| Basic Information | |
|---|---|
| Family ID | F062959 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 46 residues |
| Representative Sequence | FHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGRH |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.92 % |
| % of genes from short scaffolds (< 2000 bps) | 90.77 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.846 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.308 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF01850 | PIN | 10.77 |
| PF01674 | Lipase_2 | 9.23 |
| PF03259 | Robl_LC7 | 6.92 |
| PF01145 | Band_7 | 5.38 |
| PF01402 | RHH_1 | 3.85 |
| PF04909 | Amidohydro_2 | 2.31 |
| PF00743 | FMO-like | 2.31 |
| PF00881 | Nitroreductase | 1.54 |
| PF13450 | NAD_binding_8 | 1.54 |
| PF04672 | Methyltransf_19 | 1.54 |
| PF01717 | Meth_synt_2 | 1.54 |
| PF00534 | Glycos_transf_1 | 0.77 |
| PF02900 | LigB | 0.77 |
| PF05088 | Bac_GDH | 0.77 |
| PF02826 | 2-Hacid_dh_C | 0.77 |
| PF00871 | Acetate_kinase | 0.77 |
| PF13738 | Pyr_redox_3 | 0.77 |
| PF13231 | PMT_2 | 0.77 |
| PF01047 | MarR | 0.77 |
| PF08447 | PAS_3 | 0.77 |
| PF00561 | Abhydrolase_1 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG2018 | Predicted regulator of Ras-like GTPase activity, Roadblock/LC7/MglB family | Signal transduction mechanisms [T] | 6.92 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 2.31 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.54 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.77 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.77 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.85 % |
| Unclassified | root | N/A | 16.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10164618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. AgB32 | 808 | Open in IMG/M |
| 3300001452|JGI20203J14952_1040622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300001867|JGI12627J18819_10284678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium | 665 | Open in IMG/M |
| 3300005334|Ga0068869_100422230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1100 | Open in IMG/M |
| 3300005336|Ga0070680_100234950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1548 | Open in IMG/M |
| 3300005338|Ga0068868_100055327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 3130 | Open in IMG/M |
| 3300005363|Ga0008090_14616782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 527 | Open in IMG/M |
| 3300005434|Ga0070709_10800618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
| 3300005434|Ga0070709_11188400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 612 | Open in IMG/M |
| 3300005435|Ga0070714_100666212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1002 | Open in IMG/M |
| 3300005436|Ga0070713_101684763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 615 | Open in IMG/M |
| 3300005467|Ga0070706_100741898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 910 | Open in IMG/M |
| 3300005537|Ga0070730_10284856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1085 | Open in IMG/M |
| 3300005541|Ga0070733_10590445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300005542|Ga0070732_10154062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1368 | Open in IMG/M |
| 3300005577|Ga0068857_100998007 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300005578|Ga0068854_101961510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300005602|Ga0070762_11304162 | Not Available | 504 | Open in IMG/M |
| 3300005610|Ga0070763_10213681 | Not Available | 1033 | Open in IMG/M |
| 3300005614|Ga0068856_100109751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2755 | Open in IMG/M |
| 3300005764|Ga0066903_107076968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300005843|Ga0068860_100090951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2907 | Open in IMG/M |
| 3300005952|Ga0080026_10065127 | Not Available | 975 | Open in IMG/M |
| 3300006028|Ga0070717_10789946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
