Metagenome / Metatranscriptome Family F062850

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F062850
Family Type	Metagenome / Metatranscriptome
Number of Sequences	130
Average Sequence Length	39 residues
Representative Sequence	MDKKEIESPKLTANFLIWISAFMLLLFALIAHFVWKVF
Number of Associated Samples	109
Number of Associated Scaffolds	130

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	63.08 %
% of genes near scaffold ends (potentially truncated)	21.54 %
% of genes from short scaffolds (< 2000 bps)	74.62 %
Associated GOLD sequencing projects	103
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (62.308 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (10.769 % of family members)
Environment Ontology (ENVO)	Unclassified (33.846 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (41.538 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.94% β-sheet: 0.00% Coil/Unstructured: 56.06%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 130 Family Scaffolds
PF00924	MS_channel	4.62
PF09900	DUF2127	3.08
PF00575	S1	3.08
PF01865	PhoU_div	2.31
PF13226	DUF4034	1.54
PF00005	ABC_tran	1.54
PF10129	OpgC_C	1.54
PF11645	PDDEXK_5	1.54
PF00275	EPSP_synthase	1.54
PF14417	MEDS	1.54
PF01979	Amidohydro_1	1.54
PF00072	Response_reg	1.54
PF10727	Rossmann-like	0.77
PF01039	Carboxyl_trans	0.77
PF10091	Glycoamylase	0.77
PF13657	Couple_hipA	0.77
PF00762	Ferrochelatase	0.77
PF04909	Amidohydro_2	0.77
PF14716	HHH_8	0.77
PF11345	DUF3147	0.77
PF01726	LexA_DNA_bind	0.77
PF13520	AA_permease_2	0.77
PF13147	Obsolete Pfam Family	0.77
PF03725	RNase_PH_C	0.77
PF08447	PAS_3	0.77
PF13202	EF-hand_5	0.77
PF12867	DinB_2	0.77
PF03466	LysR_substrate	0.77
PF13580	SIS_2	0.77
PF02572	CobA_CobO_BtuR	0.77
PF05532	CsbD	0.77
PF13561	adh_short_C2	0.77
PF01384	PHO4	0.77
PF14450	FtsA	0.77
PF03726	PNPase	0.77
PF05977	MFS_3	0.77
PF12732	YtxH	0.77
PF00144	Beta-lactamase	0.77
PF06127	Mpo1-like	0.77
PF07238	PilZ	0.77
PF08388	GIIM	0.77
PF13189	Cytidylate_kin2	0.77
PF13581	HATPase_c_2	0.77
PF00133	tRNA-synt_1	0.77
PF00563	EAL	0.77

COG ID	Name	Functional Category	% Frequency in 130 Family Scaffolds
COG0668	Small-conductance mechanosensitive channel	Cell wall/membrane/envelope biogenesis [M]	4.62
COG3264	Small-conductance mechanosensitive channel MscK	Cell wall/membrane/envelope biogenesis [M]	4.62
COG1392	Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family	Inorganic ion transport and metabolism [P]	2.31
COG1185	Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)	Translation, ribosomal structure and biogenesis [J]	1.54
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.77
COG5001	Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain	Signal transduction mechanisms [T]	0.77
COG4943	Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains	Signal transduction mechanisms [T]	0.77
COG4799	Acetyl-CoA carboxylase, carboxyltransferase component	Lipid transport and metabolism [I]	0.77
COG4539	2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids)	Lipid transport and metabolism [I]	0.77
COG3434	c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains	Signal transduction mechanisms [T]	0.77
COG3237	Uncharacterized conserved protein YjbJ, UPF0337 family	Function unknown [S]	0.77
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	0.77
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.77
COG2200	EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)	Signal transduction mechanisms [T]	0.77
COG2123	Exosome complex RNA-binding protein Rrp42, RNase PH superfamily	Intracellular trafficking, secretion, and vesicular transport [U]	0.77
COG2109	ATP:corrinoid adenosyltransferase	Coenzyme transport and metabolism [H]	0.77
COG0060	Isoleucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.77
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.77
COG0825	Acetyl-CoA carboxylase alpha subunit	Lipid transport and metabolism [I]	0.77
COG0777	Acetyl-CoA carboxylase beta subunit	Lipid transport and metabolism [I]	0.77
COG0689	Ribonuclease PH	Translation, ribosomal structure and biogenesis [J]	0.77
COG0525	Valyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.77
COG0495	Leucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.77
COG0306	Phosphate/sulfate permease	Inorganic ion transport and metabolism [P]	0.77
COG0276	Protoheme ferro-lyase (ferrochelatase)	Coenzyme transport and metabolism [H]	0.77
COG0143	Methionyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.77

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.31 %
Unclassified	root	N/A	37.69 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.31 %
Unclassified	root	N/A	37.69 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.31 %
Unclassified	root	N/A	37.69 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	37.69 %
