Open in IMG/M |
| 3300010358|Ga0126370_12341930 | Not Available | 529 | Open in IMG/M |
| 3300010359|Ga0126376_10029244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3704 | Open in IMG/M |
| 3300010360|Ga0126372_12722228 | Not Available | 546 | Open in IMG/M |
| 3300010376|Ga0126381_101373339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1021 | Open in IMG/M |
| 3300010376|Ga0126381_102428722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa aurea | 752 | Open in IMG/M |
| 3300010376|Ga0126381_103205862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 647 | Open in IMG/M |
| 3300010396|Ga0134126_11231548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 831 | Open in IMG/M |
| 3300010401|Ga0134121_10893149 | Not Available | 862 | Open in IMG/M |
| 3300012208|Ga0137376_10199486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1731 | Open in IMG/M |
| 3300012361|Ga0137360_11107640 | Not Available | 684 | Open in IMG/M |
| 3300015372|Ga0132256_102169849 | Not Available | 660 | Open in IMG/M |
| 3300016270|Ga0182036_11054624 | Not Available | 672 | Open in IMG/M |
| 3300016357|Ga0182032_10107243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1986 | Open in IMG/M |
| 3300016371|Ga0182034_11502492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
| 3300016404|Ga0182037_11811534 | Not Available | 545 | Open in IMG/M |
| 3300017822|Ga0187802_10310180 | Not Available | 616 | Open in IMG/M |
| 3300017924|Ga0187820_1083944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 899 | Open in IMG/M |
| 3300017955|Ga0187817_10960762 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
| 3300017955|Ga0187817_10978554 | Not Available | 542 | Open in IMG/M |
| 3300017970|Ga0187783_10442123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 944 | Open in IMG/M |
| 3300018012|Ga0187810_10062321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella flavida | 1422 | Open in IMG/M |
| 3300018058|Ga0187766_11035781 | Not Available | 586 | Open in IMG/M |
| 3300019888|Ga0193751_1008905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5372 | Open in IMG/M |
| 3300020170|Ga0179594_10358412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 553 | Open in IMG/M |
| 3300020581|Ga0210399_10883707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 726 | Open in IMG/M |
| 3300020583|Ga0210401_10402081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1232 | Open in IMG/M |
| 3300021401|Ga0210393_10873956 | Not Available | 730 | Open in IMG/M |
| 3300021407|Ga0210383_10752639 | Not Available | 836 | Open in IMG/M |
| 3300021407|Ga0210383_11133135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300021474|Ga0210390_10516571 | Not Available | 1005 | Open in IMG/M |
| 3300021478|Ga0210402_10964940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
| 3300021560|Ga0126371_10219632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2004 | Open in IMG/M |
| 3300021560|Ga0126371_11423247 | Not Available | 823 | Open in IMG/M |
| 3300024310|Ga0247681_1036058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 741 | Open in IMG/M |
