| Basic Information | |
|---|---|
| Family ID | F062964 |
| Family Type | Metagenome |
| Number of Sequences | 130 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDMRLKGIEASLK |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.69 % |
| % of genes from short scaffolds (< 2000 bps) | 90.77 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.615 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.923 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.385 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF04519 | Bactofilin | 2.31 |
| PF00498 | FHA | 1.54 |
| PF06411 | HdeA | 1.54 |
| PF14520 | HHH_5 | 0.77 |
| PF01402 | RHH_1 | 0.77 |
| PF01381 | HTH_3 | 0.77 |
| PF00196 | GerE | 0.77 |
| PF13701 | DDE_Tnp_1_4 | 0.77 |
| PF08734 | GYD | 0.77 |
| PF01041 | DegT_DnrJ_EryC1 | 0.77 |
| PF00561 | Abhydrolase_1 | 0.77 |
| PF05050 | Methyltransf_21 | 0.77 |
| PF01068 | DNA_ligase_A_M | 0.77 |
| PF13365 | Trypsin_2 | 0.77 |
| PF13683 | rve_3 | 0.77 |
| PF01590 | GAF | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 2.31 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.77 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.77 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.77 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.77 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.77 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.77 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.77 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.62 % |
| All Organisms | root | All Organisms | 35.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000580|AF_2010_repII_A01DRAFT_1057323 | Not Available | 597 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10090664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300005179|Ga0066684_10069618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2077 | Open in IMG/M |
| 3300005332|Ga0066388_103057225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 855 | Open in IMG/M |
| 3300005332|Ga0066388_106345047 | Not Available | 596 | Open in IMG/M |
| 3300005435|Ga0070714_100671090 | Not Available | 999 | Open in IMG/M |
| 3300005435|Ga0070714_101280761 | Not Available | 715 | Open in IMG/M |
| 3300005471|Ga0070698_100575171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1066 | Open in IMG/M |
| 3300005713|Ga0066905_100431122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1078 | Open in IMG/M |
| 3300005764|Ga0066903_100359194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2362 | Open in IMG/M |
| 3300005764|Ga0066903_101402959 | Not Available | 1312 | Open in IMG/M |
| 3300005764|Ga0066903_102377631 | Not Available | 1025 | Open in IMG/M |
| 3300005764|Ga0066903_102631510 | Not Available | 975 | Open in IMG/M |
| 3300005764|Ga0066903_103483023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300005764|Ga0066903_105446646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300005764|Ga0066903_105770656 | Not Available | 650 | Open in IMG/M |
| 3300005764|Ga0066903_106611295 | Not Available | 603 | Open in IMG/M |
| 3300005764|Ga0066903_107748364 | Not Available | 552 | Open in IMG/M |