Unclassified	root	N/A	37.69 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	2.31 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.69 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	14.62 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	11.54 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	2.31 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.69 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	13.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.54 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2.31 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.69 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	13.08 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.54 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	0.77 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.77 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.77 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.77 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.69 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.54 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	6.15 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.77 %
Candidatus Sulfotelmatomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas	0.77 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.77 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.77 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.77 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.77 %
Acidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.69 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.54 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	3.08 %
Candidatus Sulfotelmatomonas gaucii	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii	0.77 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.77 %
Desulfamplus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfamplus	0.77 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	0.77 %
Flammeovirgaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae	0.77 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.77 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.69 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	11.54 %
Desulfamplus magnetovallimortis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfamplus → Desulfamplus magnetovallimortis	0.77 %
Candidatus Koribacter versatilis Ellin345	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	0.77 %
Candidatus Sulfotelmatomonas gaucii	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii	0.77 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.77 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	0.77 %
Flammeovirgaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae	0.77 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.77 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.77 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886012\|MBSR1b_contig_11283062	Not Available	1013	Open in IMG/M
2170459016\|G1P06HT02FTW2A	Not Available	666	Open in IMG/M
3300001160\|JGI12654J13325_1010825	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	640	Open in IMG/M
3300005335\|Ga0070666_10890979	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	657	Open in IMG/M
3300005437\|Ga0070710_11291316	Not Available	542	Open in IMG/M
3300005529\|Ga0070741_10000088	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	340702	Open in IMG/M
3300005529\|Ga0070741_10262396	All Organisms → cellular organisms → Bacteria	1640	Open in IMG/M
3300005529\|Ga0070741_10318662	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1453	Open in IMG/M
3300005533\|Ga0070734_10426081	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	757	Open in IMG/M
3300005534\|Ga0070735_10130869	All Organisms → cellular organisms → Bacteria	1563	Open in IMG/M
3300005534\|Ga0070735_10146937	All Organisms → cellular organisms → Bacteria	1463	Open in IMG/M
3300005534\|Ga0070735_10255945	All Organisms → cellular organisms → Bacteria	1060	Open in IMG/M
3300005536\|Ga0070697_101775789	Not Available	552	Open in IMG/M
3300005541\|Ga0070733_10014984	All Organisms → cellular organisms → Bacteria	4868	Open in IMG/M
3300005542\|Ga0070732_10107197	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae	1648	Open in IMG/M
3300005545\|Ga0070695_100074335	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	2233	Open in IMG/M
3300005548\|Ga0070665_100014166	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	8012	Open in IMG/M
3300005548\|Ga0070665_100267847	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1710	Open in IMG/M
3300005554\|Ga0066661_10377070	All Organisms → cellular organisms → Bacteria → Acidobacteria	868	Open in IMG/M
3300005560\|Ga0066670_10019359	All Organisms → cellular organisms → Bacteria	3131	Open in IMG/M
3300005575\|Ga0066702_10010370	All Organisms → cellular organisms → Bacteria	4133	Open in IMG/M
3300005602\|Ga0070762_10241124	All Organisms → cellular organisms → Bacteria → Acidobacteria	1121	Open in IMG/M
3300005607\|Ga0070740_10229752	Not Available	765	Open in IMG/M
3300005610\|Ga0070763_10682575	Not Available	600	Open in IMG/M
3300005614\|Ga0068856_100021651	Not Available	6247	Open in IMG/M
3300005614\|Ga0068856_100134969	All Organisms → cellular organisms → Bacteria	2473	Open in IMG/M
3300005614\|Ga0068856_100793303	Not Available	967	Open in IMG/M
3300005718\|Ga0068866_10058574	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1990	Open in IMG/M
3300005993\|Ga0080027_10115665	Not Available	1013	Open in IMG/M
3300006059\|Ga0075017_100065242	All Organisms → cellular organisms → Bacteria	2474	Open in IMG/M
3300006059\|Ga0075017_101638544	Not Available	508	Open in IMG/M
3300006162\|Ga0075030_101105260	Not Available	623	Open in IMG/M
3300006237\|Ga0097621_101757641	Not Available	591	Open in IMG/M
3300006237\|Ga0097621_102377467	Not Available	507	Open in IMG/M
