| Basic Information | |
|---|---|
| Family ID | F062978 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RDSGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.08 % |
| % of genes near scaffold ends (potentially truncated) | 92.31 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.769 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.692 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF03466 | LysR_substrate | 3.08 |
| PF00498 | FHA | 3.08 |
| PF08240 | ADH_N | 2.31 |
| PF02665 | Nitrate_red_gam | 2.31 |
| PF01872 | RibD_C | 1.54 |
| PF03773 | ArsP_1 | 1.54 |
| PF07690 | MFS_1 | 1.54 |
| PF04191 | PEMT | 1.54 |
| PF13602 | ADH_zinc_N_2 | 1.54 |
| PF00583 | Acetyltransf_1 | 1.54 |
| PF00196 | GerE | 1.54 |
| PF13561 | adh_short_C2 | 1.54 |
| PF00106 | adh_short | 1.54 |
| PF02211 | NHase_beta | 1.54 |
| PF03372 | Exo_endo_phos | 0.77 |
| PF00248 | Aldo_ket_red | 0.77 |
| PF01381 | HTH_3 | 0.77 |
| PF13673 | Acetyltransf_10 | 0.77 |
| PF05506 | PLipase_C_C | 0.77 |
| PF12681 | Glyoxalase_2 | 0.77 |
| PF13424 | TPR_12 | 0.77 |
| PF00685 | Sulfotransfer_1 | 0.77 |
| PF05544 | Pro_racemase | 0.77 |
| PF01878 | EVE | 0.77 |
| PF00291 | PALP | 0.77 |
| PF00724 | Oxidored_FMN | 0.77 |
| PF04397 | LytTR | 0.77 |
| PF00085 | Thioredoxin | 0.77 |
| PF13365 | Trypsin_2 | 0.77 |
| PF05694 | SBP56 | 0.77 |
| PF04978 | DUF664 | 0.77 |
| PF00589 | Phage_integrase | 0.77 |
| PF13280 | WYL | 0.77 |
| PF02566 | OsmC | 0.77 |
| PF04229 | GrpB | 0.77 |
| PF04107 | GCS2 | 0.77 |
| PF02771 | Acyl-CoA_dh_N | 0.77 |
| PF04542 | Sigma70_r2 | 0.77 |
| PF00107 | ADH_zinc_N | 0.77 |
| PF13412 | HTH_24 | 0.77 |
| PF10400 | Vir_act_alpha_C | 0.77 |
| PF12802 | MarR_2 | 0.77 |
| PF00149 | Metallophos | 0.77 |
| PF13191 | AAA_16 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG2181 | Nitrate reductase gamma subunit | Energy production and conversion [C] | 2.31 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.54 |
| COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 1.54 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.54 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.77 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.77 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.77 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.77 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.77 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.77 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.77 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.77 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.77 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.77 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.77 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.77 % |
| Unclassified | root | N/A | 39.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100117186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2506 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10054033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1533 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10113915 | Not Available | 1081 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10338549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300005332|Ga0066388_107285970 | Not Available | 556 | Open in IMG/M |
| 3300005437|Ga0070710_10297488 | Not Available | 1052 | Open in IMG/M |
| 3300005437|Ga0070710_10688186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
