NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062868

Metagenome / Metatranscriptome Family F062868

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062868
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 44 residues
Representative Sequence RAWDALLRDKKGRLRLVLLGDDGGYVTEVPEADVRRALDELIAD
Number of Associated Samples 119
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.77 %
% of genes near scaffold ends (potentially truncated) 99.23 %
% of genes from short scaffolds (< 2000 bps) 95.38 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.385 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(12.308 % of family members)
Environment Ontology (ENVO) Unclassified
(34.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.231 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.17%    β-sheet: 16.67%    Coil/Unstructured: 54.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF01220DHquinase_II 68.46
PF01321Creatinase_N 26.15
PF09285Elong-fact-P_C 3.08
PF01381HTH_3 0.77
PF00557Peptidase_M24 0.77
PF01761DHQ_synthase 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG07573-dehydroquinate dehydrataseAmino acid transport and metabolism [E] 68.46
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 26.15

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.38 %
UnclassifiedrootN/A4.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090006|LWSO2_GGWJX9X02F4LF8Not Available509Open in IMG/M
3300000955|JGI1027J12803_107267906All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300001538|A10PFW1_12081910All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300003203|JGI25406J46586_10169888All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005093|Ga0062594_100157762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1501Open in IMG/M
3300005159|Ga0066808_1029481All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005179|Ga0066684_10245151All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300005187|Ga0066675_10043497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2723Open in IMG/M
3300005332|Ga0066388_104001441All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005439|Ga0070711_102005366All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005454|Ga0066687_10362901All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300005468|Ga0070707_100763169All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300005535|Ga0070684_100361944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1335Open in IMG/M
3300005544|Ga0070686_100739937All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300005548|Ga0070665_102432174All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005552|Ga0066701_10478636All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005560|Ga0066670_10152834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1350Open in IMG/M
3300005566|Ga0066693_10497802All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005598|Ga0066706_10885240All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005598|Ga0066706_11072910All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005617|Ga0068859_102662148All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005617|Ga0068859_103170464All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005713|Ga0066905_101130871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300005719|Ga0068861_100967311All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300006237|Ga0097621_100289808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter1443Open in IMG/M
3300006578|Ga0074059_12172192Not Available500Open in IMG/M
3300006581|Ga0074048_13276416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria856Open in IMG/M
