| Basic Information | |
|---|---|
| Family ID | F062868 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RAWDALLRDKKGRLRLVLLGDDGGYVTEVPEADVRRALDELIAD |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.77 % |
| % of genes near scaffold ends (potentially truncated) | 99.23 % |
| % of genes from short scaffolds (< 2000 bps) | 95.38 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.385 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.231 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.17% β-sheet: 16.67% Coil/Unstructured: 54.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF01220 | DHquinase_II | 68.46 |
| PF01321 | Creatinase_N | 26.15 |
| PF09285 | Elong-fact-P_C | 3.08 |
| PF01381 | HTH_3 | 0.77 |
| PF00557 | Peptidase_M24 | 0.77 |
| PF01761 | DHQ_synthase | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 68.46 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 26.15 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.38 % |
| Unclassified | root | N/A | 4.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090006|LWSO2_GGWJX9X02F4LF8 | Not Available | 509 | Open in IMG/M |
| 3300000955|JGI1027J12803_107267906 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300001538|A10PFW1_12081910 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300003203|JGI25406J46586_10169888 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005093|Ga0062594_100157762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1501 | Open in IMG/M |
| 3300005159|Ga0066808_1029481 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005179|Ga0066684_10245151 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300005187|Ga0066675_10043497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2723 | Open in IMG/M |
| 3300005332|Ga0066388_104001441 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005439|Ga0070711_102005366 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005454|Ga0066687_10362901 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005468|Ga0070707_100763169 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300005535|Ga0070684_100361944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1335 | Open in IMG/M |
| 3300005544|Ga0070686_100739937 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005548|Ga0070665_102432174 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005552|Ga0066701_10478636 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005560|Ga0066670_10152834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1350 | Open in IMG/M |
| 3300005566|Ga0066693_10497802 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005598|Ga0066706_10885240 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005598|Ga0066706_11072910 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005617|Ga0068859_102662148 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005617|Ga0068859_103170464 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005713|Ga0066905_101130871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300005719|Ga0068861_100967311 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300006237|Ga0097621_100289808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter | 1443 | Open in IMG/M |
| 3300006578|Ga0074059_12172192 | Not Available | 500 | Open in IMG/M |
| 3300006581|Ga0074048_13276416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300006791|Ga0066653_10203132 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300006797|Ga0066659_10126398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1782 | Open in IMG/M |
| 3300006914|Ga0075436_100440031 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300006953|Ga0074063_10011183 | Not Available | 508 | Open in IMG/M |