| 3300006175|Ga0070712_100637705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 904 | Open in IMG/M |
| 3300006175|Ga0070712_101492892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 590 | Open in IMG/M |
| 3300006605|Ga0074057_10024341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2001 | Open in IMG/M |
| 3300006755|Ga0079222_10422850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 939 | Open in IMG/M |
| 3300006804|Ga0079221_10246081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1013 | Open in IMG/M |
| 3300006854|Ga0075425_100764093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1108 | Open in IMG/M |
| 3300009092|Ga0105250_10260776 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300009177|Ga0105248_13394168 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300009520|Ga0116214_1321189 | Not Available | 596 | Open in IMG/M |
| 3300009523|Ga0116221_1247979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300009545|Ga0105237_11977813 | Not Available | 591 | Open in IMG/M |
| 3300009551|Ga0105238_12429869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300009665|Ga0116135_1306112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300009672|Ga0116215_1159211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1001 | Open in IMG/M |
| 3300009700|Ga0116217_10538105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 731 | Open in IMG/M |
| 3300009839|Ga0116223_10225674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1137 | Open in IMG/M |
| 3300010043|Ga0126380_10244575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1237 | Open in IMG/M |
| 3300010360|Ga0126372_12040514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300010371|Ga0134125_10988559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
| 3300010371|Ga0134125_12191724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300010373|Ga0134128_11718310 | Not Available | 690 | Open in IMG/M |
| 3300010396|Ga0134126_10537602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1343 | Open in IMG/M |
| 3300010880|Ga0126350_10575672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1236 | Open in IMG/M |
| 3300011271|Ga0137393_11757671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 508 | Open in IMG/M |
| 3300012207|Ga0137381_10358829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1271 | Open in IMG/M |
| 3300012209|Ga0137379_10037554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 4672 | Open in IMG/M |
| 3300012360|Ga0137375_11436183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300012478|Ga0157328_1029693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300012924|Ga0137413_11778831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300012957|Ga0164303_10612165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300012971|Ga0126369_11846241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300013102|Ga0157371_10466388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300013105|Ga0157369_10128554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2685 | Open in IMG/M |
| 3300013307|Ga0157372_11389855 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300015372|Ga0132256_103362473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300016357|Ga0182032_11694049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300017970|Ga0187783_11141508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300017975|Ga0187782_10932807 | Not Available | 674 | Open in IMG/M |
| 3300018007|Ga0187805_10276195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300018007|Ga0187805_10599098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300018058|Ga0187766_10217243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1212 | Open in IMG/M |
| 3300018062|Ga0187784_10066177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2931 | Open in IMG/M |
| 3300018062|Ga0187784_10489949 | Not Available | 991 | Open in IMG/M |
| 3300018062|Ga0187784_11066832 | Not Available | 641 | Open in IMG/M |
| 3300018433|Ga0066667_10587811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300021088|Ga0210404_10075877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1644 | Open in IMG/M |