| 3300006034|Ga0066656_10990630 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006175|Ga0070712_100344872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1217 | Open in IMG/M |
| 3300006175|Ga0070712_100563008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
| 3300006845|Ga0075421_100270889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2075 | Open in IMG/M |
| 3300006854|Ga0075425_102847302 | Not Available | 531 | Open in IMG/M |
| 3300006914|Ga0075436_100784640 | Not Available | 709 | Open in IMG/M |
| 3300009143|Ga0099792_10878948 | Not Available | 592 | Open in IMG/M |
| 3300009147|Ga0114129_10647313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1364 | Open in IMG/M |
| 3300010046|Ga0126384_10667677 | Not Available | 917 | Open in IMG/M |
| 3300010047|Ga0126382_11310790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 655 | Open in IMG/M |
| 3300010322|Ga0134084_10173651 | Not Available | 739 | Open in IMG/M |
| 3300010358|Ga0126370_11282474 | Not Available | 686 | Open in IMG/M |
| 3300010359|Ga0126376_10599951 | Not Available | 1041 | Open in IMG/M |
| 3300010359|Ga0126376_13253157 | Not Available | 502 | Open in IMG/M |
| 3300010360|Ga0126372_10102365 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
| 3300010360|Ga0126372_10159163 | Not Available | 1818 | Open in IMG/M |
| 3300010361|Ga0126378_10791588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium prunaredense | 1058 | Open in IMG/M |
| 3300010361|Ga0126378_12264973 | Not Available | 620 | Open in IMG/M |
| 3300010366|Ga0126379_10061317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3156 | Open in IMG/M |
| 3300010366|Ga0126379_10976224 | Not Available | 951 | Open in IMG/M |
| 3300010366|Ga0126379_11526466 | Not Available | 773 | Open in IMG/M |
| 3300010366|Ga0126379_13035767 | Not Available | 562 | Open in IMG/M |
| 3300010376|Ga0126381_100113869 | Not Available | 3484 | Open in IMG/M |
| 3300010376|Ga0126381_101973814 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300010376|Ga0126381_102331286 | Not Available | 769 | Open in IMG/M |
| 3300010398|Ga0126383_10492627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1283 | Open in IMG/M |
| 3300010398|Ga0126383_11325787 | Not Available | 810 | Open in IMG/M |
| 3300010398|Ga0126383_13459555 | Not Available | 516 | Open in IMG/M |
| 3300010868|Ga0124844_1289861 | Not Available | 559 | Open in IMG/M |
| 3300012096|Ga0137389_11593742 | Not Available | 549 | Open in IMG/M |
| 3300012199|Ga0137383_10760579 | Not Available | 707 | Open in IMG/M |
| 3300012202|Ga0137363_10564287 | Not Available | 959 | Open in IMG/M |
| 3300012490|Ga0157322_1039356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 537 | Open in IMG/M |
| 3300012948|Ga0126375_11084297 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 658 | Open in IMG/M |
| 3300012948|Ga0126375_12060380 | Not Available | 506 | Open in IMG/M |
| 3300012961|Ga0164302_10646933 | Not Available | 774 | Open in IMG/M |
| 3300012961|Ga0164302_11580150 | Not Available | 544 | Open in IMG/M |
| 3300012985|Ga0164308_11258238 | Not Available | 670 | Open in IMG/M |
| 3300015372|Ga0132256_101557988 | Not Available | 771 | Open in IMG/M |
| 3300016341|Ga0182035_10186096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1630 | Open in IMG/M |