| 3300007076|Ga0075435_101652776 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300009012|Ga0066710_103121105 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300009100|Ga0075418_10616515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1168 | Open in IMG/M |
| 3300009137|Ga0066709_104691655 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009147|Ga0114129_10882942 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300009148|Ga0105243_12706689 | Not Available | 536 | Open in IMG/M |
| 3300009545|Ga0105237_11052789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300009551|Ga0105238_12805209 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009789|Ga0126307_10516763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
| 3300010036|Ga0126305_10197942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1273 | Open in IMG/M |
| 3300010038|Ga0126315_10195377 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300010040|Ga0126308_10350669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
| 3300010040|Ga0126308_10625715 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010045|Ga0126311_10612121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
| 3300010301|Ga0134070_10021457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2105 | Open in IMG/M |
| 3300010333|Ga0134080_10111357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1134 | Open in IMG/M |
| 3300010336|Ga0134071_10806174 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010359|Ga0126376_12763698 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010373|Ga0134128_11700291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter | 694 | Open in IMG/M |
| 3300010375|Ga0105239_10643828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1210 | Open in IMG/M |
| 3300010375|Ga0105239_11159740 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300010375|Ga0105239_12397374 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010375|Ga0105239_13057186 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010375|Ga0105239_13241784 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010396|Ga0134126_12760937 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300011003|Ga0138514_100036648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 950 | Open in IMG/M |
| 3300011119|Ga0105246_10199998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1553 | Open in IMG/M |
| 3300011269|Ga0137392_10342730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1237 | Open in IMG/M |
| 3300012004|Ga0120134_1071364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 626 | Open in IMG/M |
| 3300012199|Ga0137383_11249473 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012200|Ga0137382_10307480 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300012206|Ga0137380_10379424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 1258 | Open in IMG/M |
| 3300012207|Ga0137381_10424846 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300012208|Ga0137376_10299653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1395 | Open in IMG/M |
| 3300012209|Ga0137379_11758228 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012210|Ga0137378_11788099 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012212|Ga0150985_105661386 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012212|Ga0150985_115227579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1124 | Open in IMG/M |
| 3300012353|Ga0137367_10381489 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300012354|Ga0137366_10013153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6497 | Open in IMG/M |
| 3300012355|Ga0137369_10453235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300012356|Ga0137371_10432101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1020 | Open in IMG/M |