3300006791|Ga0066653_10203132All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300006797|Ga0066659_10126398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1782Open in IMG/M
3300006914|Ga0075436_100440031All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300006953|Ga0074063_10011183Not Available508Open in IMG/M
3300007076|Ga0075435_101652776All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300009012|Ga0066710_103121105All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300009100|Ga0075418_10616515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1168Open in IMG/M
3300009137|Ga0066709_104691655All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300009147|Ga0114129_10882942All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300009148|Ga0105243_12706689Not Available536Open in IMG/M
3300009545|Ga0105237_11052789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300009551|Ga0105238_12805209All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300009789|Ga0126307_10516763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria964Open in IMG/M
3300010036|Ga0126305_10197942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1273Open in IMG/M
3300010038|Ga0126315_10195377All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300010040|Ga0126308_10350669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300010040|Ga0126308_10625715All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300010045|Ga0126311_10612121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria863Open in IMG/M
3300010301|Ga0134070_10021457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2105Open in IMG/M
3300010333|Ga0134080_10111357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1134Open in IMG/M
3300010336|Ga0134071_10806174All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300010359|Ga0126376_12763698All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300010373|Ga0134128_11700291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter694Open in IMG/M
3300010375|Ga0105239_10643828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1210Open in IMG/M
3300010375|Ga0105239_11159740All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300010375|Ga0105239_12397374All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300010375|Ga0105239_13057186All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010375|Ga0105239_13241784All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300010396|Ga0134126_12760937All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300011003|Ga0138514_100036648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales950Open in IMG/M
3300011119|Ga0105246_10199998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1553Open in IMG/M
3300011269|Ga0137392_10342730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1237Open in IMG/M
3300012004|Ga0120134_1071364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae626Open in IMG/M
3300012199|Ga0137383_11249473All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300012200|Ga0137382_10307480All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300012206|Ga0137380_10379424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album1258Open in IMG/M
3300012207|Ga0137381_10424846All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300012208|Ga0137376_10299653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1395Open in IMG/M
3300012209|Ga0137379_11758228All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012210|Ga0137378_11788099All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012212|Ga0150985_105661386All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300012212|Ga0150985_115227579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1124Open in IMG/M