| 3300016357|Ga0182032_10411956 | Not Available | 1095 | Open in IMG/M |
| 3300016371|Ga0182034_10350311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200 | 1199 | Open in IMG/M |
| 3300016371|Ga0182034_11602584 | Not Available | 572 | Open in IMG/M |
| 3300016387|Ga0182040_10061389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2393 | Open in IMG/M |
| 3300016387|Ga0182040_10617123 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300016422|Ga0182039_11178855 | Not Available | 691 | Open in IMG/M |
| 3300016445|Ga0182038_10029356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200 | 3439 | Open in IMG/M |
| 3300016445|Ga0182038_10224756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1493 | Open in IMG/M |
| 3300016445|Ga0182038_10596235 | Not Available | 953 | Open in IMG/M |
| 3300016445|Ga0182038_11115483 | Not Available | 701 | Open in IMG/M |
| 3300016445|Ga0182038_11140480 | Not Available | 694 | Open in IMG/M |
| 3300021560|Ga0126371_10247074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1897 | Open in IMG/M |
| 3300021560|Ga0126371_13367732 | Not Available | 540 | Open in IMG/M |
| 3300025906|Ga0207699_10111864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1751 | Open in IMG/M |
| 3300025910|Ga0207684_10597701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300025910|Ga0207684_11277836 | Not Available | 605 | Open in IMG/M |
| 3300025915|Ga0207693_10390796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1088 | Open in IMG/M |
| 3300025915|Ga0207693_10710876 | Not Available | 778 | Open in IMG/M |
| 3300025915|Ga0207693_10859921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300025918|Ga0207662_11344348 | Not Available | 507 | Open in IMG/M |
| 3300025933|Ga0207706_11739613 | Not Available | 501 | Open in IMG/M |
| 3300027874|Ga0209465_10531546 | Not Available | 586 | Open in IMG/M |
| 3300028881|Ga0307277_10276393 | Not Available | 743 | Open in IMG/M |
| 3300031544|Ga0318534_10593317 | Not Available | 630 | Open in IMG/M |
| 3300031545|Ga0318541_10545132 | Not Available | 649 | Open in IMG/M |
| 3300031546|Ga0318538_10549603 | Not Available | 626 | Open in IMG/M |
| 3300031546|Ga0318538_10668248 | Not Available | 564 | Open in IMG/M |
| 3300031668|Ga0318542_10200712 | Not Available | 1006 | Open in IMG/M |
| 3300031682|Ga0318560_10449897 | Not Available | 697 | Open in IMG/M |
| 3300031719|Ga0306917_10258720 | Not Available | 1335 | Open in IMG/M |
| 3300031719|Ga0306917_10315813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1209 | Open in IMG/M |
| 3300031744|Ga0306918_10491094 | Not Available | 961 | Open in IMG/M |
| 3300031744|Ga0306918_10930577 | Not Available | 676 | Open in IMG/M |
| 3300031751|Ga0318494_10369007 | Not Available | 831 | Open in IMG/M |
| 3300031751|Ga0318494_10460438 | Not Available | 740 | Open in IMG/M |
| 3300031765|Ga0318554_10371243 | Not Available | 813 | Open in IMG/M |
| 3300031792|Ga0318529_10077693 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300031793|Ga0318548_10218311 | Not Available | 937 | Open in IMG/M |
| 3300031794|Ga0318503_10303891 | Not Available | 518 | Open in IMG/M |