| 3300012897|Ga0157285_10359065 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012971|Ga0126369_12071773 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012975|Ga0134110_10469354 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012987|Ga0164307_11454041 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012989|Ga0164305_10182428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1458 | Open in IMG/M |
| 3300013763|Ga0120179_1011217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2310 | Open in IMG/M |
| 3300014157|Ga0134078_10268066 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300014166|Ga0134079_10481014 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300014326|Ga0157380_12038426 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300014969|Ga0157376_12993750 | Not Available | 511 | Open in IMG/M |
| 3300015077|Ga0173483_10521399 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300017657|Ga0134074_1370569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 531 | Open in IMG/M |
| 3300017792|Ga0163161_10409999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
| 3300017959|Ga0187779_10941329 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300018027|Ga0184605_10023089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2516 | Open in IMG/M |
| 3300018027|Ga0184605_10114469 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300018433|Ga0066667_10381270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1133 | Open in IMG/M |
| 3300018482|Ga0066669_10908644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300019875|Ga0193701_1027626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1164 | Open in IMG/M |
| 3300019887|Ga0193729_1166596 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300021080|Ga0210382_10248306 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300021080|Ga0210382_10253509 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300021560|Ga0126371_12272602 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300022915|Ga0247790_10028792 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300025899|Ga0207642_11144374 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300025919|Ga0207657_11361209 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300025927|Ga0207687_10166592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1696 | Open in IMG/M |
| 3300025934|Ga0207686_11456154 | Not Available | 564 | Open in IMG/M |
| 3300025936|Ga0207670_10398512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1100 | Open in IMG/M |
| 3300026121|Ga0207683_11184683 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300026142|Ga0207698_11167517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
| 3300026306|Ga0209468_1102213 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300026323|Ga0209472_1086610 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300026330|Ga0209473_1207498 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300026343|Ga0209159_1207123 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300026528|Ga0209378_1137007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300026750|Ga0207483_101786 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300028379|Ga0268266_11983289 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300028705|Ga0307276_10215166 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300028716|Ga0307311_10182540 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300028754|Ga0307297_10090423 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300028778|Ga0307288_10028322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1837 | Open in IMG/M |
| 3300028778|Ga0307288_10304626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 634 | Open in IMG/M |