| 3300025910|Ga0207684_10310947 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300025929|Ga0207664_10228552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1616 | Open in IMG/M |
| 3300025929|Ga0207664_10377991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1257 | Open in IMG/M |
| 3300026041|Ga0207639_11159720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 725 | Open in IMG/M |
| 3300026095|Ga0207676_10609284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1050 | Open in IMG/M |
| 3300027110|Ga0208488_1077531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300027167|Ga0208096_109807 | Not Available | 505 | Open in IMG/M |
| 3300027898|Ga0209067_10146788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1250 | Open in IMG/M |
| 3300027898|Ga0209067_10429279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 743 | Open in IMG/M |
| 3300028379|Ga0268266_11664347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 613 | Open in IMG/M |
| 3300028828|Ga0307312_10816430 | Not Available | 618 | Open in IMG/M |
| 3300030056|Ga0302181_10512780 | Not Available | 504 | Open in IMG/M |
| 3300031545|Ga0318541_10252686 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300031545|Ga0318541_10539350 | Not Available | 653 | Open in IMG/M |
| 3300031545|Ga0318541_10827942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300031640|Ga0318555_10494709 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031713|Ga0318496_10095767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1589 | Open in IMG/M |
| 3300031713|Ga0318496_10493885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 677 | Open in IMG/M |
| 3300031718|Ga0307474_10068639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2631 | Open in IMG/M |
| 3300031719|Ga0306917_11098501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300031720|Ga0307469_12014957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 560 | Open in IMG/M |
| 3300031723|Ga0318493_10059753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1830 | Open in IMG/M |
| 3300031723|Ga0318493_10111475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1383 | Open in IMG/M |
| 3300031724|Ga0318500_10738844 | Not Available | 503 | Open in IMG/M |
| 3300031747|Ga0318502_10297725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 948 | Open in IMG/M |
| 3300031763|Ga0318537_10117796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
| 3300031765|Ga0318554_10083322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1786 | Open in IMG/M |
| 3300031765|Ga0318554_10098401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1643 | Open in IMG/M |
| 3300031765|Ga0318554_10804030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 526 | Open in IMG/M |
| 3300031768|Ga0318509_10172889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
| 3300031769|Ga0318526_10057909 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300031770|Ga0318521_10857730 | Not Available | 554 | Open in IMG/M |
| 3300031771|Ga0318546_10030262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3217 | Open in IMG/M |