| 3300005467|Ga0070706_101150227 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005471|Ga0070698_100961060 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300005471|Ga0070698_101865884 | Not Available | 554 | Open in IMG/M |
| 3300005537|Ga0070730_10116962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1830 | Open in IMG/M |
| 3300005541|Ga0070733_10100089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1849 | Open in IMG/M |
| 3300005546|Ga0070696_101824374 | Not Available | 526 | Open in IMG/M |
| 3300005610|Ga0070763_10002167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6931 | Open in IMG/M |
| 3300005712|Ga0070764_10067832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1857 | Open in IMG/M |
| 3300005764|Ga0066903_100867669 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300005921|Ga0070766_10190424 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300006052|Ga0075029_101210457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Leekyejoonella → Leekyejoonella antrihumi | 528 | Open in IMG/M |
| 3300006174|Ga0075014_100926595 | Not Available | 523 | Open in IMG/M |
| 3300006176|Ga0070765_101068304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Pseudarthrobacter → unclassified Pseudarthrobacter → Pseudarthrobacter sp. AG30 | 763 | Open in IMG/M |
| 3300006176|Ga0070765_102086560 | Not Available | 530 | Open in IMG/M |
| 3300006755|Ga0079222_10474400 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300006804|Ga0079221_10905152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300007076|Ga0075435_100177432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1799 | Open in IMG/M |
| 3300009839|Ga0116223_10590739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. HBU206391 | 641 | Open in IMG/M |
| 3300010048|Ga0126373_11671086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 701 | Open in IMG/M |
| 3300010048|Ga0126373_12976935 | Not Available | 528 | Open in IMG/M |
| 3300010323|Ga0134086_10258277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300010343|Ga0074044_10440474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 852 | Open in IMG/M |
| 3300010361|Ga0126378_10238066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Acidothermales → unclassified Acidothermales → Acidothermales bacterium | 1910 | Open in IMG/M |
| 3300010361|Ga0126378_12247044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis | 622 | Open in IMG/M |
| 3300010361|Ga0126378_12332464 | Not Available | 611 | Open in IMG/M |
| 3300010361|Ga0126378_12691092 | Not Available | 568 | Open in IMG/M |
| 3300010362|Ga0126377_13371868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300010366|Ga0126379_10604130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1183 | Open in IMG/M |
| 3300010376|Ga0126381_101623347 | Not Available | 934 | Open in IMG/M |
| 3300010376|Ga0126381_102336695 | Not Available | 768 | Open in IMG/M |
| 3300010398|Ga0126383_10844125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1000 | Open in IMG/M |
| 3300010867|Ga0126347_1573583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300010876|Ga0126361_10776171 | Not Available | 679 | Open in IMG/M |
| 3300010876|Ga0126361_10787984 | Not Available | 575 | Open in IMG/M |
| 3300011270|Ga0137391_11517502 | Not Available | 515 | Open in IMG/M |
| 3300012285|Ga0137370_11003916 | Not Available | 514 | Open in IMG/M |
| 3300012359|Ga0137385_10682088 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300012948|Ga0126375_11375887 | Not Available | 597 | Open in IMG/M |