| 3300028784|Ga0307282_10530583 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300028811|Ga0307292_10367061 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300028828|Ga0307312_10378888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 927 | Open in IMG/M |
| 3300028881|Ga0307277_10024243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2391 | Open in IMG/M |
| 3300030336|Ga0247826_10605045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| 3300031184|Ga0307499_10072432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 892 | Open in IMG/M |
| 3300031543|Ga0318516_10879524 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031544|Ga0318534_10885939 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031820|Ga0307473_11129773 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031835|Ga0318517_10125030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1140 | Open in IMG/M |
| 3300031981|Ga0318531_10531012 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031995|Ga0307409_100889078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
| 3300032013|Ga0310906_10928325 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300033551|Ga0247830_11192092 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.38% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.31% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.31% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater Sediment | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.77% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.77% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.77% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090006 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 2 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026750 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWSO2_08328620 | 2088090006 | Freshwater Sediment | VHVSRERAWEALLRDKKGRLRIVLLGPDGAHEEELPEPDVRAALDALIAE |
| JGI1027J12803_1072679062 | 3300000955 | Soil | AWEALLRDKKGRLRIVLLDGERELTEADVRAALDDLIAG* |
| A10PFW1_120819102 | 3300001538 | Permafrost | AELHPEPVRVDADRAWDALLRDKKGPLSLILIGDDGAFEDTLPEADVRGALNELIAR* |
| JGI25406J46586_101698881 | 3300003203 | Tabebuia Heterophylla Rhizosphere | APERVRVDPEVAWQALLRDKKGHLRVILLGDEGAYETDLPERDVRRALDELIAE* |
| Ga0062594_1001577623 | 3300005093 | Soil | AWEALLRDKKGALNLVLLGDDGGFVTQVPEADVKRALDELIAD* |
| Ga0066808_10294812 | 3300005159 | Soil | VDRDRAWNALLLDKKGALNLVLLADDGGYVTQVPEADVKRALDELIAD* |
| Ga0066684_102451511 | 3300005179 | Soil | ERAWEALKRDKKSTGGELTLVLLGDEGGFATNVPEADVRRALDELIAD* |
| Ga0066675_100434971 | 3300005187 | Soil | AWQALERDKKSTGGELTLVLLGGEGGFTTKVPATDVRSALDDLIAN* |
| Ga0066388_1040014413 | 3300005332 | Tropical Forest Soil | LQRDKKGPMRLILLGDEGGFETEMPPDEVRAALDSLIAR* |
| Ga0070711_1020053662 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRERAWEALLRDKKGRLRIVLLDDDGPREEELPEADVRAALDQLIAE* |
| Ga0066687_103629011 | 3300005454 | Soil | QRARVDPDRAWQALLRDKKGRLRIVLLGDDGAFETELPESDVRAALAELIER* |
| Ga0070707_1007631691 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ALQRDKKGRMRVILLGDEGGYEAELPEADVQAALDELIAG* |
| Ga0070684_1003619441 | 3300005535 | Corn Rhizosphere | DRERAWEALLRDKKGRLRIVLLDDDGPREEELPEADVRAALDQLIAE* |
| Ga0070686_1007399371 | 3300005544 | Switchgrass Rhizosphere | DRAWEALQRDKKGPLRVILLGDDGGFETKLPERDVRAALDELIAG* |
| Ga0070665_1024321742 | 3300005548 | Switchgrass Rhizosphere | QRDKKGRMRIVLLDDDGGRVTELPEADVRAALDSLIAR* |
| Ga0066701_104786363 | 3300005552 | Soil | RPRPIPVDAELAWQTLLRDKKGPMKLILLGDEGAFETTVPPTEVRRALDELIA* |
| Ga0066670_101528343 | 3300005560 | Soil | RDRAWAALRRDKKSTGGELTLVLLGDEGGFTTNVRDEDVRRALDELIAD* |
| Ga0066693_104978021 | 3300005566 | Soil | WEAFKRDKKSTGGELTLVLLGDEGGFTTSVAENDVRRALHELIAD* |
| Ga0066706_108852401 | 3300005598 | Soil | LGPQPVKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD* |
