Basic Information | |
---|---|
Family ID | F063018 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 130 |
Average Sequence Length | 43 residues |
Representative Sequence | VALDPKHLPEDPKVLQQMVLDLMAQLDREFTERNKIEALLR |
Number of Associated Samples | 116 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 41.54 % |
% of genes near scaffold ends (potentially truncated) | 96.15 % |
% of genes from short scaffolds (< 2000 bps) | 99.23 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.692 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.539 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.692 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.308 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF05717 | TnpB_IS66 | 86.92 |
PF01527 | HTH_Tnp_1 | 2.31 |
PF13518 | HTH_28 | 1.54 |
PF08388 | GIIM | 1.54 |
PF13005 | zf-IS66 | 0.77 |
PF13701 | DDE_Tnp_1_4 | 0.77 |
PF12867 | DinB_2 | 0.77 |
PF13610 | DDE_Tnp_IS240 | 0.77 |
PF00589 | Phage_integrase | 0.77 |
PF01610 | DDE_Tnp_ISL3 | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 86.92 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.69 % |
Unclassified | root | N/A | 22.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10100631 | Not Available | 712 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1032107 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1098541 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300001305|C688J14111_10080386 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → Blastopirellula marina | 990 | Open in IMG/M |
3300002568|C688J35102_117923377 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300003218|JGI26339J46600_10077468 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300004081|Ga0063454_102006222 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300004633|Ga0066395_10575800 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300005172|Ga0066683_10621639 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005180|Ga0066685_11158624 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005293|Ga0065715_10815154 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005363|Ga0008090_14423683 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005363|Ga0008090_15823857 | Not Available | 564 | Open in IMG/M |
3300005364|Ga0070673_102381805 | Not Available | 503 | Open in IMG/M |
3300005437|Ga0070710_10851238 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300005457|Ga0070662_102004653 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005467|Ga0070706_100343098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1392 | Open in IMG/M |
3300005518|Ga0070699_101479218 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005557|Ga0066704_10660290 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300005617|Ga0068859_102103315 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005843|Ga0068860_102202230 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005921|Ga0070766_11033992 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005944|Ga0066788_10025496 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300005950|Ga0066787_10027955 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300005995|Ga0066790_10118146 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300006028|Ga0070717_10551555 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300006059|Ga0075017_100308942 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300006102|Ga0075015_100955956 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300006173|Ga0070716_100433543 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula | 954 | Open in IMG/M |