3300006794\|Ga0066658_10022763	All Organisms → cellular organisms → Bacteria	2466	Open in IMG/M
3300006804\|Ga0079221_10388884	All Organisms → cellular organisms → Bacteria → Acidobacteria	859	Open in IMG/M
3300006806\|Ga0079220_10187827	All Organisms → cellular organisms → Bacteria	1180	Open in IMG/M
3300006871\|Ga0075434_100116890	All Organisms → cellular organisms → Bacteria	2680	Open in IMG/M
3300006893\|Ga0073928_10000364	All Organisms → cellular organisms → Bacteria	107154	Open in IMG/M
3300006893\|Ga0073928_10300137	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1206	Open in IMG/M
3300007982\|Ga0102924_1011033	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	7639	Open in IMG/M
3300009038\|Ga0099829_10417823	Not Available	1110	Open in IMG/M
3300009088\|Ga0099830_10532477	Not Available	960	Open in IMG/M
3300009089\|Ga0099828_10879325	Not Available	801	Open in IMG/M
3300009093\|Ga0105240_10159997	All Organisms → cellular organisms → Bacteria	2676	Open in IMG/M
3300009093\|Ga0105240_10384550	All Organisms → cellular organisms → Bacteria	1584	Open in IMG/M
3300009101\|Ga0105247_11204795	Not Available	603	Open in IMG/M
3300009545\|Ga0105237_10580241	All Organisms → cellular organisms → Bacteria → Acidobacteria	1128	Open in IMG/M
3300010359\|Ga0126376_13064822	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300010371\|Ga0134125_10757515	All Organisms → cellular organisms → Bacteria	1069	Open in IMG/M
3300010396\|Ga0134126_10606044	All Organisms → cellular organisms → Bacteria	1252	Open in IMG/M
3300010398\|Ga0126383_10667433	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1116	Open in IMG/M
3300010400\|Ga0134122_10031851	Not Available	3991	Open in IMG/M
3300010876\|Ga0126361_10723629	All Organisms → cellular organisms → Bacteria → Acidobacteria	1887	Open in IMG/M
3300011120\|Ga0150983_15308961	Not Available	502	Open in IMG/M
3300011269\|Ga0137392_11232863	Not Available	607	Open in IMG/M
3300011271\|Ga0137393_11755974	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	509	Open in IMG/M
3300012096\|Ga0137389_10010882	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	6063	Open in IMG/M
3300012397\|Ga0134056_1170704	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfamplus → Desulfamplus magnetovallimortis	558	Open in IMG/M
3300012469\|Ga0150984_115389316	Not Available	517	Open in IMG/M
3300012469\|Ga0150984_122504363	Not Available	645	Open in IMG/M
3300012987\|Ga0164307_11618506	All Organisms → cellular organisms → Bacteria → Acidobacteria	548	Open in IMG/M
3300012988\|Ga0164306_10421290	Not Available	1008	Open in IMG/M
3300013100\|Ga0157373_10904164	Not Available	655	Open in IMG/M
3300013105\|Ga0157369_10034555	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	5547	Open in IMG/M
3300013297\|Ga0157378_10283555	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1597	Open in IMG/M
3300013307\|Ga0157372_10004103	All Organisms → cellular organisms → Bacteria	15620	Open in IMG/M
3300014167\|Ga0181528_10795269	Not Available	531	Open in IMG/M
3300014325\|Ga0163163_10067883	Not Available	3547	Open in IMG/M
3300015162\|Ga0167653_1035345	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	923	Open in IMG/M
3300017924\|Ga0187820_1038212	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1267	Open in IMG/M
3300017924\|Ga0187820_1214646	Not Available	605	Open in IMG/M
3300017930\|Ga0187825_10332348	All Organisms → cellular organisms → Bacteria → Acidobacteria	572	Open in IMG/M
3300017936\|Ga0187821_10072568	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1249	Open in IMG/M
3300017936\|Ga0187821_10298049	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	640	Open in IMG/M
3300017994\|Ga0187822_10236371	Not Available	623	Open in IMG/M
3300018034\|Ga0187863_10089832	All Organisms → cellular organisms → Bacteria	1725	Open in IMG/M
3300018431\|Ga0066655_10486446	All Organisms → cellular organisms → Bacteria → Acidobacteria	816	Open in IMG/M
3300018468\|Ga0066662_11593648	All Organisms → cellular organisms → Bacteria → Acidobacteria	681	Open in IMG/M
3300019878\|Ga0193715_1097110	Not Available	595	Open in IMG/M
3300019881\|Ga0193707_1020464	Not Available	2194	Open in IMG/M
3300020002\|Ga0193730_1031603	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1534	Open in IMG/M
3300020004\|Ga0193755_1226466	Not Available	517	Open in IMG/M
3300020579\|Ga0210407_10371003	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1120	Open in IMG/M
3300020582\|Ga0210395_10178060	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1593	Open in IMG/M
3300020583\|Ga0210401_10037861	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4581	Open in IMG/M
3300021170\|Ga0210400_11469049	Not Available	541	Open in IMG/M
3300021171\|Ga0210405_11210226	Not Available	559	Open in IMG/M
3300021178\|Ga0210408_10424826	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1058	Open in IMG/M
3300021181\|Ga0210388_11811884	Not Available	503	Open in IMG/M
3300021405\|Ga0210387_10982609	Not Available	740	Open in IMG/M
3300021407\|Ga0210383_10544139	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1002	Open in IMG/M
3300021560\|Ga0126371_12246054	All Organisms → cellular organisms → Bacteria → Acidobacteria	659	Open in IMG/M
3300022557\|Ga0212123_10000124	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	261125	Open in IMG/M