| 3300031771|Ga0318546_10157253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1535 | Open in IMG/M |
| 3300031795|Ga0318557_10355561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. SID8362 | 673 | Open in IMG/M |
| 3300031819|Ga0318568_10939004 | Not Available | 535 | Open in IMG/M |
| 3300031831|Ga0318564_10014017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3235 | Open in IMG/M |
| 3300031833|Ga0310917_10756136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 657 | Open in IMG/M |
| 3300031835|Ga0318517_10275146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 760 | Open in IMG/M |
| 3300031860|Ga0318495_10276345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 750 | Open in IMG/M |
| 3300031879|Ga0306919_11106801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300031897|Ga0318520_10163556 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300031945|Ga0310913_10519258 | Not Available | 846 | Open in IMG/M |
| 3300032010|Ga0318569_10188566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300032043|Ga0318556_10104443 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300032043|Ga0318556_10130731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1288 | Open in IMG/M |
| 3300032052|Ga0318506_10072335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1434 | Open in IMG/M |
| 3300032052|Ga0318506_10237447 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300032055|Ga0318575_10576636 | Not Available | 570 | Open in IMG/M |
| 3300032066|Ga0318514_10183308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1094 | Open in IMG/M |
| 3300032068|Ga0318553_10641369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300032076|Ga0306924_12139682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. | 572 | Open in IMG/M |
| 3300032090|Ga0318518_10148336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1191 | Open in IMG/M |
| 3300032261|Ga0306920_100837767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1348 | Open in IMG/M |
| 3300032261|Ga0306920_102116713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 785 | Open in IMG/M |
| 3300032770|Ga0335085_10635252 | Not Available | 1196 | Open in IMG/M |
| 3300032805|Ga0335078_12026239 | Not Available | 615 | Open in IMG/M |
| 3300032896|Ga0335075_11194145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 661 | Open in IMG/M |
| 3300033134|Ga0335073_10735242 | Not Available | 1071 | Open in IMG/M |
| 3300033289|Ga0310914_10357870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1320 | Open in IMG/M |
| 3300033290|Ga0318519_11019468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.54% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.77% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027167 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF034 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00514960 | 2166559006 | Grass Soil | MTALAPDRFGPLTGDVLVSRGLWQYAHYYDPAGVAS |
| F62_09829610 | 2170459010 | Grass Soil | ARRWPPWITTGAAPPGMTALAPGRFGPLPDDELVTRGLWQYAHYYDPMVS |