| 3300014201|Ga0181537_10714929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300016270|Ga0182036_11197094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300016341|Ga0182035_10074928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2397 | Open in IMG/M |
| 3300016341|Ga0182035_11938110 | Not Available | 535 | Open in IMG/M |
| 3300016387|Ga0182040_10188015 | Not Available | 1508 | Open in IMG/M |
| 3300016445|Ga0182038_10452858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae | 1087 | Open in IMG/M |
| 3300016750|Ga0181505_10497077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 591 | Open in IMG/M |
| 3300017924|Ga0187820_1213395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300017937|Ga0187809_10186076 | Not Available | 732 | Open in IMG/M |
| 3300017970|Ga0187783_10454809 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300017970|Ga0187783_11088165 | Not Available | 576 | Open in IMG/M |
| 3300017973|Ga0187780_10329169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis composta | 1077 | Open in IMG/M |
| 3300017973|Ga0187780_11456845 | Not Available | 505 | Open in IMG/M |
| 3300017995|Ga0187816_10430240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300018006|Ga0187804_10037051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1863 | Open in IMG/M |
| 3300018007|Ga0187805_10471613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
| 3300018060|Ga0187765_11336729 | Not Available | 509 | Open in IMG/M |
| 3300020021|Ga0193726_1204664 | Not Available | 828 | Open in IMG/M |
| 3300021088|Ga0210404_10520806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300021181|Ga0210388_10444183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera japonica → Tetrasphaera japonica T1-X7 | 1140 | Open in IMG/M |
| 3300021401|Ga0210393_11084979 | Not Available | 647 | Open in IMG/M |
| 3300021402|Ga0210385_11331863 | Not Available | 550 | Open in IMG/M |
| 3300021404|Ga0210389_10003858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces guanduensis | 11691 | Open in IMG/M |
| 3300021406|Ga0210386_10831799 | Not Available | 792 | Open in IMG/M |
| 3300021474|Ga0210390_11547534 | Not Available | 523 | Open in IMG/M |
| 3300021474|Ga0210390_11584006 | Not Available | 516 | Open in IMG/M |
| 3300021560|Ga0126371_11273982 | Not Available | 869 | Open in IMG/M |
| 3300021560|Ga0126371_11674803 | Not Available | 760 | Open in IMG/M |
| 3300022716|Ga0242673_1026099 | Not Available | 867 | Open in IMG/M |
| 3300022720|Ga0242672_1010802 | Not Available | 1102 | Open in IMG/M |
| 3300027109|Ga0208603_1035563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300027812|Ga0209656_10232499 | Not Available | 880 | Open in IMG/M |
| 3300027855|Ga0209693_10492469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CC228A | 587 | Open in IMG/M |
| 3300030007|Ga0311338_10218766 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300030058|Ga0302179_10012206 | All Organisms → cellular organisms → Bacteria | 4397 | Open in IMG/M |
| 3300030520|Ga0311372_10130003 | All Organisms → cellular organisms → Bacteria | 4443 | Open in IMG/M |
| 3300031090|Ga0265760_10044550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1328 | Open in IMG/M |
| 3300031233|Ga0302307_10297955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
| 3300031234|Ga0302325_10678873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1491 | Open in IMG/M |