| 3300021088|Ga0210404_10215717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1033 | Open in IMG/M |
| 3300021402|Ga0210385_10355723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium agri | 1094 | Open in IMG/M |
| 3300021403|Ga0210397_11274640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
| 3300021404|Ga0210389_10135911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1903 | Open in IMG/M |
| 3300021420|Ga0210394_10175616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1865 | Open in IMG/M |
| 3300021432|Ga0210384_10593103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Beutenbergiaceae → Beutenbergia → Beutenbergia cavernae | 995 | Open in IMG/M |
| 3300021475|Ga0210392_11485100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 507 | Open in IMG/M |
| 3300021477|Ga0210398_10930968 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300021560|Ga0126371_12729454 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300022467|Ga0224712_10250881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Beutenbergiaceae → Beutenbergia → Beutenbergia cavernae | 817 | Open in IMG/M |
| 3300024055|Ga0247794_10167890 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300024181|Ga0247693_1005374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces anthocyanicus group → Streptomyces tricolor | 1541 | Open in IMG/M |
| 3300024286|Ga0247687_1041226 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300024288|Ga0179589_10047791 | Not Available | 1596 | Open in IMG/M |
| 3300024325|Ga0247678_1053663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
| 3300025898|Ga0207692_10100039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1589 | Open in IMG/M |
| 3300025898|Ga0207692_10136162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1392 | Open in IMG/M |
| 3300025906|Ga0207699_10435742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
| 3300025915|Ga0207693_10433014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300025921|Ga0207652_10606702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
| 3300025924|Ga0207694_10267535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1401 | Open in IMG/M |
| 3300025928|Ga0207700_10233044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1566 | Open in IMG/M |
| 3300025929|Ga0207664_10208175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1691 | Open in IMG/M |
| 3300025929|Ga0207664_10880613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300025929|Ga0207664_10954009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300026035|Ga0207703_11459925 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300026078|Ga0207702_12024284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 566 | Open in IMG/M |
| 3300026118|Ga0207675_101852002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 622 | Open in IMG/M |
| 3300027662|Ga0208565_1059212 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300027725|Ga0209178_1011229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2801 | Open in IMG/M |
| 3300027738|Ga0208989_10271384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 548 | Open in IMG/M |
| 3300027775|Ga0209177_10064643 | Not Available | 1076 | Open in IMG/M |
| 3300027869|Ga0209579_10056155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2090 | Open in IMG/M |
| 3300027905|Ga0209415_10216462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1780 | Open in IMG/M |
| 3300027905|Ga0209415_10376760 | Not Available | 1162 | Open in IMG/M |
| 3300027905|Ga0209415_10503088 | Not Available | 932 | Open in IMG/M |
| 3300027905|Ga0209415_10791416 | Not Available | 662 | Open in IMG/M |
| 3300030007|Ga0311338_10491430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1290 | Open in IMG/M |
| 3300031236|Ga0302324_101462677 | Not Available | 890 | Open in IMG/M |
| 3300031543|Ga0318516_10844002 | Not Available | 517 | Open in IMG/M |