| Ga0066706_110729102 | 3300005598 | Soil | LRPRPIPVDAELAWQTLLRDKKGPMKLILLGDEGAFETTVPPTEVRRALDELIA* |
| Ga0068859_1026621481 | 3300005617 | Switchgrass Rhizosphere | KKGRMRIVLLDDDGGRVTELPEADVRAALDSLIAR* |
| Ga0068859_1031704642 | 3300005617 | Switchgrass Rhizosphere | DRERAWEALLRDKKGRLRIVLLDDDGAREEELPEADVRAALDELIAE* |
| Ga0066905_1011308711 | 3300005713 | Tropical Forest Soil | RAWDALLRDKKGALNLVLLGDDGGYVTQVPEGDVKRALGELISD* |
| Ga0068861_1009673113 | 3300005719 | Switchgrass Rhizosphere | KSTGGKLTLVLLGDEGGFRAKVPELDVRRALDELIAD* |
| Ga0097621_1002898083 | 3300006237 | Miscanthus Rhizosphere | KGRLRIVLLGDDGAFEQELPEADVRTALDALISG* |
| Ga0074059_121721922 | 3300006578 | Soil | RAWDALLRDKKGALNLVLLGDDGGYVTQVPEADVKRALDELIAD* |
| Ga0074048_132764161 | 3300006581 | Soil | AWEALLRDKKGRLRIVLLDDDGAREEELPEADVRGALDELIAE* |
| Ga0066653_102031321 | 3300006791 | Soil | KATHGELRLVLLGDEGGFTTAVEKADARRALDELIAE* |
| Ga0066659_101263984 | 3300006797 | Soil | TGGELTLVLLGDEGGFATTVPEADVRRALDELIAD* |
| Ga0075436_1004400311 | 3300006914 | Populus Rhizosphere | LRDKKGRLRLVLLGEEGGFVTEVPEADVKRALDELIAD* |
| Ga0074063_100111831 | 3300006953 | Soil | WDALLHDKKGRLRLVLLGDDGGYVTEVPEPDVRRALDELIAD* |
| Ga0075435_1016527762 | 3300007076 | Populus Rhizosphere | RAWDALLRDKKGRLRLVLLGDDGGYVTEVPEADVRRALDELIAD* |
| Ga0066710_1031211051 | 3300009012 | Grasslands Soil | RAWQALLRDKKGPLSLILLGDDGAFETEVPQDDVRRALDELIA |
| Ga0075418_106165151 | 3300009100 | Populus Rhizosphere | REAAWQALLRDKKGRMRVILLGDDGAFETELDERDVRRALDELIAE* |
| Ga0066709_1046916552 | 3300009137 | Grasslands Soil | LLRDKKGRLRIVLLGDEGPREEELPEADVRAALDALISG* |
| Ga0114129_108829421 | 3300009147 | Populus Rhizosphere | KGALNLVLLGDDGGFVTEMPEADVRCALDELIAD* |
| Ga0105243_127066892 | 3300009148 | Miscanthus Rhizosphere | HDKKGRLRLVLLADEGGYVTEVPEADVKRALEELIAD* |
| Ga0105237_110527891 | 3300009545 | Corn Rhizosphere | RDKKGALNLVLLGDEGGFVTQLPEADVRRALDELIAD* |
| Ga0105238_128052092 | 3300009551 | Corn Rhizosphere | ERERAWEALLRDKKGRLRIVLLGDDGAFEQELPEADVRTALDALISG* |
| Ga0126307_105167631 | 3300009789 | Serpentine Soil | RDRAWEALLRDKKGALNLVLLGDDGGYVTHVPETDVKRALNELIAD* |
| Ga0126305_101979423 | 3300010036 | Serpentine Soil | RAWEALLRDKKGPLNVVLLGDEGPFVTELPAADVRRALDELVDG* |
| Ga0126315_101953771 | 3300010038 | Serpentine Soil | ERAWEALQRDKKGRLRVILVGDDGGFETDLPERDVRGALDELIAG* |
| Ga0126308_103506693 | 3300010040 | Serpentine Soil | KGPLRVILLGDEGGFETELPERDVRRALDELIAG* |
| Ga0126308_106257151 | 3300010040 | Serpentine Soil | DRERAWQALLRDKKGPLNVVLLGDDGAFVTELPAQDVKRALDGLVDG* |
| Ga0126311_106121213 | 3300010045 | Serpentine Soil | EALLRDKKGALNLVLLRADGAFVGEQPASDVRRALDELVAE* |
| Ga0134070_100214574 | 3300010301 | Grasslands Soil | LLRDKKGALNLVLLGDEGGYVTSVPEREVKRALDELIAD* |
| Ga0134080_101113573 | 3300010333 | Grasslands Soil | LSGRPTDAVEAVLAPQPVKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD* |
| Ga0134071_108061741 | 3300010336 | Grasslands Soil | DKKGRLRLVLLGDDGGFVTDVPEADVKRALDELIAD* |
| Ga0126376_127636982 | 3300010359 | Tropical Forest Soil | QRDKKGPMRLILLGDDGGYEQELPPDEVRAALDSLIAR* |
| Ga0134128_117002911 | 3300010373 | Terrestrial Soil | KKGALNLVLLGDDGGFVTQVPEADVKRALDELIAD* |
| Ga0105239_106438281 | 3300010375 | Corn Rhizosphere | ALQRDKKSTGGELTLVLLGDEGGFAANVPETDVRRALDELIAD* |
| Ga0105239_111597401 | 3300010375 | Corn Rhizosphere | EQDHAERALQRDKKGPLRVILLGDDGGFETKLPERDVRAALDELIAG* |
| Ga0105239_123973741 | 3300010375 | Corn Rhizosphere | ERAWDALRRDKKGPLRLILLGEDGAFERELPERDVRAALDELIEG* |
| Ga0105239_130571861 | 3300010375 | Corn Rhizosphere | RERAWEALQRDKKGRMRIVLLDDAGGRVTELPEADVRAALDSLIAR* |
| Ga0105239_132417842 | 3300010375 | Corn Rhizosphere | ERAWEALLRDKKGRLRIVLLGDDGAFEQELPEADVRTALDALISG* |
| Ga0134126_127609372 | 3300010396 | Terrestrial Soil | AWEALQRDKKSTGGELTLVLLGDEGGFRAKVPELDVRRALDELIAD* |