| JGI1027J12803_1085447671 | 3300000955 | Soil | GLTALSPGRFGPLPDDELVTRGLWQYAHYYDPAAPDLE* |
| Ga0066388_1021892641 | 3300005332 | Tropical Forest Soil | TGAAPPGLTALSPGRFGPLPDDELVSRGLWQYAHYYDPAAPDLE* |
| Ga0066388_1068105822 | 3300005332 | Tropical Forest Soil | TGAAPPGLTALSPGRFGPLPDDELVSRGLWQYAHYYDPAAADPE* |
| Ga0070680_1016837601 | 3300005336 | Corn Rhizosphere | TSDTPPPGMTALSPDRFGPLSDEVLVSRGLWQYAHYYDPAGVPS* |
| Ga0070671_1004277011 | 3300005355 | Switchgrass Rhizosphere | AAWITSDTPPPGMTALSPDRFGPLTGEVLVSRGLWQYAHYYDPAGVAS* |
| Ga0070714_1004762403 | 3300005435 | Agricultural Soil | TPPPGMTALAPDRFGPLSDEVLVSRGLWQYAHYYDPAGVPA* |
| Ga0066661_109354321 | 3300005554 | Soil | DTPPPGMTALAPGRFGPLTDDVLISRGLWQYAHYYDPAGGAPEAAGPDR* |
| Ga0066654_105061332 | 3300005587 | Soil | MMALSPGRFGPLTDDVLVSRGLWQYAHYYDPAGVAS* |
| Ga0068859_1010750832 | 3300005617 | Switchgrass Rhizosphere | LAAWITSDTPPPGMTALSPDRFGPLTGDVLVSRGLWQYAHYYDPAGVPS* |
| Ga0066903_1006245121 | 3300005764 | Tropical Forest Soil | PPGMMLLAPDRFGPASDDALVKDGLWQYAHYYDPVASDLV* |
| Ga0066903_1028265523 | 3300005764 | Tropical Forest Soil | WITTGTPPPGFEALSPARFGPLPDDTLIARGMWQYAHYYDPAA* |
| Ga0068851_104515502 | 3300005834 | Corn Rhizosphere | SDTPPPGMTALAPDRFGPLIDEVLVSRGLWQYAHYYDPAGVPS* |
| Ga0075024_1005340022 | 3300006047 | Watersheds | AWITGGGPPPGLSALSPGRFGPLPDDDLLSRGLWQYAHYYDPTTS* |
| Ga0075019_103174452 | 3300006086 | Watersheds | AWITGGTPPPGLSVLSPGRFGPLPDDDLLSRGLWQYAHYYDPSTS* |
| Ga0070716_1003970681 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GMTALSPDRFGPLTGDVLVSRGLWQYAHYYDPAGVPS* |
| Ga0079221_101849893 | 3300006804 | Agricultural Soil | PPGMTALAPDRFGPLSDEVLVSRGLWQYAHYYDPAGVPA* |
| Ga0079221_102284953 | 3300006804 | Agricultural Soil | MTSDTPPPGMMALSPDRFGPVSDEVLVSRGLWQYAHYYDPAGVAS* |
| Ga0075424_1022061291 | 3300006904 | Populus Rhizosphere | LAAWITSDTPPPGMTALAPDRFGPMTGEALVSRGLWQYAHYYDPAGVPS* |
| Ga0075436_1006504951 | 3300006914 | Populus Rhizosphere | SDTPPPGMTALAPDRFGPLSDEVLVSRGLWQYAHYYDPAGVPA* |
| Ga0079219_111608791 | 3300006954 | Agricultural Soil | ALSPARLGTLPDDALISRGLWQYAHYYDPAPGGASG* |
| Ga0066709_1033798581 | 3300009137 | Grasslands Soil | PPPGMTALAPGRFGPLADDVLISRGLWQYAHYYDPAGSAP* |
| Ga0105243_104746891 | 3300009148 | Miscanthus Rhizosphere | ITSDSPPSGMTALSPARFGPLPAEELVSRGLWQYAHYYDPASVAS* |
| Ga0116218_11426582 | 3300009522 | Peatlands Soil | MTALSPGRFGPLPDDALLTRGLWQYAHYYGPVTSAP |
| Ga0116217_104288291 | 3300009700 | Peatlands Soil | PGLSVLSPGRFGPLPDDDLLSRGLWQYAHYYDPSTS* |
| Ga0126374_106750992 | 3300009792 | Tropical Forest Soil | APGRFGPLTDDVLVSRGLWQYAHYYDPLAGSAVSGS* |
| Ga0126370_123419302 | 3300010358 | Tropical Forest Soil | GVEALSPARFGTLPDDALITRGLWQYAHYYDPAPAGGAAR* |
| Ga0126376_100292441 | 3300010359 | Tropical Forest Soil | LTALSPGRFGPLPDDELVSRGLWQYAHYYDPAAADPE* |
| Ga0126372_127222281 | 3300010360 | Tropical Forest Soil | WITTGAAPPGMTALSPGRFGPLPDDELVSRGLWQYAHYYDPAEALSSGAPPA* |
| Ga0126381_1013733391 | 3300010376 | Tropical Forest Soil | DLAPGRFGPLTDDALVSRGLWQYAHYYDPVGPDQG* |
| Ga0126381_1024287221 | 3300010376 | Tropical Forest Soil | MTDLAPGRFGPLTDDALVSRGLWQYAHYYDPTGPDQG* |