| 3300031543|Ga0318516_10888952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300031544|Ga0318534_10004518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 6453 | Open in IMG/M |
| 3300031544|Ga0318534_10197949 | Not Available | 1160 | Open in IMG/M |
| 3300031544|Ga0318534_10415587 | Not Available | 772 | Open in IMG/M |
| 3300031544|Ga0318534_10543047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 662 | Open in IMG/M |
| 3300031668|Ga0318542_10551978 | Not Available | 600 | Open in IMG/M |
| 3300031679|Ga0318561_10077953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1710 | Open in IMG/M |
| 3300031682|Ga0318560_10075966 | Not Available | 1704 | Open in IMG/M |
| 3300031682|Ga0318560_10125084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1348 | Open in IMG/M |
| 3300031682|Ga0318560_10614601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WM6378 | 588 | Open in IMG/M |
| 3300031708|Ga0310686_100325786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 1080 | Open in IMG/M |
| 3300031713|Ga0318496_10567148 | Not Available | 627 | Open in IMG/M |
| 3300031723|Ga0318493_10263580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 923 | Open in IMG/M |
| 3300031723|Ga0318493_10793156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300031724|Ga0318500_10233558 | Not Available | 888 | Open in IMG/M |
| 3300031744|Ga0306918_10555179 | Not Available | 900 | Open in IMG/M |
| 3300031747|Ga0318502_10124579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1451 | Open in IMG/M |
| 3300031747|Ga0318502_10251929 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300031748|Ga0318492_10010604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3759 | Open in IMG/M |
| 3300031748|Ga0318492_10268030 | Not Available | 885 | Open in IMG/M |
| 3300031751|Ga0318494_10281193 | Not Available | 958 | Open in IMG/M |
| 3300031768|Ga0318509_10185489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1155 | Open in IMG/M |
| 3300031778|Ga0318498_10415260 | Not Available | 597 | Open in IMG/M |
| 3300031779|Ga0318566_10144784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1177 | Open in IMG/M |
| 3300031780|Ga0318508_1134116 | Not Available | 699 | Open in IMG/M |
| 3300031793|Ga0318548_10023443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2636 | Open in IMG/M |
| 3300031794|Ga0318503_10163792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300031795|Ga0318557_10086921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1369 | Open in IMG/M |
| 3300031805|Ga0318497_10579443 | Not Available | 629 | Open in IMG/M |
| 3300031819|Ga0318568_10039741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus | 2673 | Open in IMG/M |
| 3300031819|Ga0318568_10732209 | Not Available | 614 | Open in IMG/M |
| 3300031821|Ga0318567_10243282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
| 3300031831|Ga0318564_10096326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1312 | Open in IMG/M |
| 3300031833|Ga0310917_11142965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300031835|Ga0318517_10072575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1479 | Open in IMG/M |
| 3300031897|Ga0318520_10023662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2972 | Open in IMG/M |
| 3300031945|Ga0310913_10200866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1392 | Open in IMG/M |
| 3300031947|Ga0310909_10057602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3008 | Open in IMG/M |