| Ga0138514_1000366483 | 3300011003 | Soil | LERDKKSTGGELTLVLLGDEGGFTTSVPETDVRRALDELIAD* |
| Ga0105246_101999981 | 3300011119 | Miscanthus Rhizosphere | VLIDRERAWDALLRDKKGALNLVLLGDEGGYVTAVPENDVRSALNELIAD* |
| Ga0137392_103427303 | 3300011269 | Vadose Zone Soil | LRDKKGPLSLILLGGDGAFETEVPQADVRAALDALIAG* |
| Ga0120134_10713641 | 3300012004 | Permafrost | RQVLRLIAVVVEETLAPKSVEVDRDRAWEALKRDKKSTRGELTLVLLGDEGGYTTNVPEADVRRALDELIAD* |
| Ga0137383_112494731 | 3300012199 | Vadose Zone Soil | ALLRDKKGPLSLILLGDDGAFELSVPEADARAALDELIAG* |
| Ga0137382_103074801 | 3300012200 | Vadose Zone Soil | APVSVERDRAWEAFKRDKKSTGGELKLVLLGDEGGFMTSVAETDVRRALQDLIAD* |
| Ga0137380_103794243 | 3300012206 | Vadose Zone Soil | RVRVDRERAWDALLRDKKGKLRLALLGEDGGFVTEVPETDVHRALDELIAD* |
| Ga0137381_104248463 | 3300012207 | Vadose Zone Soil | ALKRDKKSTGGELTLVLLGDEGGFTTKVPEADVRRSLDELIAD* |
| Ga0137376_102996531 | 3300012208 | Vadose Zone Soil | KRDKKSTRDALTLVLVGDEGGFTTNMPEADVRRALDELIAD* |
| Ga0137379_117582281 | 3300012209 | Vadose Zone Soil | DKKGPLSLILLGDDGAFELSVPEADARAALDELIAG* |
| Ga0137378_117880991 | 3300012210 | Vadose Zone Soil | RAWDALLRDKKGPLSLILIGDDGAFEDTLPESDVRGALNELIAG* |
| Ga0150985_1056613861 | 3300012212 | Avena Fatua Rhizosphere | RDKKGRMRIVLLGDDGGRVTELPEADVRAALDSLIAR* |
| Ga0150985_1152275793 | 3300012212 | Avena Fatua Rhizosphere | RERAWQALLRDKKGAIRIVLLGDDGARGEEVPEDLARRELDRLIA* |
| Ga0137367_103814891 | 3300012353 | Vadose Zone Soil | DRERAWQALLRDKKGKLNVVLLGDDGAFVTEVPAHDARRALDELIAS* |
| Ga0137366_100131538 | 3300012354 | Vadose Zone Soil | VEAVLAPEPVKVDRDRAREALQRDKKSTGGELTLVLLGDEGGFTVNVPETDVRRALDELIAD* |
| Ga0137369_104532351 | 3300012355 | Vadose Zone Soil | KGPLRVILLGDDGGYETQLPEPDVRAALDELIAG* |
| Ga0137371_104321013 | 3300012356 | Vadose Zone Soil | VKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD* |
| Ga0157285_103590651 | 3300012897 | Soil | ALQRDKKGPMRIVLLDDDGGRVTELPEADVRAALDSLIAR* |
| Ga0126369_120717731 | 3300012971 | Tropical Forest Soil | RAWQALLRDKKGRLRIVLLGDDGPHEEELPGTDVRAALNELISG* |
| Ga0134110_104693542 | 3300012975 | Grasslands Soil | AWEALKRDKKSTGGELTLVLLGDEGGFATTVPEADVRRALDELIAD* |
| Ga0164307_114540412 | 3300012987 | Soil | DRAWQALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD* |
| Ga0164305_101824283 | 3300012989 | Soil | DKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD* |
| Ga0120179_10112171 | 3300013763 | Permafrost | AWNALLRDKKGPLSLILLGDDGAFEESVPAEDVRAALNELIAR* |
| Ga0134078_102680661 | 3300014157 | Grasslands Soil | DRDRAWDALLRDKKGALNLVLLGDEGGYVTSVPKREVKRALDELIAD* |
| Ga0134079_104810141 | 3300014166 | Grasslands Soil | TGGEVTLVLLGDEGGYTAPAPADDVRRALDELIAE* |
| Ga0157380_120384263 | 3300014326 | Switchgrass Rhizosphere | ALLRDKKGRLRIVLLGDDGAFEQELPEADVRTALDALISG* |
| Ga0157376_129937502 | 3300014969 | Miscanthus Rhizosphere | VRVDRDRAWEALLRDKKGKLRLVLLGDDGGYVTEVPEADVKRALDELIAD* |
| Ga0173483_105213991 | 3300015077 | Soil | KGRLRIVLLGDEGAVEEELPEADVRAALDALIAG* |
| Ga0134074_13705692 | 3300017657 | Grasslands Soil | EAVLAPEPVKVDRDRAREALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIA |
| Ga0163161_104099993 | 3300017792 | Switchgrass Rhizosphere | DKKGRLRIVLLDDDGAHEEELPEADVRAALDELIAE |
| Ga0187779_109413291 | 3300017959 | Tropical Peatland | RAWEALLRDKKGRLRIVLLGDQGAEERELPEADVRAALDALIAQ |
| Ga0184605_100230895 | 3300018027 | Groundwater Sediment | DRAWETLQRDKKSTGGELILVLLGDEGGFTANVPETDVRRALDELIAD |
| Ga0184605_101144691 | 3300018027 | Groundwater Sediment | DALQRDKKGRFRLILLGDEGGFEADVPEPDVRAALDGLIAG |
| Ga0066667_103812701 | 3300018433 | Grasslands Soil | ALLRDKKSTGGAVTLVLLGAEGGYTAEVPAGDVRRALDELIAA |
| Ga0066669_109086441 | 3300018482 | Grasslands Soil | AWDALLRDKKGALNLVLLGDEGGYVTSVPEREVKRALDELIAD |
| Ga0193701_10276261 | 3300019875 | Soil | RAWDALLRDKKGALNLVLLGEDGGFVTAVPEVDVRRALDELIAD |