3300022557\|Ga0212123_10007815	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	16740	Open in IMG/M
3300024288\|Ga0179589_10323105	Not Available	697	Open in IMG/M
3300025899\|Ga0207642_10195909	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1112	Open in IMG/M
3300025913\|Ga0207695_10072860	All Organisms → cellular organisms → Bacteria	3502	Open in IMG/M
3300025913\|Ga0207695_10376050	Not Available	1306	Open in IMG/M
3300025913\|Ga0207695_11420088	Not Available	574	Open in IMG/M
3300025923\|Ga0207681_10212094	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1493	Open in IMG/M
3300025928\|Ga0207700_10961339	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	765	Open in IMG/M
3300025929\|Ga0207664_10744914	Not Available	881	Open in IMG/M
3300025932\|Ga0207690_10671839	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	850	Open in IMG/M
3300026023\|Ga0207677_10804175	Not Available	842	Open in IMG/M
3300026497\|Ga0257164_1082746	Not Available	544	Open in IMG/M
3300027537\|Ga0209419_1104443	Not Available	565	Open in IMG/M
3300027591\|Ga0209733_1173767	Not Available	513	Open in IMG/M
3300027706\|Ga0209581_1176261	Not Available	683	Open in IMG/M
3300027727\|Ga0209328_10039244	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1456	Open in IMG/M
3300027773\|Ga0209810_1267181	Not Available	652	Open in IMG/M
3300027867\|Ga0209167_10044210	All Organisms → cellular organisms → Bacteria	2176	Open in IMG/M
3300027895\|Ga0209624_10002044	All Organisms → cellular organisms → Bacteria → Acidobacteria	15190	Open in IMG/M
3300027895\|Ga0209624_10452578	All Organisms → cellular organisms → Bacteria → Acidobacteria	856	Open in IMG/M
3300027986\|Ga0209168_10000643	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	31699	Open in IMG/M
3300029987\|Ga0311334_10195870	All Organisms → cellular organisms → Bacteria	1544	Open in IMG/M
3300030862\|Ga0265753_1004057	All Organisms → cellular organisms → Bacteria → Acidobacteria	1577	Open in IMG/M
3300031716\|Ga0310813_10309012	All Organisms → cellular organisms → Bacteria	1336	Open in IMG/M
3300031902\|Ga0302322_100372023	All Organisms → cellular organisms → Bacteria	1631	Open in IMG/M
3300031962\|Ga0307479_10049258	Not Available	4048	Open in IMG/M
3300031962\|Ga0307479_10417184	Not Available	1327	Open in IMG/M
3300031996\|Ga0308176_10113391	All Organisms → cellular organisms → Bacteria → Acidobacteria	2410	Open in IMG/M
3300032180\|Ga0307471_101165960	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	935	Open in IMG/M
3300032782\|Ga0335082_11728819	Not Available	500	Open in IMG/M
3300032783\|Ga0335079_10000103	All Organisms → cellular organisms → Bacteria → Acidobacteria	97979	Open in IMG/M
3300032783\|Ga0335079_10033277	All Organisms → cellular organisms → Bacteria	5918	Open in IMG/M
3300032783\|Ga0335079_10210669	All Organisms → cellular organisms → Bacteria	2152	Open in IMG/M
3300032829\|Ga0335070_11642049	Not Available	584	Open in IMG/M
3300032895\|Ga0335074_10007850	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	14813	Open in IMG/M
3300034268\|Ga0372943_1104654	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii	530	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	76.92%
Host-Associated	Host-Associated	22.31%
Engineered	Engineered	0.77%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	64.62%
Plants	Host-Associated → Plants	22.31%
Aquatic	Environmental → Aquatic	12.31%
Solid Waste	Engineered → Solid Waste	0.77%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.08%
Rhizosphere	Host-Associated → Plants → Rhizosphere	14.62%
Freshwater	Environmental → Aquatic → Freshwater	6.15%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.38%
Thermal Springs	Environmental → Aquatic → Thermal Springs	3.85%
Sediment	Environmental → Aquatic → Sediment	2.31%
Roots	Host-Associated → Plants → Roots	2.31%
Peat	Environmental → Terrestrial → Peat	1.54%
Grass	Engineered → Solid Waste → Grass	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.92%
Loam	Environmental → Terrestrial → Soil → Loam	10.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.23%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	6.15%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.38%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.38%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.62%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	3.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.31%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.31%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.77%