3300006845|Ga0075421_101485829 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300006852|Ga0075433_10819450 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula | 813 | Open in IMG/M |
3300006894|Ga0079215_10077667 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300006894|Ga0079215_10128951 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula | 1169 | Open in IMG/M |
3300006914|Ga0075436_100930134 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300007004|Ga0079218_12709302 | Not Available | 592 | Open in IMG/M |
3300007265|Ga0099794_10492480 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300009012|Ga0066710_102941513 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300009012|Ga0066710_104675387 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300009038|Ga0099829_11705105 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300009088|Ga0099830_10898633 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300009091|Ga0102851_11198870 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300009524|Ga0116225_1507209 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300009637|Ga0116118_1177726 | Not Available | 676 | Open in IMG/M |
3300010323|Ga0134086_10327069 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300010362|Ga0126377_11988608 | Not Available | 657 | Open in IMG/M |
3300010366|Ga0126379_10621018 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300010376|Ga0126381_102360814 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300010376|Ga0126381_102776470 | Not Available | 699 | Open in IMG/M |
3300010376|Ga0126381_103445479 | Not Available | 622 | Open in IMG/M |
3300010396|Ga0134126_12566352 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300010398|Ga0126383_12435437 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300012189|Ga0137388_11574627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300012199|Ga0137383_10502344 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300012200|Ga0137382_10392374 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300012202|Ga0137363_10812529 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300012205|Ga0137362_10968936 | Not Available | 725 | Open in IMG/M |
3300012205|Ga0137362_10991521 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300012211|Ga0137377_11351452 | Not Available | 642 | Open in IMG/M |
3300012211|Ga0137377_11918891 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300012285|Ga0137370_10393315 | Not Available | 839 | Open in IMG/M |
3300012917|Ga0137395_10496350 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300012955|Ga0164298_10948691 | Not Available | 630 | Open in IMG/M |
3300012971|Ga0126369_12840363 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300012975|Ga0134110_10528824 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300012985|Ga0164308_11892008 | Not Available | 556 | Open in IMG/M |
3300014161|Ga0181529_10335403 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300014164|Ga0181532_10600084 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300014165|Ga0181523_10205191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
3300014165|Ga0181523_10378964 | Not Available | 790 | Open in IMG/M |
3300014501|Ga0182024_12870607 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300014883|Ga0180086_1121866 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300015052|Ga0137411_1280694 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300015067|Ga0167640_118682 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300015245|Ga0137409_10766599 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300015374|Ga0132255_105339803 | Not Available | 544 | Open in IMG/M |
3300016404|Ga0182037_11051367 | Not Available | 711 | Open in IMG/M |
3300016422|Ga0182039_10356551 | Not Available | 1230 | Open in IMG/M |