| 3300031796|Ga0318576_10612101 | Not Available | 513 | Open in IMG/M |
| 3300031798|Ga0318523_10416588 | Not Available | 667 | Open in IMG/M |
| 3300031819|Ga0318568_10799183 | Not Available | 585 | Open in IMG/M |
| 3300031833|Ga0310917_10174230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200 | 1430 | Open in IMG/M |
| 3300031833|Ga0310917_10528048 | Not Available | 802 | Open in IMG/M |
| 3300031879|Ga0306919_10623266 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 832 | Open in IMG/M |
| 3300031879|Ga0306919_11434851 | Not Available | 520 | Open in IMG/M |
| 3300031890|Ga0306925_10121797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2791 | Open in IMG/M |
| 3300031896|Ga0318551_10203827 | Not Available | 1095 | Open in IMG/M |
| 3300031910|Ga0306923_10574426 | Not Available | 1268 | Open in IMG/M |
| 3300031912|Ga0306921_11595013 | Not Available | 709 | Open in IMG/M |
| 3300031941|Ga0310912_10517857 | Not Available | 929 | Open in IMG/M |
| 3300031942|Ga0310916_10309727 | Not Available | 1338 | Open in IMG/M |
| 3300031945|Ga0310913_10123623 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1769 | Open in IMG/M |
| 3300031945|Ga0310913_10575090 | Not Available | 799 | Open in IMG/M |
| 3300031945|Ga0310913_10884154 | Not Available | 628 | Open in IMG/M |
| 3300031946|Ga0310910_10254426 | Not Available | 1374 | Open in IMG/M |
| 3300031946|Ga0310910_10547283 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300031947|Ga0310909_10350261 | Not Available | 1239 | Open in IMG/M |
| 3300031947|Ga0310909_10509675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1008 | Open in IMG/M |
| 3300031947|Ga0310909_10582768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 935 | Open in IMG/M |
| 3300031947|Ga0310909_11005134 | Not Available | 681 | Open in IMG/M |
| 3300031954|Ga0306926_12002481 | Not Available | 651 | Open in IMG/M |
| 3300031954|Ga0306926_12828494 | Not Available | 523 | Open in IMG/M |
| 3300031959|Ga0318530_10129334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| 3300031981|Ga0318531_10150686 | Not Available | 1042 | Open in IMG/M |
| 3300032001|Ga0306922_10209264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2093 | Open in IMG/M |
| 3300032001|Ga0306922_10973089 | Not Available | 877 | Open in IMG/M |
| 3300032035|Ga0310911_10150357 | Not Available | 1309 | Open in IMG/M |
| 3300032052|Ga0318506_10242830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300032055|Ga0318575_10345325 | Not Available | 754 | Open in IMG/M |
| 3300032064|Ga0318510_10017131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2247 | Open in IMG/M |
| 3300032261|Ga0306920_100174502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3205 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A01DRAFT_10573231 | 3300000580 | Forest Soil | MTVSSPNGIEIKLNRLIDDMRLLRLQIIAFDKRLKGIEAYLKPSEQQPE |
| AF_2010_repII_A001DRAFT_100906642 | 3300000793 | Forest Soil | MTVGSPNVIEIELDRLIDDMRLLRLQMIAFDRQLKG |
| Ga0066684_100696181 | 3300005179 | Soil | IEIKLDRLIDDMRLLRSQMITFDRQLKGIEASLKPSRPSEQQ* |
| Ga0066388_1030572251 | 3300005332 | Tropical Forest Soil | MTVNSPNMTEIKLDRLIDDARFLRSQIIAFDRRLKGIEASLKPS |