| 3300031947|Ga0310909_11165147 | Not Available | 624 | Open in IMG/M |
| 3300031962|Ga0307479_10323378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1525 | Open in IMG/M |
| 3300032001|Ga0306922_12323269 | Not Available | 514 | Open in IMG/M |
| 3300032008|Ga0318562_10867394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300032010|Ga0318569_10502114 | Not Available | 565 | Open in IMG/M |
| 3300032052|Ga0318506_10078973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1378 | Open in IMG/M |
| 3300032068|Ga0318553_10404521 | Not Available | 715 | Open in IMG/M |
| 3300032090|Ga0318518_10457962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → Tetrasphaera australiensis → Tetrasphaera australiensis Ben110 | 653 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.31% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.54% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.77% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.77% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.77% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1001171861 | 3300002245 | Forest Soil | SGPMRLKLPVSPPALPVCHDDAGWCAASATFEHPQASLVLT* |
| JGIcombinedJ51221_100540331 | 3300003505 | Forest Soil | GPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT* |
| JGIcombinedJ51221_101139151 | 3300003505 | Forest Soil | GPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSRASLVLT* |
| JGIcombinedJ51221_103385492 | 3300003505 | Forest Soil | LAVIPAATPRDSGPVRLNLPVSCPVLPVCHDDAGWCEGSSMFEHSPASLVLA* |
| Ga0066388_1072859701 | 3300005332 | Tropical Forest Soil | PRDSGPVRLNLPVSCPVLPVCHDDAGWCVGSSTFGHAPASLVLT* |
| Ga0070710_102974881 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | APPRGPEPMRLGLPVSCPVLPVCHDDAGWCVGSSTSGQSPASLVLT* |
| Ga0070710_106881862 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PPRGPEPMRLGLPVSCPVLPVCHDDAGWCVGSSTSGQPPASLVLT* |
| Ga0070706_1011502271 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TPRDSGPIRLNLPVSAPVLPVCHDDAGWCVESSQFEHSPASLVMT* |
| Ga0070698_1009610601 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PRDSGPVRLNLPVSSPVLPVCHDDTGWCAGSSTFEHSPASLVLA* |
| Ga0070698_1018658842 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GPVRLNLPVSCPVVPVCHDDAGWCVGSSTFGRSPASLALT* |
| Ga0070730_101169623 | 3300005537 | Surface Soil | VALVRLSLPVSCPVLPVCHDDAGWCVGSSTFEHSPASLVLA* |
| Ga0070733_101000893 | 3300005541 | Surface Soil | VALVRLNLPVSCPVLPVCHDDAGWCVGSSTFEHSPASLVLA* |
| Ga0070696_1018243741 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVTPRDSGPIRLNLPVSAPVLPVCHDDAGWCVGSSTFERSPASLVPALA* |
| Ga0070763_100021678 | 3300005610 | Soil | AAPRDSGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHTPASLVLT* |
| Ga0070764_100678323 | 3300005712 | Soil | TPRDSGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT* |
| Ga0066903_1008676693 | 3300005764 | Tropical Forest Soil | TPRDSGPVRLNLPVSCPVLPVCHDDAGWCVGPSTSGHAPASLVLT* |
| Ga0070766_101904241 | 3300005921 | Soil | AATPRDSGPVRLNLPVSCPVLRVCHDDAGWCAGSSTFEHSPASLVLA* |
| Ga0075029_1012104571 | 3300006052 | Watersheds | PRDSGPMRLNLPVSPPGLVECHDDAGWCAVSSTFECSPASLVLT* |
| Ga0075014_1009265951 | 3300006174 | Watersheds | SGPVRLNLPVSCPVLVVCHDDAGWCAGSGTSGHSPASLVLT* |
| Ga0070765_1010683041 | 3300006176 | Soil | RDSGPVRLDLPAACPVMMVCHDDAGWCAEPSTSRRSPASLALV* |
| Ga0070765_1020865601 | 3300006176 | Soil | PAPRDSGPVRLSLPVSSPVLPVCHDDAGWCAGSSTFEHSRASLVLT* |
| Ga0079222_104744001 | 3300006755 | Agricultural Soil | LPVSAPVLPVCDDDAGWCMGASTFEHSPASLVLV* |