| 3300031546|Ga0318538_10831950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300031708|Ga0310686_100423945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12490 | Open in IMG/M |
| 3300031708|Ga0310686_117922389 | Not Available | 672 | Open in IMG/M |
| 3300031713|Ga0318496_10693954 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031715|Ga0307476_10392134 | Not Available | 1025 | Open in IMG/M |
| 3300031740|Ga0307468_101988383 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031753|Ga0307477_10216683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1330 | Open in IMG/M |
| 3300031769|Ga0318526_10370902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300031778|Ga0318498_10159402 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300031782|Ga0318552_10562104 | Not Available | 582 | Open in IMG/M |
| 3300031823|Ga0307478_11312467 | Not Available | 601 | Open in IMG/M |
| 3300031860|Ga0318495_10545359 | Not Available | 504 | Open in IMG/M |
| 3300031897|Ga0318520_10780042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300032067|Ga0318524_10188760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1051 | Open in IMG/M |
| 3300032074|Ga0308173_11112673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 736 | Open in IMG/M |
| 3300032783|Ga0335079_10077863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3769 | Open in IMG/M |
| 3300032892|Ga0335081_11306100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300032893|Ga0335069_12210648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia miyunensis | 575 | Open in IMG/M |
| 3300033475|Ga0310811_10098546 | All Organisms → cellular organisms → Bacteria | 3792 | Open in IMG/M |
| 3300033547|Ga0316212_1005963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1768 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.23% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.08% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.08% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.54% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.77% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.77% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.77% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.77% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001452 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101646182 | 3300000567 | Peatlands Soil | ALPAPFHSADKVLGYGAGLAALWYVGALFWRLRKGTAGVKPVDELIDR* |
| JGI20203J14952_10406222 | 3300001452 | Arctic Peat Soil | LIMVVLSFPAPFHGSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVSDLVDKP* |
| JGI12627J18819_102846781 | 3300001867 | Forest Soil | LSFPAPFHGSDKMLGYALALAALWYFSCLLWRLRKGTAGVKPVSDLVDRL* |
| Ga0068869_1004222301 | 3300005334 | Miscanthus Rhizosphere | VLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG* |
| Ga0070680_1002349504 | 3300005336 | Corn Rhizosphere | SDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG* |
| Ga0068868_1000553275 | 3300005338 | Miscanthus Rhizosphere | LSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG* |
| Ga0008090_146167821 | 3300005363 | Tropical Rainforest Soil | PAPFHGSDKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLAEPPSD* |
| Ga0070709_108006181 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPIEDLASMSRHES* |
| Ga0070709_111884001 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GYGLVLAALWYFGGLLWRLKKGTAGVKPVEELASTPPSEP* |
| Ga0070714_1006662121 | 3300005435 | Agricultural Soil | VLSLPAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELVSTPPSEP* |
| Ga0070713_1016847632 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELADQSQP* |
| Ga0070706_1007418981 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG* |
| Ga0070730_102848561 | 3300005537 | Surface Soil | VLGYGAALAALWYFGGLLRRLRKGTAGVRPVEELTGRPEP* |
| Ga0070733_105904452 | 3300005541 | Surface Soil | YGLALAALWYFGGLLWRLRKGTAGVKPVEDLVDADG* |
| Ga0070732_101540621 | 3300005542 | Surface Soil | GYGLALAALWYFGGLLWRLRKGTAGVKPVEDLVDADG* |
| Ga0068857_1009980072 | 3300005577 | Corn Rhizosphere | PFHGSDKMLGYALALAALWYFSGLLWRLRKGTAGVKPVSDLVDRR* |