| Ga0066388_1063450471 | 3300005332 | Tropical Forest Soil | MTVSSPDVVEIKLDRLIDDMRLLRSQMIAFDKRLKGIEAYLKPSEQQP |
| Ga0070714_1006710901 | 3300005435 | Agricultural Soil | MTVSSPNAVEIKLDRLIDDMRLLRSQMIAFDRHLKGIEACLKPS |
| Ga0070714_1012807612 | 3300005435 | Agricultural Soil | MTVSSPNTTEIKLDRLIDDMRLLRSQIIAFDMHLKGIEAYLK |
| Ga0070698_1005751712 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDRHLKGIEASLKPS |
| Ga0066905_1004311223 | 3300005713 | Tropical Forest Soil | MTVSSPNVIEIKLDRVIDDMRLLRSQMIAFDNRLKGI |
| Ga0066903_1003591941 | 3300005764 | Tropical Forest Soil | MTVGSPNVIEIKLDRLIDDMRLLRSQMIAFDRNLKGIEACLKPSEPSESRRLLARRKDGF |
| Ga0066903_1014029594 | 3300005764 | Tropical Forest Soil | MTVGSPNVIEIKLDRLIDDMRLLRSQMIAFDSHLKGIEASLKP |
| Ga0066903_1023776311 | 3300005764 | Tropical Forest Soil | MTVARFNAIETKLDRLIDDVRLLRSQMIAFDRQLKGIEASLKP |
| Ga0066903_1026315101 | 3300005764 | Tropical Forest Soil | VTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDRHLKGIE |
| Ga0066903_1034830231 | 3300005764 | Tropical Forest Soil | MTVSSPNAIEIKLNRLIDDMRLLRSQMIAFDKRLKGIEAYLKPSEPSEQQP |
| Ga0066903_1054466462 | 3300005764 | Tropical Forest Soil | MSASSPNVIEIKLDRLIDDMRLLRSQVIAFDSRLKGIEASLKPSE |
| Ga0066903_1057706562 | 3300005764 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDMRLK |
| Ga0066903_1066112953 | 3300005764 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDDVRFLRSQMIAFDRHLKGI |
| Ga0066903_1077483642 | 3300005764 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDMRLKGI |
| Ga0066656_109906302 | 3300006034 | Soil | MKATPLTLSSPNVIEVKLDRVIDDMRVLRSQMIAFDRQLKGIEA |
| Ga0070712_1003448725 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVSSPNVIEIKLDRLIDDMRVLRSQMIAFDRQLKGIEA |
| Ga0070712_1005630081 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVSSPNVIEIKLDRLIDDMRLLRSRMIAFDRQLKGIEACLKQSEPSEQQ |
| Ga0075421_1002708896 | 3300006845 | Populus Rhizosphere | MTESSPNVIEIKLDRLIDDMRFLRSQIIAFDRRLNGIEA |
| Ga0075425_1028473021 | 3300006854 | Populus Rhizosphere | MKASANTVSSSNTIEIKLDRLIDDMRLLRSQIIAFDMHLKGIEAYLKAA |
| Ga0075436_1007846402 | 3300006914 | Populus Rhizosphere | MTVSSPNVIEIKLDRLIDDMRLLRSQMTAYDRHLKDIEAHLKPSEP |
| Ga0099792_108789482 | 3300009143 | Vadose Zone Soil | MTASSPNVIEIKLDRLIDDMRLLRSQMIAFDRHLKGIEAYLKTTEPNEQ |
| Ga0114129_106473131 | 3300009147 | Populus Rhizosphere | MTVSSPNVIEIKVDRLIDDMRFLRSQMIAFDRRLN |
| Ga0126384_106676772 | 3300010046 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDRHLKGIEAYPKPS |
| Ga0126382_113107901 | 3300010047 | Tropical Forest Soil | MTVSSPHVIEIKLDRLIDDMRHLRSQMIAFDRQLKGIEAYLKTREPSEQQPE |
| Ga0134084_101736511 | 3300010322 | Grasslands Soil | MTASSPNVIEIKLDRLIDDMRLLRSQMIAFDRQLKGIEARLKPSQPREQ |
| Ga0126370_112824742 | 3300010358 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDEMRLLRSQMIAFDMHLKGIEAYLKPS |
| Ga0126376_105999512 | 3300010359 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDDVPLLRSHMIAFDKRLKGIEAYLKP |
| Ga0126376_132531571 | 3300010359 | Tropical Forest Soil | VIEIKLDRLIDDMRLLRSQMFAFDRHLRDIEASLKPSEPSEQQPE |
| Ga0126372_101023654 | 3300010360 | Tropical Forest Soil | MTVGNPNVIEIKLDRLIDDMCLLRSQMIAFDMHLKGIEASLKPSEPSEQQPES |
| Ga0126372_101591631 | 3300010360 | Tropical Forest Soil | MTVSSANVIEIKLDRLIDEMRLLRSQMIAFDMHLKGIEAYL |