| Ga0079221_109051521 | 3300006804 | Agricultural Soil | PRDSGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT* |
| Ga0075435_1001774324 | 3300007076 | Populus Rhizosphere | PRDSGPIRLNLPVSAPVLPVCHDDAGWCVGSSTFERSPASLVPALA* |
| Ga0116223_105907391 | 3300009839 | Peatlands Soil | RDSGPVRLNLPVSPPVLPVCHDDAGWCAESSMSGHSPASLVLA* |
| Ga0126373_116710861 | 3300010048 | Tropical Forest Soil | DSGPVRLNLPVSSPVLPVCHDDAGWCVGSGTLPRSPAPLVPA* |
| Ga0126373_129769351 | 3300010048 | Tropical Forest Soil | KLPVSCPVLPVCHDDAGWCVGSSTLGHAPASLVLT* |
| Ga0134086_102582772 | 3300010323 | Grasslands Soil | DSGPMRLNLPVSSPVLLVCHDDAGWCAGSSRFEHSPASLVLT* |
| Ga0074044_104404743 | 3300010343 | Bog Forest Soil | GPVRLNLPVSPPVLPVCHDDAGWCAGPSMSGHSPASLVLA* |
| Ga0126378_102380665 | 3300010361 | Tropical Forest Soil | SGPIRLNLPVSPAVLAVCHDDAGWCVGSSTVEHSPASLVMA* |
| Ga0126378_122470442 | 3300010361 | Tropical Forest Soil | LAVVPAATPRDSGPVRLKLPVSSPVLPVYHDDAGWCVESSTFEHSPASLVLA* |
| Ga0126378_123324641 | 3300010361 | Tropical Forest Soil | PGVRPCTPPDSGPVRLNLPLASPVLPVCHDDAGWCVGAGTFERSPAPLVLA* |
| Ga0126378_126910921 | 3300010361 | Tropical Forest Soil | DSGPIRLNLPVSPAVLAVCHDDAGWCAGSSIVEHSPASLVMA* |
| Ga0126377_133718682 | 3300010362 | Tropical Forest Soil | DSGPVRLSLPVSAPVLPVCHDDAGWCVEASTSGYSPASLVLA* |
| Ga0126379_106041301 | 3300010366 | Tropical Forest Soil | LPVSSPALPVCHDDAGWCVESSTFEHSPAPLVLA* |
| Ga0126381_1016233471 | 3300010376 | Tropical Forest Soil | NLPVSSPVLPVCHDDAGWCVEADTFDRSPGLVLA* |
| Ga0126381_1023366952 | 3300010376 | Tropical Forest Soil | AVLPAAPRDSGPLRLNLPACSPVMPVCHDDAGWCVGSSTFEHSATPVLLT* |
| Ga0126383_108441252 | 3300010398 | Tropical Forest Soil | RDSGPVRLDLPVSAPVLPMCHDDAGWCLASGTSGNSPAPLVLA* |
| Ga0126347_15735832 | 3300010867 | Boreal Forest Soil | LPVRSAVLPMGHDDAGWCAGSAAFEHSPASLVLT* |
| Ga0126361_107761711 | 3300010876 | Boreal Forest Soil | VVRAATPRDSGPVRLNLPVSSPVLPVCHDDAGWCAGSSMFEHSPASLVLA* |
| Ga0126361_107879842 | 3300010876 | Boreal Forest Soil | SGPARLNLPVSAPVLPVCHDDAGWCTESSMFEDSPASLVLA* |
| Ga0137391_115175021 | 3300011270 | Vadose Zone Soil | MRLNLPVSYPVLPVCHDDAGWCVGSSTFEHSPASLVLA* |
| Ga0137370_110039162 | 3300012285 | Vadose Zone Soil | RDSGPVRLNLPVSCPVLPVYHDDAGWCMGSGTSGHSPASLVLA* |
| Ga0137385_106820883 | 3300012359 | Vadose Zone Soil | RLNLPVSCPVLPVCHDDAGWCAGSSTVEHSPASLVLT* |
| Ga0126375_113758871 | 3300012948 | Tropical Forest Soil | PRDSGPVRLNLPVSAPVLPVCHDDAGWCMGSSTFEHSPASLVLA* |
| Ga0181537_107149292 | 3300014201 | Bog | RLKLPDSCPVLPVGHDDAGWCAEPSIFAPSPASLVLA* |
| Ga0182036_111970942 | 3300016270 | Soil | ATPRDSGPVRLNLPVSCPVLPVCDDDAGWCLGSGTSEPSSASLVLV |
| Ga0182035_100749281 | 3300016341 | Soil | TPRDSGPMRLNLPASPPVLQVCHDDAGWCAGSSTVEHAPASLVLT |
| Ga0182035_119381103 | 3300016341 | Soil | SGPVRLNLPVSCPVLPLCHDDAGWCVGPSKSEYSPTSLVLA |
| Ga0182040_101880152 | 3300016387 | Soil | LSLPVSPAVLAVCHDDAGWCAGSSIVEHSPAPLVMV |
| Ga0182038_104528583 | 3300016445 | Soil | AVGPPPAPRDSGPVRLNLPVSARVLPVCDDDAGWCVGSSTFEPSPASLVLA |
| Ga0181505_104970772 | 3300016750 | Peatland | MRLNLPVSSPVLPMCHDDAGWCVGSSTFEHSPASLVLA |
| Ga0187820_12133951 | 3300017924 | Freshwater Sediment | PVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT |
| Ga0187809_101860761 | 3300017937 | Freshwater Sediment | APRDSGPIRLNLPVSSPVLPVGHDDAGWCAGSSTFEHSPDSLVLA |
| Ga0187783_104548091 | 3300017970 | Tropical Peatland | VSSPVLPVCHDDAGWCVESSAFSAFEHSPASLVLA |
| Ga0187783_110881652 | 3300017970 | Tropical Peatland | GPIRLSLPVSAPVLPMLHDDAGWCVETSRLERSPETLVLA |