| Ga0126381_1032058623 | 3300010376 | Tropical Forest Soil | PGMAALAPARFGALTEDVLVSRGIWQYAHYYDPASQPA* |
| Ga0134126_112315481 | 3300010396 | Terrestrial Soil | SDTPPPGMTALSPDRFGPLTGDVLVSRGLWQYAHYYDPAGVAS* |
| Ga0134121_108931491 | 3300010401 | Terrestrial Soil | TALSPDRFGPLTGDVLVSRGLWQYAHYYDPAGVPS* |
| Ga0137376_101994863 | 3300012208 | Vadose Zone Soil | AAPSGMTALAPGRFGPLADDVLVTRGLWEYAHFYDPVGNGPERS* |
| Ga0137360_111076402 | 3300012361 | Vadose Zone Soil | ITGDTPPPGMTELSPDRFGPVTDDALVSRGLWQYAHYYDPADGAP* |
| Ga0132256_1021698492 | 3300015372 | Arabidopsis Rhizosphere | PGITALSPGRFGPLTDDALVSRGLWQYAHYYDPVGDAP* |
| Ga0182036_110546242 | 3300016270 | Soil | GMAALSPARFGPLPDDALITRGLWQYAHYYDPASADGTAR |
| Ga0182032_101072431 | 3300016357 | Soil | ITSGAPPPGLTALAPARFGPLPDDALLSRGLWQYAHYYDPAPS |
| Ga0182034_115024922 | 3300016371 | Soil | ATWITTGTPPPGFEALSPARFGPLPDDTLIARGLWQYAHYYDPAA |
| Ga0182037_118115342 | 3300016404 | Soil | ATSITTGTPPPGMEALSPARFGTLPDDALITRGLWQYAHYYDPAPAGGTA |
| Ga0187802_103101802 | 3300017822 | Freshwater Sediment | MVGGLAELSPGRFGPLPDDALLSRGLWQYAHYYDPVGTELRSSGD |
| Ga0187820_10839443 | 3300017924 | Freshwater Sediment | GLAALSPGRFGPLPDDTLISRGLWQYAHYYDPTRLDLE |
| Ga0187817_109607621 | 3300017955 | Freshwater Sediment | TGDEPAGLAALSPGRFGPLPDDTLISRGLWQYAHYYDPTGLDLE |
| Ga0187817_109785541 | 3300017955 | Freshwater Sediment | ELSPGRFGPLPDDALLSRGLWQYAHYYDPVGTELR |
| Ga0187783_104421231 | 3300017970 | Tropical Peatland | WITSGTPPPGLTALAPARFGLLPDDTLLTRGLWQYAHYYDPTDPDLG |
| Ga0187810_100623213 | 3300018012 | Freshwater Sediment | MVGGLAELSPGRFGPLPDDALLSRGLWQYAHYYDPVGTELR |
| Ga0187766_110357811 | 3300018058 | Tropical Peatland | PGLSALPPGRFGPLPDDALLSRGLWQYAHYYDPAAPDLG |
| Ga0193751_10089057 | 3300019888 | Soil | WITDGRPQPGLAALSPGRFAGLTDDALVRNGIWQYAHYYDPAAAGSG |
| Ga0179594_103584122 | 3300020170 | Vadose Zone Soil | TGDTPPPGMTALAPDRFGPVSDEVLISRGLWQYAHYYDPAGVPS |
| Ga0210399_108837072 | 3300020581 | Soil | AEFSPGRFGRLRDDVLLDRGLWQYAHYYDPTAPDLG |
| Ga0210395_110435821 | 3300020582 | Soil | TPPPGMTALAPGRFGPLTDDVLISRGLWQYAHYYDPAGGAPEAAGPDR |
| Ga0210401_104020812 | 3300020583 | Soil | WITSGTPPPGLAEFSPGRFGRLRDDVLLDRGLWQYAHYYDPIAPDLG |
| Ga0210393_108739561 | 3300021401 | Soil | TGGSPPEGMAALSPGRFGPVRDDELTSRGLWQYAHYYDPAA |
| Ga0210386_115500351 | 3300021406 | Soil | ALATWITSGTPPPGLAELSPGRFGRLRDDVLLDRGLWQYAHYYDPIAPDLG |
| Ga0210386_116576271 | 3300021406 | Soil | PPGLTALSPARFGPLSDDALITRGLWQYTHYYDPAGPVTPEPAEPE |
| Ga0210383_107526392 | 3300021407 | Soil | PGFAALSPARFGPLPDDTLVTQGLWQYAHYYDPAGSL |
| Ga0210383_111331352 | 3300021407 | Soil | GFAALSPARFGPLPDDTLVTQGLWQYAHYYDPVAVAPGR |
| Ga0210390_105165712 | 3300021474 | Soil | TTGTPPPGFAARSPARFGPLPDDTLVTQGLWQYAHYYDPADNL |
| Ga0210402_109649402 | 3300021478 | Soil | EELATWITTGAPSPGMEALSPARFGPLPDDALIARGVWQYAHYYDPAPAPG |
| Ga0210409_104913812 | 3300021559 | Soil | PPGMTALAPGRFGPLTDDVLISRGLWQYAHYYDPAGGAPEAAGPDR |
| Ga0126371_102196321 | 3300021560 | Tropical Forest Soil | TWITTGAPPPGMEALSPARFGALPDDTLITRGLWQYAHYYDPAPAGQP |
| Ga0126371_114232472 | 3300021560 | Tropical Forest Soil | VAALSPARFGTLPDDALITRGLWQYAHYYDPAPAGGAPR |