| Ga0126378_107915882 | 3300010361 | Tropical Forest Soil | MTVSSPNGIEIKLNRLIDDMRLLRSQMIAFVKRLKALDP* |
| Ga0126378_122649731 | 3300010361 | Tropical Forest Soil | MTASSPNVIEIKLDRLIDDMRLLRSQMIAFDRRPKEIQDHLKPRDPSEQ |
| Ga0126379_100613171 | 3300010366 | Tropical Forest Soil | MTASSPNVIEIKLDRLIDDVRFLRSQMIAFDRHLKGIEASLKPSEP |
| Ga0126379_109762242 | 3300010366 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDDMRFLRSQMIAFDRHLKGIEASLK |
| Ga0126379_115264661 | 3300010366 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDEMRLLRSQMIAFDMHLKGIEAYLKLMV* |
| Ga0126379_130357672 | 3300010366 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDMHLKGI |
| Ga0126381_1001138695 | 3300010376 | Tropical Forest Soil | MTVSRPNMTDKLDRLIDEVRLLRAQMIGLDRQLRGIEAYL |
| Ga0126381_1019738141 | 3300010376 | Tropical Forest Soil | MTVSSSNVIEIKLDRLIDDMRLLRSQMIAFDRHLK |
| Ga0126381_1023312861 | 3300010376 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDDVRFLRSQMIAFDRHLKGIEAS |
| Ga0126383_104926274 | 3300010398 | Tropical Forest Soil | MTVSSPNVTEIKLDRLIDDMRVLRSQMVAFDRQLKGIEAYLKPSEQQ |
| Ga0126383_113257871 | 3300010398 | Tropical Forest Soil | MTVSNPNVIEIKLDRLIDDMRLLRPQMIAFDRHLKGIEAYLKPSEPSEQRPGS |
| Ga0126383_134595551 | 3300010398 | Tropical Forest Soil | VSSPNVIEIKLDRLIEDMRLLRSQMIAFDMRLKGIEASLK |
| Ga0124844_12898612 | 3300010868 | Tropical Forest Soil | VTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDGHLKGIEASLKPSEPS |
| Ga0137389_115937421 | 3300012096 | Vadose Zone Soil | MTVNSPNVIEIKLDRLIDHMRRLRSQMIACDRHLKGIEACLKPSEPSEQQAES |
| Ga0137383_107605792 | 3300012199 | Vadose Zone Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDRHLKGI |
| Ga0137363_105642872 | 3300012202 | Vadose Zone Soil | MTVNSPNVIEIKLDRLIDDMRLLRSQMIAFDRHLKGIEACLKPSEPSEQQP |
| Ga0157322_10393561 | 3300012490 | Arabidopsis Rhizosphere | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDRQLKGIEARLKPSQPSEHGMSQFLLK* |
| Ga0126375_110842971 | 3300012948 | Tropical Forest Soil | VTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDKRLKGIEAYL |
| Ga0126375_120603801 | 3300012948 | Tropical Forest Soil | MTASSPNVIEIKLDRLIDDVRFLRSQMIAFDRHLKGIEASLK |
| Ga0164302_106469332 | 3300012961 | Soil | MAVSNPNVIEIKLDRLIDDMRLLRSQMIAFDRHLKEIEARLKTTEKQPQSK |
| Ga0164302_115801502 | 3300012961 | Soil | MTVSSPNTIEIKLDRLIDDMRLLRSQMIAFDMHLKGIEAYLKAGERSERRR |
| Ga0164308_112582381 | 3300012985 | Soil | MAVSNPNVIEIKLDRLIDDMRLLRSQMIAFDRHLKEIEARLKTTEK |
| Ga0132256_1015579882 | 3300015372 | Arabidopsis Rhizosphere | MTVSSPNVIEVKLDRLIDEMRHLRSQMIAFDRHLKDIEVYLKL |
| Ga0182035_101860961 | 3300016341 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDKRLKGIEAY |
| Ga0182032_104119561 | 3300016357 | Soil | MTENPPNVIEIKLNRLIDDMRLLRSQMIAFDKRLKGIEAYLKPSEQQPESKS |
| Ga0182034_103503111 | 3300016371 | Soil | MTVSSPNVIEFKLDRLIDDMRLLRSQMIAFDKRLKGIEAYLK |
| Ga0182034_116025842 | 3300016371 | Soil | MTVSSPNVIEMKLDRLIDDMRLLRSQMIAFDMRLKGIEASLK |
| Ga0182040_100613891 | 3300016387 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDKRLKGI |
| Ga0182040_106171232 | 3300016387 | Soil | MTVSSPNAIEIKLDRLIDDVRFLRSQMIAFDRHLKGIEASLKP |
| Ga0182039_111788551 | 3300016422 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDKRLKGIEA |
| Ga0182038_100293567 | 3300016445 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDKRLKGIE |
| Ga0182038_102247561 | 3300016445 | Soil | MTVSSPNVIETKLDRLIDDMRLLRSQMIAFDSRLKGIE |
| Ga0182038_105962352 | 3300016445 | Soil | MTVSSPNVIEMKLDRLIDDMRLLRSQMIAFDMRLKGIEASLKPSEPSEQQPE |
| Ga0182038_111154831 | 3300016445 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDMHLKG |
| Ga0182038_111404802 | 3300016445 | Soil | MTVSNPNVIEIKLDRLIDDMRLLRSQMIAFDRHLRGIEAYLKPSE |
| Ga0126371_102470744 | 3300021560 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDEMRLLRSQMIAFDMHLKGIEA |
| Ga0126371_133677321 | 3300021560 | Tropical Forest Soil | MTVSSPNVIEIKLDRLIDEMRLLRSQMIAFDMHLKGIEAYLKLMV |
| Ga0207699_101118643 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VIEVKLDRLIDDMRLLRSQMIAFDRQIKGIEACLKPS |
| Ga0207684_105977011 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVGSPNVIEIKLDRLIDDMRLLRSQMIAFDRNLKGIEACLKPN |
| Ga0207684_112778361 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVNSPNVIEIKLDRLIDDMRLLRSQMIAFDRYLKGIEAYVKPS |
| Ga0207693_103907961 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVSSPNAVEIKLDRLIDDMRLLRSQMIAFDRHLKG |
| Ga0207693_107108763 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVSSPNTTEIKLDRLIDDMRLLRSQIIAFDMHLKGIEAY |
| Ga0207693_108599212 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVSSPNVIEIKLDRVIDDMRLLRSQMIAFDRQLKGIEACLKPSEPSEQQ |
| Ga0207662_113443481 | 3300025918 | Switchgrass Rhizosphere | VTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDRHLK |
| Ga0207706_117396131 | 3300025933 | Corn Rhizosphere | MTVSSPNVIEIKLDRLIDDMRLLRSRMIAFDRQLKGIEACLKQ |
| Ga0209465_105315461 | 3300027874 | Tropical Forest Soil | MTVSSPHVIEIKLDRLIDDMRLLRSQTIAFNRQLNGIEAYLKPREPSEQQ |
| Ga0307277_102763932 | 3300028881 | Soil | MTASSPNVIEIKLDRLIDDMRLLRSQMIAYDRQLKGIEASLDSSEPSEQQP |
| Ga0318534_105933171 | 3300031544 | Soil | MTVSSPNAIEIKLDRVIDEMRFLRSQMIAFDRHLKGIEAYLEPS |
| Ga0318541_105451321 | 3300031545 | Soil | MTVSSPTLIEIKLDRLIDDMRLLRSQMIAFDKRLKQIEAYLKPNEQQP |
| Ga0318538_105496032 | 3300031546 | Soil | MSTDDREQPPNVIEIKLDRLIDDIRLLRSQMIAFDKRLKGIEAY |
| Ga0318538_106682481 | 3300031546 | Soil | MTVSSPNGIEIKLTRLIDDMRLLRSQMIAFDKRLKGIEAYLKPSEQQPES |
| Ga0318542_102007121 | 3300031668 | Soil | MTVSSPNGIEIKLTRLIDDMRLLRSQMIAFDKRLKGIEAYLKPSEQQP |
| Ga0318560_104498973 | 3300031682 | Soil | MTVRRPNVIEIKLDRLIDDMRLLRSQMIAFDRQLKRIEASLK |
| Ga0306917_102587203 | 3300031719 | Soil | MTVRRPNVIEIKLDRLIDDMRLLRSQMIAFDRQLKRIEASLKPSEPSER |
| Ga0306917_103158134 | 3300031719 | Soil | MTVGSPNVIEIKLDRLIDDMRLLRSQMIAFDRNLKGIEACLK |
| Ga0306918_104910941 | 3300031744 | Soil | MTVSSPNVIGIKLDRVIDDMRLLRSHMIAFDNRLKGIEAYLKPSEP |
| Ga0306918_109305771 | 3300031744 | Soil | VIEIKLDRLIDDMRLLRSQMIAFDSHLKGIEASLKPSEPSEQQPE |
| Ga0318494_103690071 | 3300031751 | Soil | MTVSSPNAIEIKLDRVIDEMRFLRSQMIAFDRHLKGIEAYLEPSEPSEQQP |
| Ga0318494_104604381 | 3300031751 | Soil | MTVSSPNVIEIKLDRLIDDVRFLRSQMIAFDRHLKGIEASLK |
| Ga0318554_103712431 | 3300031765 | Soil | MTVSSPNGIEIKLTRLIDDMRLLRSQMIAFDKRLKGIEAYLKPSE |
| Ga0318529_100776933 | 3300031792 | Soil | MTVSSPNVIEIKLDRLIDDVRFLRSQLIAFDRHLK |