| Ga0187780_103291693 | 3300017973 | Tropical Peatland | RDSGPVRLNLPVSAPVLPVCHDDAGWCAGSSTVEHSPASLVLA |
| Ga0187780_114568451 | 3300017973 | Tropical Peatland | VPAATPRDSGPVRLNLPVSCPALPVCHDDAGWCAGSSTFEHSSASLVLT |
| Ga0187816_104302402 | 3300017995 | Freshwater Sediment | LNLPVSCPVLPVCHDDAGWCAGSSTFEHSSASLVLT |
| Ga0187804_100370514 | 3300018006 | Freshwater Sediment | SGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT |
| Ga0187805_104716132 | 3300018007 | Freshwater Sediment | RDSGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSSASLVLT |
| Ga0187765_113367291 | 3300018060 | Tropical Peatland | IRLKLPVSCPVLPMDHDDAGWCARSAAFEPSPASLVLA |
| Ga0193726_12046641 | 3300020021 | Soil | VRLNLPVSPAVLPVCHDDAGWCADLSAPERSPAALVLA |
| Ga0210404_105208061 | 3300021088 | Soil | LNLPVSSPVLLVRHDDAGWCAGSSTFEHSPASLVLA |
| Ga0210388_104441831 | 3300021181 | Soil | ATPRDSGPVRLNLPVSCPVLPVCHDDAGWYAGSSTFEHSPASLVLT |
| Ga0210393_110849792 | 3300021401 | Soil | PVRLTLPASCPVMLMRHDDAGWCAEPSTSTRSLASLVLV |
| Ga0210385_113318631 | 3300021402 | Soil | AAPRDSGPVRLNLPVSAPVLPVCHDDAGWCVESHLPGHSPASLVLA |
| Ga0210389_100038581 | 3300021404 | Soil | LNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT |
| Ga0210386_108317991 | 3300021406 | Soil | RDSGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT |
| Ga0210390_115475341 | 3300021474 | Soil | IVPAAAPRDSGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHTPASLVLT |
| Ga0210390_115840061 | 3300021474 | Soil | AEPRDSGPVRLNLPVSSPVLPVCHDDAGWCAASCTFERSPASLVLT |
| Ga0126371_112739822 | 3300021560 | Tropical Forest Soil | RPAAPRDSGPIRLNLPVSAPVVPMCHDDAGWCVGTSTFQHAPASLILA |
| Ga0126371_116748032 | 3300021560 | Tropical Forest Soil | NLPGSPPVLPVCHDDAGWCMGSSPSVHSPASLVLT |
| Ga0242673_10260991 | 3300022716 | Soil | RDSGPVRLNLPVSSPVLPVCDDDAGWCVEFSTLEHSPASLVPA |
| Ga0242672_10108022 | 3300022720 | Soil | PVRLNLPVSSPVLPVCDDDAGWCAEFSTLEHSPASLVLT |
| Ga0208603_10355632 | 3300027109 | Forest Soil | RLNLPVSCPVLPVCHDDAGWCEGSSMFEHSPASLVLA |
| Ga0209656_102324991 | 3300027812 | Bog Forest Soil | LAIVPAATPRDSGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT |
| Ga0209693_104924691 | 3300027855 | Soil | LAVLLAAAPRDSGPVRLNLPVSAPVLPVCHDDAGWCVESHLPGHSPASLVLA |
| Ga0311338_102187663 | 3300030007 | Palsa | GPVRLNLPVWSPVLPVCHDDAGWCAGSSTFGPSPESLVLA |
| Ga0302179_100122064 | 3300030058 | Palsa | VRPAATPRDSGPVRLNLPVSSPVLPVCHDDAGWCVGSSVPGPAPASLVLA |
| Ga0311372_101300031 | 3300030520 | Palsa | TPRDSGPVWLNLPVSSPVLPVCHDDAGWCVGSSVPGPAPASLVLA |
| Ga0265760_100445501 | 3300031090 | Soil | RLNLPVSCPVLPVCHDDAGWCAESGMFEHSSASLVLA |
| Ga0302307_102979551 | 3300031233 | Palsa | ATPRDSGPVRLNLPVSSPVLPVCHDDAGWCVGSSVPGPAPASLVLA |
| Ga0302325_106788732 | 3300031234 | Palsa | SGPVRLNLPVWSPVLPVCHDDAGWCAGSSTFGPSPESLVLA |
| Ga0318516_108889522 | 3300031543 | Soil | HGSGPIRLDLPVSAPVLPMCHDDPGWCMESSTTEHARASLVLI |
| Ga0318534_100045182 | 3300031544 | Soil | LAGLWVVWAQPVRLNLPVSAPVLTVCHDDAGWCAGPSTFERPPASLVLA |
| Ga0318534_101979493 | 3300031544 | Soil | PAATPHDSGPVRLKLPVSCPVLPVCHDDAGWCVGSSTLGHAPASLVLT |
| Ga0318534_104155872 | 3300031544 | Soil | ITPGTPRDSGPIRLSLPVSAPALPVGHDDAGWCAGSSPVEHAGALVLA |
| Ga0318534_105430471 | 3300031544 | Soil | AATPRDSGPMRLNLPASPAVLQVCHDDAGWCAGSSTFEHAPASLVLT |
| Ga0318542_105519781 | 3300031668 | Soil | VGGVAQPVRLNLPVSAPVLTVCHDDAGWCAGPSTFERPPASLVLA |
| Ga0318561_100779534 | 3300031679 | Soil | PAATPHGSGPIRLDLPVSAPVLPMCHDDPGWCMESSTTEHARASLVLI |
| Ga0318560_100759663 | 3300031682 | Soil | RDSGPVRLKLPVSSPVLPVCHDDAGWCVGSSTVEHSPASLVLT |