3300012353|Ga0137367_10381489All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300012354|Ga0137366_10013153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia6497Open in IMG/M
3300012355|Ga0137369_10453235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria915Open in IMG/M
3300012356|Ga0137371_10432101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1020Open in IMG/M
3300012897|Ga0157285_10359065All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300012971|Ga0126369_12071773All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300012975|Ga0134110_10469354All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300012987|Ga0164307_11454041All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012989|Ga0164305_10182428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1458Open in IMG/M
3300013763|Ga0120179_1011217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2310Open in IMG/M
3300014157|Ga0134078_10268066All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300014166|Ga0134079_10481014All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300014326|Ga0157380_12038426All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300014969|Ga0157376_12993750Not Available511Open in IMG/M
3300015077|Ga0173483_10521399All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300017657|Ga0134074_1370569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae531Open in IMG/M
3300017792|Ga0163161_10409999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1088Open in IMG/M
3300017959|Ga0187779_10941329All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300018027|Ga0184605_10023089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2516Open in IMG/M
3300018027|Ga0184605_10114469All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300018433|Ga0066667_10381270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1133Open in IMG/M
3300018482|Ga0066669_10908644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300019875|Ga0193701_1027626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1164Open in IMG/M
3300019887|Ga0193729_1166596All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300021080|Ga0210382_10248306All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300021080|Ga0210382_10253509All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300021560|Ga0126371_12272602All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300022915|Ga0247790_10028792All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300025899|Ga0207642_11144374All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300025919|Ga0207657_11361209All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300025927|Ga0207687_10166592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1696Open in IMG/M
3300025934|Ga0207686_11456154Not Available564Open in IMG/M
3300025936|Ga0207670_10398512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1100Open in IMG/M
3300026121|Ga0207683_11184683All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300026142|Ga0207698_11167517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria784Open in IMG/M