3300017822|Ga0187802_10127517 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300017924|Ga0187820_1063010 | Not Available | 1020 | Open in IMG/M |
3300017946|Ga0187879_10087781 | Not Available | 1792 | Open in IMG/M |
3300017961|Ga0187778_11319689 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300018026|Ga0187857_10340917 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300018030|Ga0187869_10140190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1203 | Open in IMG/M |
3300018033|Ga0187867_10629179 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300018038|Ga0187855_10243840 | Not Available | 1055 | Open in IMG/M |
3300018038|Ga0187855_10701851 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300018043|Ga0187887_10948087 | Not Available | 509 | Open in IMG/M |
3300018044|Ga0187890_10479942 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300018046|Ga0187851_10070299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2226 | Open in IMG/M |
3300018431|Ga0066655_10718457 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300020022|Ga0193733_1190842 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300020150|Ga0187768_1066420 | Not Available | 809 | Open in IMG/M |
3300020579|Ga0210407_10531480 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300021168|Ga0210406_11083767 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300021362|Ga0213882_10202927 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300025905|Ga0207685_10155598 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1039 | Open in IMG/M |
3300026142|Ga0207698_12733774 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300026215|Ga0209849_1080663 | Not Available | 574 | Open in IMG/M |
3300026334|Ga0209377_1272649 | Not Available | 559 | Open in IMG/M |
3300026497|Ga0257164_1024587 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300027546|Ga0208984_1087471 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300027651|Ga0209217_1032072 | Not Available | 1640 | Open in IMG/M |
3300027703|Ga0207862_1078513 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300027842|Ga0209580_10202484 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 985 | Open in IMG/M |
3300027869|Ga0209579_10781184 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300027886|Ga0209486_10987797 | Not Available | 564 | Open in IMG/M |
3300028381|Ga0268264_12048111 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300031057|Ga0170834_106902132 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300031234|Ga0302325_13267460 | Not Available | 515 | Open in IMG/M |
3300031792|Ga0318529_10166057 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300031890|Ga0306925_10867382 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300031945|Ga0310913_10412402 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300032001|Ga0306922_12398614 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300032076|Ga0306924_11931852 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300032782|Ga0335082_10554043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
3300032805|Ga0335078_10913530 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300032805|Ga0335078_11775203 | Not Available | 672 | Open in IMG/M |
3300032828|Ga0335080_10848425 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300032828|Ga0335080_10872066 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300032892|Ga0335081_11120093 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 905 | Open in IMG/M |
3300032892|Ga0335081_12565450 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300032897|Ga0335071_10907947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 828 | Open in IMG/M |