| Ga0318560_101250841 | 3300031682 | Soil | ATPRDSGPMRLNLPASPAVLQVCHDDAGWCAGSSTFEHAPASLVLT |
| Ga0318560_106146012 | 3300031682 | Soil | RDSGPVRLNLPVSCPVLPVCDDDAGWCLGSGTSEPSSASLVLV |
| Ga0310686_1003257862 | 3300031708 | Soil | MRLNLPVSSPVLLVCDDDAGWCAGSSTFEHSPASLILT |
| Ga0318496_105671481 | 3300031713 | Soil | VGGVAQPVRLNLPVSAPVLTVCHDDAGRCAGPSTFE |
| Ga0318493_102635803 | 3300031723 | Soil | TPHGSGPIRLDLPVSAPVLPMCHDDPGWCIESSTTEHARASLVLI |
| Ga0318493_107931562 | 3300031723 | Soil | RDSGPIRLNLPVSAPVLPMCHDDAGWCVGSSTFEPSPASLVLA |
| Ga0318500_102335582 | 3300031724 | Soil | AGPVRLNLPVSCPVLPVCHDDAGWCAGSSRSEHTTASLVLT |
| Ga0306918_105551791 | 3300031744 | Soil | VPAAAPRDSGPVRLNLPVSCPVLPLCHDDAGWCVGPSKSEYSPTSLVLA |
| Ga0318502_101245791 | 3300031747 | Soil | NLPVSCPVLPVCHDDAGWCAGSSRSEHTTASLVLT |
| Ga0318502_102519291 | 3300031747 | Soil | LAVVPAVAPRDSGPIRLNLPVSAPVLPVCHDDAGWCVGSSTFEPSPASLVLA |
| Ga0318492_100106042 | 3300031748 | Soil | VGGVAQPVRLNLPVSAPVLPVCHDDAGWCAGPSTFERPPASLVLA |
| Ga0318492_102680301 | 3300031748 | Soil | GPVRLNLPVSCPVLPVCHDDAGWCAGSSRSEHTTASLVPA |
| Ga0318494_102811931 | 3300031751 | Soil | AVVPAAAPRDSGPVRLKLPVSSPVLPVRHDDAGWCVGSSTVEHSPASLVLT |
| Ga0318509_101854893 | 3300031768 | Soil | GSGPVRLNLPVSCPVLPVCHDDAGWCAGSSRSEHTTASLVLT |
| Ga0318498_104152602 | 3300031778 | Soil | TPHDSGPIRLNLPVSPPVLPVCHDDAGWCAGSGTFERSPAALVLT |
| Ga0318566_101447842 | 3300031779 | Soil | PMRLNLPASPAVLQVCHDDAGWCAGSSTFEHAPASLVLT |
| Ga0318508_11341162 | 3300031780 | Soil | VGGVAQPVRLNLPVSAPVLPMCHDDAGWCVASSTAERPPASLVMT |
| Ga0318548_100234431 | 3300031793 | Soil | VGGVAQPVRLNLPVSAPVLTVCHDDAGRCAGPSTFERPPASLVL |
| Ga0318503_101637921 | 3300031794 | Soil | AGPVRLNLPVPCPVLPVCHDDAGWCVGSSTFEHSPASLVLT |
| Ga0318557_100869212 | 3300031795 | Soil | LSLPASPTVLQVCHDDAGWCAGSSTVEHAPASLVLT |
| Ga0318497_105794431 | 3300031805 | Soil | HDSGPIRLNLPVSPPVLPVCHDDAGWCAGSGTFERSPAALVLT |
| Ga0318568_100397413 | 3300031819 | Soil | VRAATPRDSGPMRLNLPASPAVLQVCHDDAGWCAGSSTVEHAPASLVLT |
| Ga0318568_107322092 | 3300031819 | Soil | PRDSGPIRLSLPVSAPALPVGHDDAGWCAGSSPVEHAGALVLA |
| Ga0318567_102432823 | 3300031821 | Soil | DSGPVRLNLPVSCPVLPVCDDDAGWCLGSGTSEPSSASLVLV |
| Ga0318564_100963263 | 3300031831 | Soil | ATPHGSGPIRLDLPVSAPVLPMCHDDPGWCIESSTTEHARASLVLI |
| Ga0310917_111429652 | 3300031833 | Soil | VRLNLPVSCPVLPVCDDDAGWCLGSGTSEPSSASLVLV |
| Ga0318517_100725752 | 3300031835 | Soil | RDSGPIRLNLPLSPAVLAMCHDDAGWCVASSTAERPPASLVMT |
| Ga0318520_100236622 | 3300031897 | Soil | LAGLWVVWAQPVRLNLPVSAPVLTVCHDDAGRCAGPSTFERPPASLVLA |
| Ga0310913_102008663 | 3300031945 | Soil | ATPHGSGPIRLDLPVSAPVLPMCHDDPGWCMESSTTEHARASLVLI |
| Ga0310909_100576021 | 3300031947 | Soil | NLPVSCPVLPVCHDDAGWCVGSSTFGHSPASLVLT |
| Ga0310909_111651471 | 3300031947 | Soil | AATPRGSGPVRLNLPVSCPVLPVCHDDAGWCAGSSRSEHTTASLVLT |
| Ga0307479_103233781 | 3300031962 | Hardwood Forest Soil | APRDSGPVRLNLPVSCPVLPVCHDDAGWCAGSSTFEHSPASLVLT |
| Ga0306922_123232691 | 3300032001 | Soil | VRLNLPVSCPVLPVCHDDAGWCAGSSAFEHSPESLVLT |
| Ga0318562_108673942 | 3300032008 | Soil | DSGPMRLNLPASPTVLQVCHDDAGWCAGSSTVEHAPASLVLT |
| Ga0318569_105021142 | 3300032010 | Soil | VWAQPVRLNLPVSAPVLTVCHDDAGWCAGPSTFERPPASLVLA |
| Ga0318506_100789731 | 3300032052 | Soil | NLPLSPAVLAMCHDDAGWCVASSTAERPPASLVMT |
| Ga0318553_104045211 | 3300032068 | Soil | PHDSGPIRLKLPVSCPVLPMDHDDAGWCARSSTFEPSPASLVRA |
| Ga0318518_104579622 | 3300032090 | Soil | RLKLPVSSPVLPVCHDDAGWCVGSSTVEHSPASLVLT |
| ⦗Top⦘ |