3300026306|Ga0209468_1102213All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300026323|Ga0209472_1086610All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300026330|Ga0209473_1207498All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300026343|Ga0209159_1207123All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300026528|Ga0209378_1137007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300026750|Ga0207483_101786All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300028379|Ga0268266_11983289All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300028705|Ga0307276_10215166All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300028716|Ga0307311_10182540All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300028754|Ga0307297_10090423All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300028778|Ga0307288_10028322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1837Open in IMG/M
3300028778|Ga0307288_10304626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium634Open in IMG/M
3300028784|Ga0307282_10530583All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300028811|Ga0307292_10367061All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300028828|Ga0307312_10378888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales927Open in IMG/M
3300028881|Ga0307277_10024243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2391Open in IMG/M
3300030336|Ga0247826_10605045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300031184|Ga0307499_10072432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia892Open in IMG/M
3300031543|Ga0318516_10879524All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031544|Ga0318534_10885939All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031820|Ga0307473_11129773All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031835|Ga0318517_10125030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1140Open in IMG/M
3300031981|Ga0318531_10531012All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031995|Ga0307409_100889078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria904Open in IMG/M
3300032013|Ga0310906_10928325All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300033551|Ga0247830_11192092All Organisms → cellular organisms → Bacteria608Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.31%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.38%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.08%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.08%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.31%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.31%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.54%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.54%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.54%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater Sediment0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.77%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.77%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.77%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090006Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 2EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005159Soil and rhizosphere microbial communities from Laval, Canada - mgLPBEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026750Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LWSO2_083286202088090006Freshwater SedimentVHVSRERAWEALLRDKKGRLRIVLLGPDGAHEEELPEPDVRAALDALIAE
JGI1027J12803_10726790623300000955SoilAWEALLRDKKGRLRIVLLDGERELTEADVRAALDDLIAG*
A10PFW1_1208191023300001538PermafrostAELHPEPVRVDADRAWDALLRDKKGPLSLILIGDDGAFEDTLPEADVRGALNELIAR*
JGI25406J46586_1016988813300003203Tabebuia Heterophylla RhizosphereAPERVRVDPEVAWQALLRDKKGHLRVILLGDEGAYETDLPERDVRRALDELIAE*
Ga0062594_10015776233300005093SoilAWEALLRDKKGALNLVLLGDDGGFVTQVPEADVKRALDELIAD*
Ga0066808_102948123300005159SoilVDRDRAWNALLLDKKGALNLVLLADDGGYVTQVPEADVKRALDELIAD*
Ga0066684_1024515113300005179SoilERAWEALKRDKKSTGGELTLVLLGDEGGFATNVPEADVRRALDELIAD*
Ga0066675_1004349713300005187SoilAWQALERDKKSTGGELTLVLLGGEGGFTTKVPATDVRSALDDLIAN*