3300032954|Ga0335083_10815216 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300032955|Ga0335076_10635293 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300033004|Ga0335084_10573113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
3300033158|Ga0335077_10821793 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 944 | Open in IMG/M |
3300033158|Ga0335077_12023157 | Not Available | 534 | Open in IMG/M |
3300034172|Ga0334913_112641 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300034268|Ga0372943_0308672 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300034402|Ga0334960_065069 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.08% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.08% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.08% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.31% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.31% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.54% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.54% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.54% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.54% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.54% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.54% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.54% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.77% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.77% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.77% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.77% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.77% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.77% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.77% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.77% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.77% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.77% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015067 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7A, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034402 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 56SNS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_101006313 | 3300000597 | Forest Soil | VAIAIEHLPEDPKVLQKMVLDLTAQLDRESAERHKVETILREL |
AF_2010_repII_A100DRAFT_10321071 | 3300000655 | Forest Soil | VAIAIEHLPEDPKVLQKMVLDLTAQLDRESAERHKVETILRELIEARRSRK |
AF_2010_repII_A100DRAFT_10985412 | 3300000655 | Forest Soil | VAIDPKHLPEDPKVLQQMVLDLMTQLDREFSERNKIESLLRELL |
C688J14111_100803861 | 3300001305 | Soil | VALDPKHLPDDAKTLQQMVLDLMAQLDREFSERGKVETLL |
C688J35102_1179233771 | 3300002568 | Soil | VAIDPKHLPDDPKALQQMVLDLMAQLDREFTERGKVETLLRELL |
JGI26339J46600_100774683 | 3300003218 | Bog Forest Soil | VAIDSQHLPEDPQVLQKMVRDLMAQLDRESAERHKIEAMLRELLDARRNR |
Ga0063454_1020062222 | 3300004081 | Soil | VAIDPKHLPDDPKALQQMVLDLMAQLEREFTERGKVETLLRELLDAKRNRK |
Ga0066395_105758003 | 3300004633 | Tropical Forest Soil | LLVAIDAKHLPHDPKVLQQMVLDLMAQLDRESAERNKFETLLR |
Ga0066683_106216391 | 3300005172 | Soil | VALDPKHLPEDPKVLQQMVLDLMAQVDREHTERNKIESLLRELLDAKRNRKE* |
Ga0066685_111586242 | 3300005180 | Soil | VAIDPKHLPEDPKILQQMVLDLMTQLDKEFSERNKIESLL |
Ga0065715_108151542 | 3300005293 | Miscanthus Rhizosphere | VAFDPKHLPEDPKVLQQMVLDLITQLDRECTERNKIEVLLRELLDARRNR |
Ga0008090_144236832 | 3300005363 | Tropical Rainforest Soil | VNTLREDLLTVAIDPKHLPEDPKVLQQMVLDLMRQLNREFSERNKIESLLRELLDAK |
Ga0008090_158238572 | 3300005363 | Tropical Rainforest Soil | VAIGIEHLPEDPKVLQKMVLDLTAQLDRESAERHKVETILREL |
Ga0070673_1023818051 | 3300005364 | Switchgrass Rhizosphere | VSTLIEKTHLLVAIDPKYLPEDPKVLQQMVLDLLAQLDREFSERSKIAS |
Ga0070710_108512382 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIDIEHLPEDPKILQKMVQDLTAQLDRESAERHKVETILREL |