| Ga0213853_113391411 | 3300021861 | Watersheds | MTALSPGRFGPLPDDALLTRGLWQYAHYYDPVPSAPT |
| Ga0247681_10360581 | 3300024310 | Soil | LAAWITSDTPPPGMTALSPDRFGPLTGEVLVSRGLWQYAHYYDPAGVAS |
| Ga0207699_103420053 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GDTPPPGMTALAPGRFGPLTDDVLISRGLWQYAHYYDPAGGAPEAAGPDR |
| Ga0207684_103109471 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PGMASLSPARLGPLPDDTLITRGLWQYAHYYDPAPAGAHQPG |
| Ga0207663_107490092 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RFGPLTDDVLISRGLWQYAHYYDPAGGAPEAAGPDR |
| Ga0207664_102285521 | 3300025929 | Agricultural Soil | SDTPPPGMTALAPDRFGPLSDEVLVSRGLWQYAHYYDPAGVPA |
| Ga0207664_103779913 | 3300025929 | Agricultural Soil | SDTPPPGMTALAPDRFGPLSDEVLVSRGLWQYAHYYDPAGVPS |
| Ga0207665_112438691 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PPPGRTGLAPGRFGPMADDVLISRGLWQYAHYYDPAGGAPEAAGPDR |
| Ga0207639_111597202 | 3300026041 | Corn Rhizosphere | WITSDTPPPGMTALAPDRFGPLSDEVLVSRGLWQYAHYYDPAGVPS |
| Ga0207676_106092841 | 3300026095 | Switchgrass Rhizosphere | TELSPGRFGPVTDDALVSRGLWQYAHYYDPVGSAP |
| Ga0208488_10775312 | 3300027110 | Forest Soil | PPGMTALSPGRFGPLPDAALLTRGLWQYAHYYDPVTSTTG |
| Ga0208096_1098072 | 3300027167 | Forest Soil | GLAELSPGRFGRLPDNVLLDRGLWQYAHYYDPTAPDLG |
| Ga0209067_101467881 | 3300027898 | Watersheds | VNIWKITSGDAPPGVEALSPGRFGPLPDDVLLTRGLWQYAHY |
| Ga0209067_104292791 | 3300027898 | Watersheds | AWITGGTPPPGLSVLSPGRFGPLPDDDLLSRGLWQYAHYYDPSTS |
| Ga0268266_116643472 | 3300028379 | Switchgrass Rhizosphere | PGMTALSPDRFGPLSDEVLVSRGLWQYAHYYDPAGVPS |
| Ga0307312_108164301 | 3300028828 | Soil | DTPPPGMTALAPDRFGPLTGDVLVSRGLWQYAHYYDPAGVAS |
| Ga0302181_105127802 | 3300030056 | Palsa | PPGMTALSPGRFGPLPDAVLLTRGLWQYAHYYDPVTSTTG |
| Ga0318541_102526862 | 3300031545 | Soil | MTDLAPGRFGPLTDDALVSRGLWQYARYYDPVAGTVVSGG |
| Ga0318541_105393501 | 3300031545 | Soil | WITTGTAPPGAEALSPARFGALPDDALITRGLWQYAHYYDPAPA |
| Ga0318541_108279422 | 3300031545 | Soil | TGTAPPGAEALSPARFGPLPDDAVITRGLWQYAHYYDPAPA |
| Ga0318555_104947092 | 3300031640 | Soil | MAAWITGHAPPGLTALSPGRFGPLRDDALVSRGLWQYAHYYDPVVPDLD |
| Ga0318496_100957672 | 3300031713 | Soil | PGLAALAPARFGPLPDDALLSRGLWQYAHYYDPATS |
| Ga0318496_104938851 | 3300031713 | Soil | TGQTPPPGMTDLAPGRFGPLTDDALVSRGLWQYAHYYDPVAGPALSGG |
| Ga0307474_100686392 | 3300031718 | Hardwood Forest Soil | MTALAPDRFGPLSGEVLVSRGLWQYAHYYDPAGVPS |
| Ga0306917_110985012 | 3300031719 | Soil | TAPPGAEALSPARFGPLPDDAVITRGLWQYAHYYDPAPA |
| Ga0307469_120149572 | 3300031720 | Hardwood Forest Soil | WITSDTPPPGMTALSPDRFGPLSDEVLVSRGLWQYAHYYDPASVAS |
| Ga0318493_100597531 | 3300031723 | Soil | TDLAPGRFGPLTDDVLVTRGLWQYAHYYDPVAGSALSGS |
| Ga0318493_101114751 | 3300031723 | Soil | EALATWITTGTAPPGAEALSPARFGALPDDALITRGLWQYAHYYDPAPA |
| Ga0318500_107388441 | 3300031724 | Soil | GMTALAPGRFGPLPDDELVTRGLWQYAHYYDPAAPDPG |
| Ga0318502_102977251 | 3300031747 | Soil | TGETPPPGMTDLAPGRFGPLTDDVLVTRGLWQYAHYYDPVAGSALSGS |
| Ga0318537_101177961 | 3300031763 | Soil | WITAGAPPPGGEALSPARFGPLPDDSLITQGLWQYAHYYDPAPA |