| Ga0193729_11665961 | 3300019887 | Soil | VEVDRDRAWEALKRDKKSTRGELTLVLLGDEGGYTTTVPEADVRRALDELIAD |
| Ga0210382_102483063 | 3300021080 | Groundwater Sediment | DKKSTRGELTLVLLGDEGGYTTTVPEADVRRALDELIAD |
| Ga0210382_102535093 | 3300021080 | Groundwater Sediment | VKVDRDRAWETLQRDKKSTGGELILVLLGDEGGFTANVPETDVRRALDELIAD |
| Ga0126371_122726023 | 3300021560 | Tropical Forest Soil | TRGVLRFVLLGDTGAYTAQVPEADARRALDELIAE |
| Ga0247790_100287923 | 3300022915 | Soil | RDKKGALNLVLLGEEGGYVTAVPENDVRSALNELIAD |
| Ga0207642_111443742 | 3300025899 | Miscanthus Rhizosphere | RVDRDRAWEALLRDKKGALTLVLLGDDGGFVTQVPEADVKRALDELIAD |
| Ga0207657_113612091 | 3300025919 | Corn Rhizosphere | QPVEVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFRAKVPELDVRRALDELIAD |
| Ga0207687_101665923 | 3300025927 | Miscanthus Rhizosphere | DRERAWEALLRDKKGRLRIVLLDDDGAREEELLEADVRAALDELIAE |
| Ga0207686_114561541 | 3300025934 | Miscanthus Rhizosphere | RERAWEALLRDKKGRLRIVLLDDDGAREEELPEADVRAALDELIAE |
| Ga0207670_103985121 | 3300025936 | Switchgrass Rhizosphere | RDKKGALNLVLLGDEGGFVTQVPEADVKRALDELIAD |
| Ga0207683_111846831 | 3300026121 | Miscanthus Rhizosphere | LIDRERAWDALLRDKKGALNLVLLGDEGGYVTAVPENDVRSALNELIAD |
| Ga0207698_111675173 | 3300026142 | Corn Rhizosphere | WEALLRDKKGRLRIVLLGEDGAGEQELPEAEVRAALDALISG |
| Ga0209468_11022133 | 3300026306 | Soil | DRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAD |
| Ga0209472_10866103 | 3300026323 | Soil | DKKATQGELRLVLLGDEGGFTTAVAEADARRALDELIAE |
| Ga0209473_12074981 | 3300026330 | Soil | STGGGLTLVLLGDEGGFATNVPEADVRRALDELIAD |
| Ga0209159_12071231 | 3300026343 | Soil | TGGELTLVLLGDEGGFTANVPETDVRRALDELIAD |
| Ga0209378_11370073 | 3300026528 | Soil | PVKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTANVPETDVRRALDELIAG |
| Ga0207483_1017863 | 3300026750 | Soil | RAWEALQRDKKSTGGELTLVLLGDEGGVAAKVPETDVRRALDELIAD |
| Ga0268266_119832891 | 3300028379 | Switchgrass Rhizosphere | WEALLRDKKGRLRIVLLGDDGAFEQELPEADVRTALDALISG |
| Ga0307276_102151661 | 3300028705 | Soil | RDKKSTGGELTVVLLGEEGGFTTSVGEADVRRALDELIAD |
| Ga0307311_101825401 | 3300028716 | Soil | LAPQPVKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTAKVPELDVRRALDELIAD |
| Ga0307297_100904231 | 3300028754 | Soil | ALLRDKKGALNLVLLGEDGGFVTAVPEVDVRRALDELIAD |
| Ga0307288_100283224 | 3300028778 | Soil | RERAWEALQRDKKGPLRVILLGDDGGFETQLPERDVRAALDELIAG |
| Ga0307288_103046261 | 3300028778 | Soil | TGDQLTLVLLGDEGPLTAPVPEADVRRALDSLVAD |
| Ga0307282_105305831 | 3300028784 | Soil | EEVLTPQPAKVDRDRAWEALQRDKKSTGGELTLVLLGDEGGFTAKMPEPDVRRALDELIA |
| Ga0307292_103670611 | 3300028811 | Soil | EALQRDKKGPLRVILVGDEGGFETELPERDVRAALDALIAR |
| Ga0307312_103788881 | 3300028828 | Soil | KRDKKSTRGELTLVLLGDEGGYTTTVPEADVRRALDELIAD |
| Ga0307277_100242431 | 3300028881 | Soil | RDKKFVAGQPTVVLLGDEGGYTTNVPEADVRRALDELIAD |
| Ga0247826_106050453 | 3300030336 | Soil | KKGRLRIVLLDDDGAREEELPEADVRGALDALIAE |
| Ga0307499_100724321 | 3300031184 | Soil | WDALLRDKKGAFNLVLLGEDGGFVTAVPEVDVRRALDELIAD |
| Ga0318516_108795242 | 3300031543 | Soil | QALLRDKKGRLRVILLGDDGGFETELPEQDVRSALDELIAG |
| Ga0318534_108859391 | 3300031544 | Soil | DRERAWQALQRDKKGPMRLILIGDDGGYEQELPPDDVRAALDSLIGR |
| Ga0307473_111297732 | 3300031820 | Hardwood Forest Soil | DRERAWEALQRDKKGPLRVILLGEDGGFETELPAQDVRKALDELIAR |
| Ga0318517_101250303 | 3300031835 | Soil | AWQALQRDKKGPMRLILIGDDGGYEQELPPDDVRAALDSLIGR |
| Ga0318531_105310121 | 3300031981 | Soil | ALLRDKKGRLRVILLGDDGGFETELPEQDVRSALDELIAG |
| Ga0307409_1008890781 | 3300031995 | Rhizosphere | RVDRERAWEALLRDKKGALNLVLLRADGAFVGEQPASDVRRALDELVAE |
| Ga0310906_109283252 | 3300032013 | Soil | VDRDRAWDALLRDKKGRLRIVLLGDDGAGEQELPEAEVRAALDALISG |
| Ga0247830_111920922 | 3300033551 | Soil | WEALQRDKKSTGGELTLVLLGDEGGFRAKVPELDVRRALDELIAD |
| ⦗Top⦘ |