Ga0070662_1020046532 | 3300005457 | Corn Rhizosphere | VALNPKHLPEDPKVLQQMVLDLMTQLDREFTERNKIEALLR |
Ga0070706_1003430981 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VALDPKHLPEDPQVLQQMVLDLMAQLDHEFTERNKIEALLRELLDARRN |
Ga0070699_1014792182 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VALDPKHLPEDPQVLQQMVLDLMAQLDREFTERNKIEALLRELLDA |
Ga0066704_106602901 | 3300005557 | Soil | VAIDPKHLPEDPKILQQMVLDLMTQLDREFSERNKIESLLRELLD |
Ga0068859_1021033151 | 3300005617 | Switchgrass Rhizosphere | VALDPKHLPEDPKVLQQMVLDLMAQLDREFTERSKIETL |
Ga0068860_1022022303 | 3300005843 | Switchgrass Rhizosphere | VALDPKHLPDDPQVLQQMVLDLMAQLDREYTEQNK |
Ga0070766_110339922 | 3300005921 | Soil | VAFDPKHLPEDPKTLQQIVLDLMAELDRESSERTKIETLLRELLDSKRNRKSE |
Ga0066788_100254963 | 3300005944 | Soil | VAIDPKHLPEDPQTLQRMVLDLMAQLDRESAERTKIQNLLRELLDAKRTRKS* |
Ga0066787_100279551 | 3300005950 | Soil | VAIDPKHLPEDPQVLQRMVLDLMAQLDRESAERTKIQNLLR |
Ga0066790_101181461 | 3300005995 | Soil | VSTLITYSLTVAFDPKHLPEDPKILQQIVLDLMAQLNRESTERNKIETLLRELLDAR |
Ga0070717_105515551 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VAFDPKHLPENPKVLQQMVLDLMAQLDRECTERNKI |
Ga0075017_1003089422 | 3300006059 | Watersheds | VAIDPKHLPEDPKVLQQMVLDLMTQLDREFTERNKIGLSAGS* |
Ga0075015_1009559562 | 3300006102 | Watersheds | VAIDPKHLPDDPKTLQQMVLDLLTQLDREFTERNKI |
Ga0070716_1004335433 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VAFDPKHLPEDPKVLQQMVLDLIAQLDRECTERNKI |
Ga0075421_1014858291 | 3300006845 | Populus Rhizosphere | VALDPKHLPEDPKVLQKMVLDLIAQLDHEFSERSKIE |
Ga0075433_108194501 | 3300006852 | Populus Rhizosphere | VAIDPKHLPEDPKVLQQMVLDLMTQLDREFTERNKIETLL |
Ga0079215_100776674 | 3300006894 | Agricultural Soil | VTLDPKHLPEDPQVLQQMVLDLMVQLDREFTERNKIE |
Ga0079215_101289511 | 3300006894 | Agricultural Soil | VGRDPKHLPEDPKVLQQMVLDLMAQLDREFSERSKIETLLR |
Ga0075436_1009301341 | 3300006914 | Populus Rhizosphere | VAIDPKYLPEDPKVLQQMVLDLVAQLDRESAERTKIETLLRELLD |
Ga0079218_127093022 | 3300007004 | Agricultural Soil | VEYPPITVAIDPKHLPEDPKILQQLVLDLMAQLDREFSERSKIEGLLRE |
Ga0099794_104924801 | 3300007265 | Vadose Zone Soil | MAIDPRHLPEDPNILRQMVLDLMSQLDREFTERNKIESLLR |
Ga0066710_1029415133 | 3300009012 | Grasslands Soil | VAIDPKHLPEDPKILQQMVLDLMTQLDREFSERNKIESLL |
Ga0066710_1046753871 | 3300009012 | Grasslands Soil | VAIDPKHLPEDPKVLQQMVLDLMTQLDREFSERNKIESLL |
Ga0099829_117051052 | 3300009038 | Vadose Zone Soil | VAFDPKHLPEDPKLLQQMVLDLMAQLNREFTERGKIEALLR |
Ga0099830_108986331 | 3300009088 | Vadose Zone Soil | VAIDPKHLPEDPKILQQMVLDLMTQLDREFSERNKIESL |
Ga0102851_111988704 | 3300009091 | Freshwater Wetlands | VALDPKHLPEDPKVLQQMVLDLMAQLDREFIERNKIEALL |
Ga0116225_15072091 | 3300009524 | Peatlands Soil | VTFDPKHLPEDPQALRQMVLDLMAQLDREFTERNKIETLLRELLDARRNRKSQ |
Ga0116118_11777263 | 3300009637 | Peatland | VAIDPKHLPEDPQVLQRMVLDLMAQLDRESAERSK |
Ga0134086_103270691 | 3300010323 | Grasslands Soil | VAIDPKHLPEDPKVLQQMVLDLMTQLDREFSERNK |
Ga0126377_119886083 | 3300010362 | Tropical Forest Soil | VAIDPKYLPEDPKVLQQMVLDLMVQLDRESAERTKIETLLRELL |
Ga0126379_106210184 | 3300010366 | Tropical Forest Soil | VAIGIEHLPEDPKVLQQMVLDLTAQLDRESTERHKVETILRELIESRRSR |
Ga0126381_1023608143 | 3300010376 | Tropical Forest Soil | MAIDPKHLPEDPKILQQMILDLMTQLDREFTERHKIESLLRELL |
Ga0126381_1027764703 | 3300010376 | Tropical Forest Soil | VAIDPKHLPDDPKALQAMVLELIAQLDREFQERGKIEALLRELLDAKRGRRSE |
Ga0126381_1034454792 | 3300010376 | Tropical Forest Soil | VAIDPKHLPEDPKVLQQMVLDLIAQLDREFSERNKIESLLRELLDAKRNR |
Ga0134126_125663522 | 3300010396 | Terrestrial Soil | LPFDPRHLPEDPKVLQQMVLDLMTQLDREHSERSKVETLLRELLD |
Ga0126383_124354371 | 3300010398 | Tropical Forest Soil | VALDPKHLPEDPKVLQQMVLDLMAQLDREFTERNKIEALLR |