| Ga0068854_1019615102 | 3300005578 | Corn Rhizosphere | LAALWYFGGLLWRLKKGTAGVKPVEDLAQDPPRAG* |
| Ga0070762_113041621 | 3300005602 | Soil | LAALWYFGGLMWRLRKGTAGVKPVDDLVDTQPTIR* |
| Ga0070763_102136812 | 3300005610 | Soil | FHGSDKMLGYALALAALWYFSVLLWRLRKGTAGVKPISDLGDRS* |
| Ga0068856_1001097514 | 3300005614 | Corn Rhizosphere | DKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELAGAPSPDR* |
| Ga0066903_1070769682 | 3300005764 | Tropical Forest Soil | PFHGADKVLGYGLALAAAWYFGGLLWRLRKGTAGVKPVEDLVDAPPPAG* |
| Ga0068860_1000909511 | 3300005843 | Switchgrass Rhizosphere | PAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG* |
| Ga0080026_100651272 | 3300005952 | Permafrost Soil | DKVLLYGFILAVLWYAGALYRRLKAGTAGVKPIDDFID* |
| Ga0070717_107899462 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG* |
| Ga0070712_1006377052 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGIKPVEDLVQGPPQAG* |
| Ga0070712_1014928922 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELVSTPPSEP* |
| Ga0074057_100243411 | 3300006605 | Soil | LPAPFHGADKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLIQGPPQAG* |
| Ga0079222_104228503 | 3300006755 | Agricultural Soil | SDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELASAPPPEP* |
| Ga0079221_102460814 | 3300006804 | Agricultural Soil | SLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG* |
| Ga0075425_1007640932 | 3300006854 | Populus Rhizosphere | GLVLAALWYFGGLLWRLKKGTAGVKPVEELASTPPSEP* |
| Ga0105250_102607762 | 3300009092 | Switchgrass Rhizosphere | FHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGH* |
| Ga0105248_133941682 | 3300009177 | Switchgrass Rhizosphere | SDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG* |
| Ga0116214_13211892 | 3300009520 | Peatlands Soil | FHGADKVLGYGLALAALWYFGGLVWRLKKGTAGVKPIEDLVAPPPDR* |
| Ga0116221_12479792 | 3300009523 | Peatlands Soil | SLPAPFHGADKVLGYGLALAALWYFGGLVWRLKKGTAGVKPIEDLIAPPDR* |
| Ga0105237_119778132 | 3300009545 | Corn Rhizosphere | VPAAFHGSDKFLLYGFIVAVAWYFGAVFWRLRNGTAGVKPVEELAE* |
| Ga0105238_124298692 | 3300009551 | Corn Rhizosphere | VSAAFHGSDKFLLYGFIVAVAWYFGAVFWRLRNGTAGVKPVEELAE* |
| Ga0116135_13061122 | 3300009665 | Peatland | GYGVVLAALWYFGGLLWRLKKGTAGVKPVEELTGRSE* |
| Ga0116215_11592111 | 3300009672 | Peatlands Soil | LAALWYFGGLVWRLRKGTAGVKPVEDLVAAPSTRQP* |
| Ga0116217_105381052 | 3300009700 | Peatlands Soil | VLSLPAPFHGADKVLGYGLALAALWYFGGLVWRLRKGTAGVKPVEDLVAAPSTRQP* |
| Ga0116223_102256742 | 3300009839 | Peatlands Soil | PAPFHSADKVLGYGAGLAALWYVGALVWRLRKGTAGVKPVDELIDR* |
| Ga0126380_102445752 | 3300010043 | Tropical Forest Soil | LSLPAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEDLADPPSPDR* |
| Ga0126372_120405142 | 3300010360 | Tropical Forest Soil | APFHGSDKVLGYGIGLAALWYFGALLWRLRRGTAGVKPVDELVD* |
| Ga0134125_109885593 | 3300010371 | Terrestrial Soil | STFHGSDKVLLYGAGVAALWYFAALLWRLRSGTAGVKPVEDLLD* |
| Ga0134125_121917241 | 3300010371 | Terrestrial Soil | LPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG* |
| Ga0134128_117183101 | 3300010373 | Terrestrial Soil | GSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLAQDPPRAG* |
| Ga0134126_105376021 | 3300010396 | Terrestrial Soil | LGYGLVLAALWYFGGLLWRLKKGTAGVKPVEDLARASQQES* |
| Ga0126350_105756721 | 3300010880 | Boreal Forest Soil | SPFHGSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVSDLVGKP* |
| Ga0137393_117576712 | 3300011271 | Vadose Zone Soil | FPAPFHGSDKMLGYALALAALWYFSVLLWRLRKGTAGVKPLSDLVDRP* |
| Ga0137381_103588291 | 3300012207 | Vadose Zone Soil | VLSLPAPFHGSDKVLGYGLALAALWYFGGLLRRLKKGTAGVKPVENLVQGPPKAG* |
| Ga0137379_100375546 | 3300012209 | Vadose Zone Soil | ADKVLGYGLALAALWYFGGLLRRLRNGTAGVKPVEDLVDAPPAREP* |
| Ga0137375_114361832 | 3300012360 | Vadose Zone Soil | VLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG* |
| Ga0157328_10296932 | 3300012478 | Arabidopsis Rhizosphere | MLVLSLPAPFHGSDRVLGYGLALAALWYFGALLWRLKKGTAGVKPVEDLVDRQH* |
| Ga0137413_117788311 | 3300012924 | Vadose Zone Soil | APFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGIKPVEDLVQGPPQAG* |
| Ga0164303_106121651 | 3300012957 | Soil | LVLSLPAPFHGSDKVLGYGLVLSALWYFGGLLWRLKKGTAGVKPVEDLAQDPPRAG* |
| Ga0126369_118462411 | 3300012971 | Tropical Forest Soil | GSDKVLGYGLVVAALWYFGGLLWRLKKGTAGVKPVEELAERSE* |
| Ga0157371_104663882 | 3300013102 | Corn Rhizosphere | FHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGRH* |
| Ga0157369_101285543 | 3300013105 | Corn Rhizosphere | VSATFHGSDKFLLYGFIVAVAWYFGAVFWRLRNGTAGVKPVEELAE* |
| Ga0157372_113898552 | 3300013307 | Corn Rhizosphere | APFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGH* |
| Ga0132256_1033624732 | 3300015372 | Arabidopsis Rhizosphere | PAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLAGPSPD* |
| Ga0182032_116940492 | 3300016357 | Soil | SLPTPFHGADKVLGYGLALAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPVG |
| Ga0187783_111415082 | 3300017970 | Tropical Peatland | GADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVESLVDTDQ |
| Ga0187782_109328072 | 3300017975 | Tropical Peatland | VVLSFPAPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEALVDQDG |
| Ga0187805_102761952 | 3300018007 | Freshwater Sediment | PAPFHGADKVLGYGAILAALWYFGGLIWRLRRGTAGVRPVDELVE |
| Ga0187805_105990982 | 3300018007 | Freshwater Sediment | LVLSLPAPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLIDANG |
| Ga0187766_102172433 | 3300018058 | Tropical Peatland | LSLPAPFHGADKVMGYVLAVAAAWYFGGLLWRLKKGTAGVKPVEDLVDRPTP |
| Ga0187784_100661774 | 3300018062 | Tropical Peatland | GYGLALAALWYFGGLLWRLRKGTAGVKPVEDLIDTNG |
| Ga0187784_104899492 | 3300018062 | Tropical Peatland | GYGLALAALWYFGGLLWRLRKGTAGVKPVEDLVDQDG |
| Ga0187784_110668322 | 3300018062 | Tropical Peatland | SFPAPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEALVDQDG |
| Ga0066667_105878111 | 3300018433 | Grasslands Soil | APFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDRNH |
| Ga0210404_100758771 | 3300021088 | Soil | LSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGIKPVEDLVQGPPQAG |
| Ga0210404_102157174 | 3300021088 | Soil | LPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG |
| Ga0210385_103557233 | 3300021402 | Soil | GYGLALAALWYFGGLLRRLKNGTAGVKPLSDLADEP |
| Ga0210397_112746401 | 3300021403 | Soil | KVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG |
| Ga0210389_101359111 | 3300021404 | Soil | LGYGLVLAALWYFGGLLWRLKKGTAGIKPVEDLVQDPPQAG |
| Ga0210394_101756161 | 3300021420 | Soil | YGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG |
| Ga0210384_105931031 | 3300021432 | Soil | LSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG |
| Ga0210392_114851002 | 3300021475 | Soil | PSPFHGSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVSDLVGKP |
| Ga0210398_109309682 | 3300021477 | Soil | FPAPFHGSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVGDLVDKP |
| Ga0126371_127294542 | 3300021560 | Tropical Forest Soil | FHGADKVIGYGAGLAAIWYFAALLWRLRNGTAGVKPVDELIE |
| Ga0224712_102508813 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG |
| Ga0247794_101678901 | 3300024055 | Soil | LALAALWYFGGLLRRLRKGTAGVKPVEDLVQGPPQAG |
| Ga0247693_10053741 | 3300024181 | Soil | LVLSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGH |
| Ga0247687_10412262 | 3300024286 | Soil | GSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGH |
| Ga0179589_100477912 | 3300024288 | Vadose Zone Soil | FHGSDRMLGYALALAALWYFGGLLRRLRKGTAGVKPVSDLIDRP |
| Ga0247678_10536631 | 3300024325 | Soil | KVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG |
| Ga0207692_101000393 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELAGAPSPDR |
| Ga0207692_101361624 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG |
| Ga0207699_104357422 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLAQDPPRAG |
| Ga0207693_104330144 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG |
| Ga0207652_106067021 | 3300025921 | Corn Rhizosphere | LALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG |
| Ga0207694_102675354 | 3300025924 | Corn Rhizosphere | SLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGRPPSG |
| Ga0207700_102330443 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELAGAPSPDR |
| Ga0207664_102081753 | 3300025929 | Agricultural Soil | LSLPAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEELAGAPSPDR |
| Ga0207664_108806132 | 3300025929 | Agricultural Soil | MLVLSLPAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGIKPVEDLVQGPPQAG |
| Ga0207664_109540092 | 3300025929 | Agricultural Soil | DKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPQAG |
| Ga0207703_114599252 | 3300026035 | Switchgrass Rhizosphere | IMVVLSFPAPFHGSDKMLGYALALAALWYFSGLLWRLRKGTAGVKPVSDLVDRR |
| Ga0207702_120242842 | 3300026078 | Corn Rhizosphere | PAPFHGSDKVLGYGLVLAALWYFGGLLWRLKKGTAGVKPVEDLARASQPES |
| Ga0207675_1018520021 | 3300026118 | Switchgrass Rhizosphere | LAALWYFGGLLWRLKKGTAGVKPVEDLVQGPPPAG |
| Ga0208565_10592122 | 3300027662 | Peatlands Soil | DKVLGYGLALAALWYFGGLVWRLKKGTAGVKPIEDLVAPPPDR |
| Ga0209178_10112291 | 3300027725 | Agricultural Soil | GSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLLQGRPPSG |
| Ga0208989_102713841 | 3300027738 | Forest Soil | LSFPAPFHGSDKMLGYALALAALWYFSVLLWRLRKGTAGVKPLSDLVDRP |
| Ga0209177_100646431 | 3300027775 | Agricultural Soil | VPAAFHGSDKFLLYGFIVAVAWYFGAVFWRLRNGTAGVKPVEELAE |
| Ga0209579_100561554 | 3300027869 | Surface Soil | SFPAPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLLDANG |
| Ga0209415_102164623 | 3300027905 | Peatlands Soil | GADKVLGYGLALAALWYFGGLVWRLRKGTAGVKPVEDLVAAPSTRQP |
| Ga0209415_103767601 | 3300027905 | Peatlands Soil | MVVLSFPSPFHGADKVLGYGLALAALWYFGGLLWRLRAGTAGVKPVEDLVDADG |
| Ga0209415_105030881 | 3300027905 | Peatlands Soil | MVVLSFPSPFHGADKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLLDADV |
| Ga0209415_107914161 | 3300027905 | Peatlands Soil | GADKVLGYGLALAALWYFGGLVWRLKNGTAGVKPVEDLIAPPPARQP |
| Ga0311338_104914303 | 3300030007 | Palsa | GSDKMLGYALALAALWYFGGLLRRLRKGTAGVKPVVDLVDKP |
| Ga0302324_1014626771 | 3300031236 | Palsa | DKMLGYALVLAALWYFGGLLRRLKNGTAGVKPVSDLADKP |
| Ga0318516_108440022 | 3300031543 | Soil | YGLAVAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPAG |
| Ga0318538_108319501 | 3300031546 | Soil | VLGYGLVLAALWYFGGLIWRLKKGTAGVKPVEDLLGPPSP |
| Ga0310686_1004239459 | 3300031708 | Soil | DKMLGYALALAALWYFGGLLRRLRNGTAGVKPVTDLADKP |
| Ga0310686_1179223891 | 3300031708 | Soil | ADKVLGYGLVLAALWYFGGLLWRLRRGEAGVKPLDDLTD |
| Ga0318496_106939542 | 3300031713 | Soil | GSDKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLAEPPSSD |
| Ga0307476_103921341 | 3300031715 | Hardwood Forest Soil | DKVLGYGLALAALWYFGGLLWRLRKGTAGVKPVEDLLDANG |
| Ga0307468_1019883831 | 3300031740 | Hardwood Forest Soil | GYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVDGGR |
| Ga0307477_102166831 | 3300031753 | Hardwood Forest Soil | VLSLPAPFHGADKVLGYGLALAAAWYFGGLLWRLRKGTAGVKPVEDLVDAPPPVG |
| Ga0318526_103709022 | 3300031769 | Soil | MLILSLPTPFHGADKVLGYGLAVAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPVG |
| Ga0318498_101594022 | 3300031778 | Soil | LALAALWYFGGLLWRLRKGTAGVKPVEDLAGPPSSD |
| Ga0318552_105621042 | 3300031782 | Soil | VLGYGLAVAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPAG |
| Ga0307478_113124671 | 3300031823 | Hardwood Forest Soil | VLGYGLAVAAAWYFGGLLWRLRKGTAGVRPVEDLLDASRR |
| Ga0318495_105453592 | 3300031860 | Soil | LIMIVLSFPAPFHGADKVLGYGLGLAALWYFGGLLWRLRNGTAGVKPVEDLLDKDG |
| Ga0318520_107800422 | 3300031897 | Soil | KVLGYGLAVAAAWYFGGLLWRLRKGTAGVKPVEDLIDAPPPVG |
| Ga0318524_101887603 | 3300032067 | Soil | TGDDLALAPTPFHGADKVLGYGLAVAAAWYFGGLLWRLKKGTAGVKPVEDLVDRPRP |
| Ga0308173_111126731 | 3300032074 | Soil | VLSLPAPFHGSDKVLGYGLALAALWYFGGLLWRLKKGTAGVKPVEDLVQPPPEAV |
| Ga0335079_100778635 | 3300032783 | Soil | APFHGSDKVLGYGLVLAALWYFGGLLWRLRKGTAGVKPVEDLASPPPAG |
| Ga0335081_113061002 | 3300032892 | Soil | PFHGSDKVLGYGLVLAALWYFGGLLWRLRKGTAGVKPVEDLAEPPPSD |
| Ga0335069_122106481 | 3300032893 | Soil | SDRVLGYGLALAALWYFGGLLWRLKKGTAGVKPISDLVDRP |
| Ga0310811_100985461 | 3300033475 | Soil | MLGYALALAALWYFGALLWRLRKGTAGVKPVSELVDRP |
| Ga0316212_10059632 | 3300033547 | Roots | LIMVVLSFPAPFHGSDRMLGYALALAALWYFSVLLWRLRKGTAGVKPVSDLVDRP |
| ⦗Top⦘ |