Ga0066388_10400144133300005332Tropical Forest SoilLQRDKKGPMRLILLGDEGGFETEMPPDEVRAALDSLIAR*
Ga0070711_10200536623300005439Corn, Switchgrass And Miscanthus RhizosphereVDRERAWEALLRDKKGRLRIVLLDDDGPREEELPEADVRAALDQLIAE*
Ga0066687_1036290113300005454SoilQRARVDPDRAWQALLRDKKGRLRIVLLGDDGAFETELPESDVRAALAELIER*
Ga0070707_10076316913300005468Corn, Switchgrass And Miscanthus RhizosphereALQRDKKGRMRVILLGDEGGYEAELPEADVQAALDELIAG*
Ga0070684_10036194413300005535Corn RhizosphereDRERAWEALLRDKKGRLRIVLLDDDGPREEELPEADVRAALDQLIAE*
Ga0070686_10073993713300005544Switchgrass RhizosphereDRAWEALQRDKKGPLRVILLGDDGGFETKLPERDVRAALDELIAG*
Ga0070665_10243217423300005548Switchgrass RhizosphereQRDKKGRMRIVLLDDDGGRVTELPEADVRAALDSLIAR*
Ga0066701_1047863633300005552SoilRPRPIPVDAELAWQTLLRDKKGPMKLILLGDEGAFETTVPPTEVRRALDELIA*
Ga0066670_1015283433300005560SoilRDRAWAALRRDKKSTGGELTLVLLGDEGGFTTNVRDEDVRRALDELIAD*
Ga0066693_1049780213300005566SoilWEAFKRDKKSTGGELTLVLLGDEGGFTTSVAENDVRRALHELIAD*
Ga0066706_1088524013300005598SoilLGPQPVKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD*
Ga0066706_1107291023300005598SoilLRPRPIPVDAELAWQTLLRDKKGPMKLILLGDEGAFETTVPPTEVRRALDELIA*
Ga0068859_10266214813300005617Switchgrass RhizosphereKKGRMRIVLLDDDGGRVTELPEADVRAALDSLIAR*
Ga0068859_10317046423300005617Switchgrass RhizosphereDRERAWEALLRDKKGRLRIVLLDDDGAREEELPEADVRAALDELIAE*
Ga0066905_10113087113300005713Tropical Forest SoilRAWDALLRDKKGALNLVLLGDDGGYVTQVPEGDVKRALGELISD*
Ga0068861_10096731133300005719Switchgrass RhizosphereKSTGGKLTLVLLGDEGGFRAKVPELDVRRALDELIAD*
Ga0097621_10028980833300006237Miscanthus RhizosphereKGRLRIVLLGDDGAFEQELPEADVRTALDALISG*
Ga0074059_1217219223300006578SoilRAWDALLRDKKGALNLVLLGDDGGYVTQVPEADVKRALDELIAD*
Ga0074048_1327641613300006581SoilAWEALLRDKKGRLRIVLLDDDGAREEELPEADVRGALDELIAE*
Ga0066653_1020313213300006791SoilKATHGELRLVLLGDEGGFTTAVEKADARRALDELIAE*
Ga0066659_1012639843300006797SoilTGGELTLVLLGDEGGFATTVPEADVRRALDELIAD*
Ga0075436_10044003113300006914Populus RhizosphereLRDKKGRLRLVLLGEEGGFVTEVPEADVKRALDELIAD*
Ga0074063_1001118313300006953SoilWDALLHDKKGRLRLVLLGDDGGYVTEVPEPDVRRALDELIAD*
Ga0075435_10165277623300007076Populus RhizosphereRAWDALLRDKKGRLRLVLLGDDGGYVTEVPEADVRRALDELIAD*
Ga0066710_10312110513300009012Grasslands SoilRAWQALLRDKKGPLSLILLGDDGAFETEVPQDDVRRALDELIA
Ga0075418_1061651513300009100Populus RhizosphereREAAWQALLRDKKGRMRVILLGDDGAFETELDERDVRRALDELIAE*
Ga0066709_10469165523300009137Grasslands SoilLLRDKKGRLRIVLLGDEGPREEELPEADVRAALDALISG*
Ga0114129_1088294213300009147Populus RhizosphereKGALNLVLLGDDGGFVTEMPEADVRCALDELIAD*
Ga0105243_1270668923300009148Miscanthus RhizosphereHDKKGRLRLVLLADEGGYVTEVPEADVKRALEELIAD*
Ga0105237_1105278913300009545Corn RhizosphereRDKKGALNLVLLGDEGGFVTQLPEADVRRALDELIAD*
Ga0105238_1280520923300009551Corn RhizosphereERERAWEALLRDKKGRLRIVLLGDDGAFEQELPEADVRTALDALISG*
Ga0126307_1051676313300009789Serpentine SoilRDRAWEALLRDKKGALNLVLLGDDGGYVTHVPETDVKRALNELIAD*
Ga0126305_1019794233300010036Serpentine SoilRAWEALLRDKKGPLNVVLLGDEGPFVTELPAADVRRALDELVDG*
Ga0126315_1019537713300010038Serpentine SoilERAWEALQRDKKGRLRVILVGDDGGFETDLPERDVRGALDELIAG*
Ga0126308_1035066933300010040Serpentine SoilKGPLRVILLGDEGGFETELPERDVRRALDELIAG*
Ga0126308_1062571513300010040Serpentine SoilDRERAWQALLRDKKGPLNVVLLGDDGAFVTELPAQDVKRALDGLVDG*
Ga0126311_1061212133300010045Serpentine SoilEALLRDKKGALNLVLLRADGAFVGEQPASDVRRALDELVAE*
Ga0134070_1002145743300010301Grasslands SoilLLRDKKGALNLVLLGDEGGYVTSVPEREVKRALDELIAD*
Ga0134080_1011135733300010333Grasslands SoilLSGRPTDAVEAVLAPQPVKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD*
Ga0134071_1080617413300010336Grasslands SoilDKKGRLRLVLLGDDGGFVTDVPEADVKRALDELIAD*
Ga0126376_1276369823300010359Tropical Forest SoilQRDKKGPMRLILLGDDGGYEQELPPDEVRAALDSLIAR*