| Ga0318554_100833221 | 3300031765 | Soil | GADALAPARFGALTDDVLVSRGIWQYAHYYDPASQPA |
| Ga0318554_100984011 | 3300031765 | Soil | ATWITTGTAPPGAEALSPARFGPLPDDALITRGLWQYAHYYDPAPA |
| Ga0318554_108040302 | 3300031765 | Soil | TWITGGTPPPGLTALAPARFGPLPDDALLSRGLWQYAHYYDPATS |
| Ga0318509_101728893 | 3300031768 | Soil | DAPLGMTALAPGRFGPLPDDELVTRGLWQYAHYYDPAAPDPG |
| Ga0318526_100579092 | 3300031769 | Soil | PPGFEALSPARFGPLPEDTLLARGLWQYAHYYDPAA |
| Ga0318521_108577302 | 3300031770 | Soil | AWITGHAPPGLTALSPGRFGPLRDDALVSRGLWQYAHYYDPVLPDLD |
| Ga0318546_100302621 | 3300031771 | Soil | PEPLQPLATWITTGTPPPGFEALSPARFGPLPDDTLIARGLWQYAHYYDPAA |
| Ga0318546_101572531 | 3300031771 | Soil | PPPGMTDLAPGRFGPLTDDVLVSRGIWQYAHYYDPTAPDLG |
| Ga0318557_103555611 | 3300031795 | Soil | PPGLTALSPGRFGPLRDDALVSRGLWQYAHYYDPVVPDLD |
| Ga0318568_109390041 | 3300031819 | Soil | LSPARFGTLPDDALITRGLWQYAHYYDPAPAGGTA |
| Ga0318564_100140177 | 3300031831 | Soil | ITGETPPPGMTDLAPGRFGPLTDDVLVSRGIWQYAHYYDPTAPDLG |
| Ga0310917_107561361 | 3300031833 | Soil | GMTDLAPGRFGPLTDDALVSRGLWQYARYYDPVAGTVVSGG |
| Ga0318517_102751461 | 3300031835 | Soil | PPPGMTDLAPGRFGPLTDDVLVTRGLWQYAHYYDPVAGSALSGS |
| Ga0318495_102763451 | 3300031860 | Soil | GLAALAPARFGPLPDDALLSRGLWQYAHYYDPATS |
| Ga0306919_111068011 | 3300031879 | Soil | PGFEALSPARFGPLPDDTLIARGLWQYAHYYDPAA |
| Ga0318520_101635562 | 3300031897 | Soil | TVSPPPGFEALSPARFGPLPEDTLLARGLWQYAHYYDPAA |
| Ga0310913_105192581 | 3300031945 | Soil | ADGTPPPGMTDLAPGRFGPLADDALVSRGLWQYARYYDPVAGTVVSGG |
| Ga0318569_101885661 | 3300032010 | Soil | APPGAEALSPARFGPLPDDAVITRGLWQYAHYYDPAPA |
| Ga0318556_101044431 | 3300032043 | Soil | AWITTGSPPPGFEALSPARFGPLPEDTLLARGLWQYAHYYDPAA |
| Ga0318556_101307312 | 3300032043 | Soil | WITTGTAPPGAEALSPARFGPLPDDAVITRGLWQYAHYYDPAPA |
| Ga0318506_100723355 | 3300032052 | Soil | PGMTDLAPGRFGPLTDDVLVSRGIWQYAHYYDPTAPDLG |
| Ga0318506_102374471 | 3300032052 | Soil | MTDLAPGRFGPLTDDALVSRGLWQYAHYYDPVAPDL |
| Ga0318575_105766361 | 3300032055 | Soil | ALSPARFGTLPDDALITRGLWQYAHYYDPAPAGGATR |
| Ga0318514_101833081 | 3300032066 | Soil | FADWAGTPLAVARSGPLPDDALLSRGLWQYAHYYDPATS |
| Ga0318553_106413692 | 3300032068 | Soil | WITSGAPPPGLTALAPARFGPLPDDALLSRGLWQYAHYYDPAAPDPG |
| Ga0306924_121396822 | 3300032076 | Soil | GMTDLAPGRFGPLTDDVLVTRGLWQYAHYYDPVAGSALSGS |
| Ga0318518_101483362 | 3300032090 | Soil | TWITGGTPPPGLAALAPARFGPLPDDALLSRGLWQYAHYYDPATS |
| Ga0306920_1008377672 | 3300032261 | Soil | LATWITGGTPPPGLAALAPARFGPLPDDALLSRGLWQYAHYYDPATS |
| Ga0306920_1021167131 | 3300032261 | Soil | ATWITSGAPPPGLTALAPARFGPLPDDALLSRGLWQYAHYYDPAAPDPG |
| Ga0335085_106352522 | 3300032770 | Soil | PPGMTDLAPGRFGPLTDDVLVSRGLWQYAHYYDPAGVP |
| Ga0335078_120262392 | 3300032805 | Soil | TPPPGMTALAPDRFGPVTGEALVSRGLWQYAHYYDPAGVAS |
| Ga0335075_111941452 | 3300032896 | Soil | TSGAPSPDLAPFSPARFGPLPDDVLVSRGLWQYAHYYDPVTS |
| Ga0335073_107352424 | 3300033134 | Soil | LAGLAPSRFGRLADQDLIERGCWQYAHYYDPAGSDLG |
| Ga0310914_103578701 | 3300033289 | Soil | GMTDLAPGRFGPLTDDVLVSRGIWQYAHYYDPTAPDLG |
| Ga0318519_110194681 | 3300033290 | Soil | ITGGTPPPGMSALAPGRFGPLPDDELLSRGRWQYAHYYDPATS |
| ⦗Top⦘ |