Ga0137388_115746272 | 3300012189 | Vadose Zone Soil | VALDPKHLPEDPKILQQMVLDLIAQLDREHTERHK |
Ga0137383_105023441 | 3300012199 | Vadose Zone Soil | VPIDPNNLPQDAKALRQIVLDLMAQLEREFSERHKYENLLRELLEAVRG* |
Ga0137382_103923741 | 3300012200 | Vadose Zone Soil | VAIDPKHLPEDLKILQQMVLDLMTQLDREFSERNKIESLLRELLDAKRNRKS |
Ga0137363_108125291 | 3300012202 | Vadose Zone Soil | VAIDPKHLPEDPKILQQMVLDLMTQLDREFSERNKIE |
Ga0137362_109689363 | 3300012205 | Vadose Zone Soil | VAIDPKHLPEDPKILQQMVLDLMTQLDREFSERNKI |
Ga0137362_109915213 | 3300012205 | Vadose Zone Soil | VAIDLKHLPEDSKVLQQMVLDLMTQLDREFTERNKIETLLREL |
Ga0137377_113514522 | 3300012211 | Vadose Zone Soil | VAIDLEHLPEDPKVLQKMVLDLTAQLDRESAERLKVETILRELLEARRNRK |
Ga0137377_119188912 | 3300012211 | Vadose Zone Soil | VALDPKHLPEDPKVLQEMVLDLMAQLDREFTERNKIEAL |
Ga0137370_103933151 | 3300012285 | Vadose Zone Soil | VAFDPKHLPEDPKTLQQIVLDLMAQLARESSERTKIETLLR |
Ga0137395_104963503 | 3300012917 | Vadose Zone Soil | VAIDPKHLPEDPTVLQQMVLDLMAQLDREFTERSKLETLLRELL |
Ga0164298_109486911 | 3300012955 | Soil | VAFDPKHLPEDPKTLQQIVVDLMAQLDRESSERTKIETLLRELLDSK |
Ga0126369_128403632 | 3300012971 | Tropical Forest Soil | VAINPNHLPEDPKVLQQMILDLMAQLDREFTERNKVESLLRELLDAKRNR |
Ga0134110_105288241 | 3300012975 | Grasslands Soil | VAVDPKHLPEDPKVLQQMVLDLMAQLDREFAERNKIETLLRELLDAKRQRK |
Ga0164308_118920081 | 3300012985 | Soil | VAFDPKHLPEDPKTLQQIVVDLMAQLDRESSERTKIETLL |
Ga0181529_103354031 | 3300014161 | Bog | VAIDPKHLPEDPQVLQQMVLDLMTQLDREFTERHKIETLL |
Ga0181532_106000842 | 3300014164 | Bog | VAFDPKHLPEDTKILQQMVLDLMAQLDRESTERNKIEALLRELLDS |
Ga0181523_102051911 | 3300014165 | Bog | VAIDPKHLPEDPQILQRMVQDLMAQLDRETAERSKIQNLLR |
Ga0181523_103789641 | 3300014165 | Bog | VAIDPKHLPDDPQVLQQMVLDLMTQLDREYTERHKIETLLRELLD |
Ga0182024_128706071 | 3300014501 | Permafrost | MAIDSKHLPEDPTVLQKMVLDLIAQLDRESAERHKIEAMLRELLD |
Ga0180086_11218661 | 3300014883 | Soil | VALDPKHLPDDPKVLQQMVLDLMAQLDREFTERNKIEALLRELLDA* |
Ga0137411_12806943 | 3300015052 | Vadose Zone Soil | VAIDPKHLPEDPKILQQMVLDLMTQLDREFSERNKIES |
Ga0167640_1186823 | 3300015067 | Glacier Forefield Soil | MAIDPKHLPEDPKVLQQMVLDLKAQLDREFTQRSKIETLMHELL |
Ga0137409_107665993 | 3300015245 | Vadose Zone Soil | VAIDPKHLPADPKVLQQMVLDLMAQLDRECSERNKIETLLRELLDAR |
Ga0132255_1053398031 | 3300015374 | Arabidopsis Rhizosphere | VAIDPKHLPDDPKILQQMVLDLMTQLERESSERGKIESLLREL |
Ga0182037_110513671 | 3300016404 | Soil | VAIGLEHLPEDPKVLQKMVLDLTAQLDRESAERHKVETILR |
Ga0182039_103565511 | 3300016422 | Soil | VAIGIEHLPEDPKVLQKMVLDLTGQLDRESAERHKVETILREL |
Ga0187802_101275171 | 3300017822 | Freshwater Sediment | VAIDPKYLPEDPKVLQQMVLDLMAQLDRESAERTKIETLL |
Ga0187820_10630104 | 3300017924 | Freshwater Sediment | VAIDPKHLPADPKVLQQMVLDLMAQLDRECSERNKIESLLR |
Ga0187879_100877814 | 3300017946 | Peatland | VAFDPKHLPEDTKILQQMVLDLMAQLDRESTERNKIEA |
Ga0187778_113196891 | 3300017961 | Tropical Peatland | VAIDPKHLPEDPQVLQQMVLDLMAQLDRESAERTKIE |
Ga0187857_103409173 | 3300018026 | Peatland | VAIDPKHLPEDPQVLLQMVLDLMTQLDREFTERHKIETL |
Ga0187869_101401904 | 3300018030 | Peatland | VAIDPKHLPEDPQVLLQMVLDLMAQLDREFTERHK |
Ga0187867_106291792 | 3300018033 | Peatland | VAFDPKHLPEDTKILQQMVLDLMAQLDRESTERNKIEALLRELLD |
Ga0187855_102438404 | 3300018038 | Peatland | VAFDPKHLPEDTKILQQMVLDLMAQLDRESTERNKIEALLRELLDSKRNRK |
Ga0187855_107018512 | 3300018038 | Peatland | VAFDPKHLPDDTKILQQMVLDLMAQLDRESTERNKIEALLRELLDSKRNRK |
Ga0187887_109480872 | 3300018043 | Peatland | VAIDPKHLPEDPQTLQRMVLDLMAQLDRESAERSKIQNLLRE |
Ga0187890_104799421 | 3300018044 | Peatland | VAFDPKHLPDDTKILQRMVLDLMAQLDRESTERNKIEALLREL |
Ga0187851_100702995 | 3300018046 | Peatland | VAIDPKHLPEDPQTLQRMVLDLMAQLGRESVERTKIQNLLRE |
Ga0066655_107184571 | 3300018431 | Grasslands Soil | VAIDPKHLPEDPKILQQMVLDLMTQLDREFSERNKIESLLRELLDAK |