Ga0134128_1170029113300010373Terrestrial SoilKKGALNLVLLGDDGGFVTQVPEADVKRALDELIAD*
Ga0105239_1064382813300010375Corn RhizosphereALQRDKKSTGGELTLVLLGDEGGFAANVPETDVRRALDELIAD*
Ga0105239_1115974013300010375Corn RhizosphereEQDHAERALQRDKKGPLRVILLGDDGGFETKLPERDVRAALDELIAG*
Ga0105239_1239737413300010375Corn RhizosphereERAWDALRRDKKGPLRLILLGEDGAFERELPERDVRAALDELIEG*
Ga0105239_1305718613300010375Corn RhizosphereRERAWEALQRDKKGRMRIVLLDDAGGRVTELPEADVRAALDSLIAR*
Ga0105239_1324178423300010375Corn RhizosphereERAWEALLRDKKGRLRIVLLGDDGAFEQELPEADVRTALDALISG*
Ga0134126_1276093723300010396Terrestrial SoilAWEALQRDKKSTGGELTLVLLGDEGGFRAKVPELDVRRALDELIAD*
Ga0138514_10003664833300011003SoilLERDKKSTGGELTLVLLGDEGGFTTSVPETDVRRALDELIAD*
Ga0105246_1019999813300011119Miscanthus RhizosphereVLIDRERAWDALLRDKKGALNLVLLGDEGGYVTAVPENDVRSALNELIAD*
Ga0137392_1034273033300011269Vadose Zone SoilLRDKKGPLSLILLGGDGAFETEVPQADVRAALDALIAG*
Ga0120134_107136413300012004PermafrostRQVLRLIAVVVEETLAPKSVEVDRDRAWEALKRDKKSTRGELTLVLLGDEGGYTTNVPEADVRRALDELIAD*
Ga0137383_1124947313300012199Vadose Zone SoilALLRDKKGPLSLILLGDDGAFELSVPEADARAALDELIAG*
Ga0137382_1030748013300012200Vadose Zone SoilAPVSVERDRAWEAFKRDKKSTGGELKLVLLGDEGGFMTSVAETDVRRALQDLIAD*
Ga0137380_1037942433300012206Vadose Zone SoilRVRVDRERAWDALLRDKKGKLRLALLGEDGGFVTEVPETDVHRALDELIAD*
Ga0137381_1042484633300012207Vadose Zone SoilALKRDKKSTGGELTLVLLGDEGGFTTKVPEADVRRSLDELIAD*
Ga0137376_1029965313300012208Vadose Zone SoilKRDKKSTRDALTLVLVGDEGGFTTNMPEADVRRALDELIAD*
Ga0137379_1175822813300012209Vadose Zone SoilDKKGPLSLILLGDDGAFELSVPEADARAALDELIAG*
Ga0137378_1178809913300012210Vadose Zone SoilRAWDALLRDKKGPLSLILIGDDGAFEDTLPESDVRGALNELIAG*
Ga0150985_10566138613300012212Avena Fatua RhizosphereRDKKGRMRIVLLGDDGGRVTELPEADVRAALDSLIAR*
Ga0150985_11522757933300012212Avena Fatua RhizosphereRERAWQALLRDKKGAIRIVLLGDDGARGEEVPEDLARRELDRLIA*
Ga0137367_1038148913300012353Vadose Zone SoilDRERAWQALLRDKKGKLNVVLLGDDGAFVTEVPAHDARRALDELIAS*
Ga0137366_1001315383300012354Vadose Zone SoilVEAVLAPEPVKVDRDRAREALQRDKKSTGGELTLVLLGDEGGFTVNVPETDVRRALDELIAD*
Ga0137369_1045323513300012355Vadose Zone SoilKGPLRVILLGDDGGYETQLPEPDVRAALDELIAG*
Ga0137371_1043210133300012356Vadose Zone SoilVKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD*
Ga0157285_1035906513300012897SoilALQRDKKGPMRIVLLDDDGGRVTELPEADVRAALDSLIAR*
Ga0126369_1207177313300012971Tropical Forest SoilRAWQALLRDKKGRLRIVLLGDDGPHEEELPGTDVRAALNELISG*
Ga0134110_1046935423300012975Grasslands SoilAWEALKRDKKSTGGELTLVLLGDEGGFATTVPEADVRRALDELIAD*
Ga0164307_1145404123300012987SoilDRAWQALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD*
Ga0164305_1018242833300012989SoilDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD*
Ga0120179_101121713300013763PermafrostAWNALLRDKKGPLSLILLGDDGAFEESVPAEDVRAALNELIAR*
Ga0134078_1026806613300014157Grasslands SoilDRDRAWDALLRDKKGALNLVLLGDEGGYVTSVPKREVKRALDELIAD*
Ga0134079_1048101413300014166Grasslands SoilTGGEVTLVLLGDEGGYTAPAPADDVRRALDELIAE*
Ga0157380_1203842633300014326Switchgrass RhizosphereALLRDKKGRLRIVLLGDDGAFEQELPEADVRTALDALISG*
Ga0157376_1299375023300014969Miscanthus RhizosphereVRVDRDRAWEALLRDKKGKLRLVLLGDDGGYVTEVPEADVKRALDELIAD*
Ga0173483_1052139913300015077SoilKGRLRIVLLGDEGAVEEELPEADVRAALDALIAG*
Ga0134074_137056923300017657Grasslands SoilEAVLAPEPVKVDRDRAREALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIA
Ga0163161_1040999933300017792Switchgrass RhizosphereDKKGRLRIVLLDDDGAHEEELPEADVRAALDELIAE
Ga0187779_1094132913300017959Tropical PeatlandRAWEALLRDKKGRLRIVLLGDQGAEERELPEADVRAALDALIAQ
Ga0184605_1002308953300018027Groundwater SedimentDRAWETLQRDKKSTGGELILVLLGDEGGFTANVPETDVRRALDELIAD