| Ga0318548_102183113 | 3300031793 | Soil | MTVRRPNVIEIKLDRLIDDMRLLRSQMIAFDRQLKRIEASLKP |
| Ga0318503_103038911 | 3300031794 | Soil | MTVSSPEPMTVSSPNVIETKLDRLIDDMRLLRSQMIAFDSRLKGIE |
| Ga0318576_106121011 | 3300031796 | Soil | MTVGSPNVIEIKLDRLIDDMRLLRSQMIAFDRNLK |
| Ga0318523_104165881 | 3300031798 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDMHLKGIE |
| Ga0318568_107991831 | 3300031819 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDKRLKGIEAYL |
| Ga0310917_101742301 | 3300031833 | Soil | MTVSSPNVIEFKLDRLIDDMRLLRSQMIAFDKRLKGIEAYLKPSEQ |
| Ga0310917_105280482 | 3300031833 | Soil | MTVSSPNVIEMKLDRLIDDMRLLRSQMIGFDMRLKGIEASLKPSEPSEQQ |
| Ga0306919_106232661 | 3300031879 | Soil | MTVSSPNVIEIKLDRLIDDVRLLRSQMIAFDRQLIGIEA |
| Ga0306919_114348511 | 3300031879 | Soil | MTVSSPNVIEIKLNRLIDDMRLLRSQMIAFDKRLKGI |
| Ga0306925_101217971 | 3300031890 | Soil | MTVGSPNVIEIKLDRVIDDMRLLRSQMIAFERNLKGIEACL |
| Ga0318551_102038272 | 3300031896 | Soil | MTVSSPNVIEIKLDRLTDDVRFLRSQMIAFDRHLK |
| Ga0306923_105744261 | 3300031910 | Soil | MTVSSPNVIGIKLDRVIDDMRLLRSQMIAFDNRLKGIEAYLKPSEPSEQQS |
| Ga0306921_115950132 | 3300031912 | Soil | MTVSSPNLIEIKLDRLIDDMRLLRSQMIAFDKRLKQIEAYLKPNEQQPE |
| Ga0310912_105178571 | 3300031941 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDGRLKGIE |
| Ga0310916_103097273 | 3300031942 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDGRLKGIEASLKP |
| Ga0310913_101236231 | 3300031945 | Soil | MTVSSPNVIEIKLNRLIDDMRLLRSQMIAFDKRLKGIEAY |
| Ga0310913_105750902 | 3300031945 | Soil | MTVSSPNVIEIKLDRVIDDMRLLRSQMIAFERNLKGI |
| Ga0310913_108841542 | 3300031945 | Soil | VIEIKLDRLIDDMRLLRSQMIAFDSHLKGIEASLKPSEPS |
| Ga0310910_102544264 | 3300031946 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDKRLKGIEAYLKPS |
| Ga0310910_105472832 | 3300031946 | Soil | MTVSSPNAIEIKLDRLIDDVRFLRSQMIAFDRHLKGIEASLKPN |
| Ga0310909_103502612 | 3300031947 | Soil | MTVSSPNAIEIKLDRLIDDVRFLRSQMIAFDRHLKGIEA |
| Ga0310909_105096751 | 3300031947 | Soil | MTVSSPNVIEIKLDRLIDDVRFLRSQLIAFDRHLKGIEASLK |
| Ga0310909_105827681 | 3300031947 | Soil | MTVSSPNVIEIKLDRLIDDVRLLRSQMIAFDRQLIGIEAYRKPSERQP |
| Ga0310909_110051341 | 3300031947 | Soil | MTVSSPNVIEIKLDRVIDDMRLLRSQMIAFDMHLKGIEASLKASEPS |
| Ga0306926_120024812 | 3300031954 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDRQLKGI |
| Ga0306926_128284941 | 3300031954 | Soil | MSASSPNVIEIKLDRLIDDMRLLRSQVIAFDGRLK |
| Ga0318530_101293344 | 3300031959 | Soil | VTVSSPSVIEIKLDRLIDDMRLLRSQMIAFDKQLKGIEASLK |
| Ga0318531_101506862 | 3300031981 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDGRLKGIEASLKPSKPNQQQ |
| Ga0306922_102092643 | 3300032001 | Soil | MTVSSPNVIEIKLDRLIDDVRFLRSQLIAFDRHLKGIE |
| Ga0306922_109730892 | 3300032001 | Soil | MTVSSPNVIEIKLDRLIDDVRFLRSQMIAFDRQLKGIEASLKPGEPSEQQ |
| Ga0310911_101503573 | 3300032035 | Soil | MTVRRPNVIEIKLDRLIDDMRLLRSQMIAFDRQLKRIEASLKPSEPSERQP |
| Ga0318506_102428301 | 3300032052 | Soil | MTVSSPNVIEIKLDRLIDDVRFLRSQMIALDRHLK |
| Ga0318575_103453252 | 3300032055 | Soil | MTVSSPNVIEIKLDRLIDDMRLLRSQMIAFDMRLKGIEASLK |
| Ga0318510_100171312 | 3300032064 | Soil | MTVSSPNGIEIKLTRLIDDMRLLRSQMIAFDKRLKGIEAYLKPSEQQ |
| Ga0306920_1001745025 | 3300032261 | Soil | MTENPPNVIEIKLNRLIDDMRLLRSQMIAFDKRLKGIEAYLKPSEP |
| ⦗Top⦘ |