Ga0193733_11908421 | 3300020022 | Soil | VAIDPKHLPEDPKVLQQLVLDLMTQLDREFTERNKIETLLR |
Ga0187768_10664201 | 3300020150 | Tropical Peatland | VAIDVEHLPEDPKILQKMVLDLTAQLDRESVERHKVETILRELLDARRNRKS |
Ga0210407_105314801 | 3300020579 | Soil | VAFDSTHLPEDPKILQQMVLDLMAQLDRESSERTKIETLLRELL |
Ga0210406_110837671 | 3300021168 | Soil | VAIDPKHLPEDAKILQQMVLDLMVQLDREFTERNKIESLLRELLDAKRNRK |
Ga0213882_102029273 | 3300021362 | Exposed Rock | VAIDPKYLPEDPKILQQMVLDLMAQLDRESAERTKIEKLLRELLDAKRNRKSE |
Ga0207685_101555984 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VAFDPKHLPEDPKTLQQIVLDLMAQLDRESSERTKIETL |
Ga0207698_127337742 | 3300026142 | Corn Rhizosphere | VAFDPKHLPEDPKVLQQMVLDLMAQLDREFTERNKIE |
Ga0209849_10806632 | 3300026215 | Soil | VAFDSKHLPEDPKTLQQMVLDLMAQLDRESAERNKIE |
Ga0209377_12726491 | 3300026334 | Soil | VAIDPKHLPEDPKILQQMVLDLMTQLDKEFSERNKIESLLRELLGAK |
Ga0257164_10245873 | 3300026497 | Soil | VAFDPKHLPENPKVLQQMVLDLMAQLDRECTERNK |
Ga0208984_10874713 | 3300027546 | Forest Soil | VALDPKHLPEDPQVLQQMVLDLMAQLDREFTERSKIEALL |
Ga0209217_10320721 | 3300027651 | Forest Soil | VALDPKHLPEDPKVLQQMVLDLMAQLDREFTERNK |
Ga0207862_10785131 | 3300027703 | Tropical Forest Soil | VSFDPKHLPDDPQALRQIVLDLMGQLEREFAERHKVEALLRELLDAKRT |
Ga0209580_102024841 | 3300027842 | Surface Soil | VPIDLTQLPEDPQMLQRMVRDLSAQLDRESAERHKIERLLREFLQGKRGRK |
Ga0209579_107811841 | 3300027869 | Surface Soil | VAFDSKHLPEDPKILQQMVLDLMAQLDRESSERTKIETLLRELLDSK |
Ga0209486_109877972 | 3300027886 | Agricultural Soil | VEYPPITVAIDPKHLPEDPKILQQLVLDLMAQLDREFSERSKIE |
Ga0268264_120481111 | 3300028381 | Switchgrass Rhizosphere | VALDPKHLPDDPQVLQQMVLDLMAQLDREYTEQNKIE |
Ga0170834_1069021321 | 3300031057 | Forest Soil | VAIDPKHLPEDPKTLQQMVLDLMAQLDREFTERGKVE |
Ga0302325_132674601 | 3300031234 | Palsa | VAIDPKHLPEDPQILQRMVLDLMAQLDRESAERSKIQNLLRELLD |
Ga0318529_101660573 | 3300031792 | Soil | VAIGIEHLPEDPKVLQKMVLDLTAQLDRESAERHKVETI |
Ga0306925_108673821 | 3300031890 | Soil | VSFDPKHLPDDPQALRQIVLDLMGQLEREFAERHKV |
Ga0310913_104124023 | 3300031945 | Soil | VAIGIEHLPEDPKVLQKMVLDLTAQLDRESAERHKVETILRE |
Ga0306922_123986141 | 3300032001 | Soil | VAIGIEHLPEDPKVLQKMVLDLTAQLDRESAERHKVETILRELIEARRSRKSE |
Ga0306924_119318521 | 3300032076 | Soil | MAIDPKHLPEDPKILQQMILDLMTQLDREFTERHKIESLLRELLDAKRN |
Ga0335082_105540431 | 3300032782 | Soil | VAIDPRYLPEDPKVLQQMVLDLMAQLDRESAERTKIETL |
Ga0335078_109135301 | 3300032805 | Soil | VAIDPKHLPEDPRVLQQMVLDLMAQLDRESTERTK |
Ga0335078_117752033 | 3300032805 | Soil | VAIDPNHRPDDPKALQAIVLDLIAQLDKEFHERSKIET |
Ga0335080_108484251 | 3300032828 | Soil | MEKTPSPVAIDPKHLPEDPKILQQMVLDLMTQLDREFSERNKIESLLRE |
Ga0335080_108720663 | 3300032828 | Soil | VAFHPKHLPEDPQILQQMVLDLMAQLDRESTERTKIETRLRELL |
Ga0335081_111200933 | 3300032892 | Soil | MALDPKHLPEDPKVLQQMVLDLMAQLDREFTERNKVEALLRELLDAK |
Ga0335081_125654501 | 3300032892 | Soil | VAIDPKHLPDDPKILQQMVLDLVAQLDRESAERGKIEGLLRELLDAKRN |
Ga0335071_109079471 | 3300032897 | Soil | VAIDPRYLPEDPKVLQQMVLDLMAQLDRESAERTKIET |
Ga0335083_108152161 | 3300032954 | Soil | VAIDPKYLPEDPKVLQQMVLDLMAQLDRESAERTKIETLLRE |
Ga0335076_106352933 | 3300032955 | Soil | VAIDPKHLPEDPRVLQQMVLDLIAQLDRESAERTKIE |
Ga0335084_105731131 | 3300033004 | Soil | VAIDPRYLPEDPKVLQQMVLDLMAQLDRESAERTKIETLLRELLDAKRSR |
Ga0335077_108217931 | 3300033158 | Soil | VALDPKHLPEDPKVLQQMVLDLMAQLDREFTERNKIE |
Ga0335077_120231572 | 3300033158 | Soil | VAIDLKHLPDDPKVLQQMVLDLIAQLDRESAERHKTETLLRELLDA |
Ga0334913_112641_1_126 | 3300034172 | Sub-Biocrust Soil | MAIDPKHLPEDPKVLQQMVLDLMAQLDREFTERNKIESLLRE |
Ga0372943_0308672_1_129 | 3300034268 | Soil | VAIDPKHLPEDPKILQQMVLDLMAQLDREFSERGKIETLLREL |
Ga0334960_065069_2_160 | 3300034402 | Sub-Biocrust Soil | VAVDPKHLPDDAKVLQQIVLDLMAQLDREHTERNKIETLLRELLDARHNRKSE |
⦗Top⦘ |