Ga0184605_1011446913300018027Groundwater SedimentDALQRDKKGRFRLILLGDEGGFEADVPEPDVRAALDGLIAG
Ga0066667_1038127013300018433Grasslands SoilALLRDKKSTGGAVTLVLLGAEGGYTAEVPAGDVRRALDELIAA
Ga0066669_1090864413300018482Grasslands SoilAWDALLRDKKGALNLVLLGDEGGYVTSVPEREVKRALDELIAD
Ga0193701_102762613300019875SoilRAWDALLRDKKGALNLVLLGEDGGFVTAVPEVDVRRALDELIAD
Ga0193729_116659613300019887SoilVEVDRDRAWEALKRDKKSTRGELTLVLLGDEGGYTTTVPEADVRRALDELIAD
Ga0210382_1024830633300021080Groundwater SedimentDKKSTRGELTLVLLGDEGGYTTTVPEADVRRALDELIAD
Ga0210382_1025350933300021080Groundwater SedimentVKVDRDRAWETLQRDKKSTGGELILVLLGDEGGFTANVPETDVRRALDELIAD
Ga0126371_1227260233300021560Tropical Forest SoilTRGVLRFVLLGDTGAYTAQVPEADARRALDELIAE
Ga0247790_1002879233300022915SoilRDKKGALNLVLLGEEGGYVTAVPENDVRSALNELIAD
Ga0207642_1114437423300025899Miscanthus RhizosphereRVDRDRAWEALLRDKKGALTLVLLGDDGGFVTQVPEADVKRALDELIAD
Ga0207657_1136120913300025919Corn RhizosphereQPVEVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFRAKVPELDVRRALDELIAD
Ga0207687_1016659233300025927Miscanthus RhizosphereDRERAWEALLRDKKGRLRIVLLDDDGAREEELLEADVRAALDELIAE
Ga0207686_1145615413300025934Miscanthus RhizosphereRERAWEALLRDKKGRLRIVLLDDDGAREEELPEADVRAALDELIAE
Ga0207670_1039851213300025936Switchgrass RhizosphereRDKKGALNLVLLGDEGGFVTQVPEADVKRALDELIAD
Ga0207683_1118468313300026121Miscanthus RhizosphereLIDRERAWDALLRDKKGALNLVLLGDEGGYVTAVPENDVRSALNELIAD
Ga0207698_1116751733300026142Corn RhizosphereWEALLRDKKGRLRIVLLGEDGAGEQELPEAEVRAALDALISG
Ga0209468_110221333300026306SoilDRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD
Ga0209472_108661033300026323SoilDKKATQGELRLVLLGDEGGFTTAVAEADARRALDELIAE
Ga0209473_120749813300026330SoilSTGGGLTLVLLGDEGGFATNVPEADVRRALDELIAD
Ga0209159_120712313300026343SoilTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD
Ga0209378_113700733300026528SoilPVKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAG
Ga0207483_10178633300026750SoilRAWEALQRDKKSTGGELTLVLLGDEGGVAAKVPETDVRRALDELIAD
Ga0268266_1198328913300028379Switchgrass RhizosphereWEALLRDKKGRLRIVLLGDDGAFEQELPEADVRTALDALISG
Ga0307276_1021516613300028705SoilRDKKSTGGELTVVLLGEEGGFTTSVGEADVRRALDELIAD
Ga0307311_1018254013300028716SoilLAPQPVKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTAKVPELDVRRALDELIAD
Ga0307297_1009042313300028754SoilALLRDKKGALNLVLLGEDGGFVTAVPEVDVRRALDELIAD
Ga0307288_1002832243300028778SoilRERAWEALQRDKKGPLRVILLGDDGGFETQLPERDVRAALDELIAG
Ga0307288_1030462613300028778SoilTGDQLTLVLLGDEGPLTAPVPEADVRRALDSLVAD
Ga0307282_1053058313300028784SoilEEVLTPQPAKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTAKMPEPDVRRALDELIA
Ga0307292_1036706113300028811SoilEALQRDKKGPLRVILVGDEGGFETELPERDVRAALDALIAR
Ga0307312_1037888813300028828SoilKRDKKSTRGELTLVLLGDEGGYTTTVPEADVRRALDELIAD
Ga0307277_1002424313300028881SoilRDKKFVAGQPTVVLLGDEGGYTTNVPEADVRRALDELIAD
Ga0247826_1060504533300030336SoilKKGRLRIVLLDDDGAREEELPEADVRGALDALIAE
Ga0307499_1007243213300031184SoilWDALLRDKKGAFNLVLLGEDGGFVTAVPEVDVRRALDELIAD
Ga0318516_1087952423300031543SoilQALLRDKKGRLRVILLGDDGGFETELPEQDVRSALDELIAG
Ga0318534_1088593913300031544SoilDRERAWQALQRDKKGPMRLILIGDDGGYEQELPPDDVRAALDSLIGR
Ga0307473_1112977323300031820Hardwood Forest SoilDRERAWEALQRDKKGPLRVILLGEDGGFETELPAQDVRKALDELIAR
Ga0318517_1012503033300031835SoilAWQALQRDKKGPMRLILIGDDGGYEQELPPDDVRAALDSLIGR
Ga0318531_1053101213300031981SoilALLRDKKGRLRVILLGDDGGFETELPEQDVRSALDELIAG
Ga0307409_10088907813300031995RhizosphereRVDRERAWEALLRDKKGALNLVLLRADGAFVGEQPASDVRRALDELVAE
Ga0310906_1092832523300032013SoilVDRDRAWDALLRDKKGRLRIVLLGDDGAGEQELPEAEVRAALDALISG
Ga0247830_1119209223300033551SoilWEALQRDKKSTGGELTLVLLGDEGGFRAKVPELDVRRALDELIAD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.