Composting	Engineered → Solid Waste → Grass → Composting	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.23%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.23%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.38%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	4.62%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.62%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.62%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.62%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	3.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.85%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.31%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.31%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.54%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.54%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.54%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.77%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.77%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	10.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.15%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.38%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	5.38%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	4.62%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.62%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	3.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.08%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.08%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.08%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.31%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.31%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.31%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.31%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.31%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.31%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.54%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.54%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.54%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.54%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.54%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.77%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.77%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.77%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.77%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.77%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.77%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.77%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.77%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.77%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.77%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
2170459016	Litter degradation ZMR2	Engineered	Open in IMG/M
3300001160	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005607	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005993	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300007982	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010876	Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012397	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014167	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015162	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)	Environmental	Open in IMG/M
3300017924	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5	Environmental	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018034	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019878	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2	Environmental	Open in IMG/M
3300019881	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2	Environmental	Open in IMG/M
3300020002	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1	Environmental	Open in IMG/M
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026497	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B	Environmental	Open in IMG/M
3300027537	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)	Environmental	Open in IMG/M
3300027591	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)	Environmental	Open in IMG/M
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027727	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300030862	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032895	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MBSR1b_0100.00002140	2162886012	Miscanthus Rhizosphere	MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF
2ZMR_01332570	2170459016	Switchgrass, Maize And Mischanthus Litter	MDKKEIESPKLTARFLVWITGFLIVLFALIAHFVWRVF
JGI12654J13325_10108253	3300001160	Forest Soil	MNKKEIESPKLTANFLIWISAFMLLLFALLAHFVWKVF*
Ga0070666_108909791	3300005335	Switchgrass Rhizosphere	ILNMDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF*
Ga0070710_112913161	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MNKKEIESPKLTANFLVWIGLFVVLLVLVAHYILKPSRREF
Ga0070741_10000088209	3300005529	Surface Soil	MDKKEINSPKLTGRFLMFITGFVLLMLVVAHFLLRWF*
Ga0070741_102623964	3300005529	Surface Soil	MNKNGMNKKEIESPKLTANFLVWIGLFVLLMVLVAHYIFKFF*
Ga0070741_103186622	3300005529	Surface Soil	MVSGMDKKQINSPKLTVNFLVWIGLFLLAMVLLIAHFVWRIF*
Ga0070734_104260812	3300005533	Surface Soil	MNKKEIESPKLTANFLIWVGLFLFAMFALIAHFVLRWF*
Ga0070735_101308695	3300005534	Surface Soil	MQTFYTFQPLRNGMDKKEIESPKLTANFLVWIGLFLVLMVLVAHFFLKFF*
Ga0070735_101469372	3300005534	Surface Soil	MDKKEIESPKLTANFLVWIGSFLVLMVLVAHFLLKFF*
Ga0070735_102559453	3300005534	Surface Soil	MNKKEIESPKLTANFLVWIGLFVFLMLLVAHYVLKFF*
Ga0070697_1017757892	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	TLQELPKAILTLDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF*
Ga0070733_100149844	3300005541	Surface Soil	MNKKEIESPKLTANFLLWISAFLLLLFAALAHFVWKIF*
Ga0070732_101071972	3300005542	Surface Soil	MDKKQIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF*
Ga0070695_1000743353	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	VMDKKEIESPRLTARFLIWITGFMIVVFALIAHFVWRVF*
Ga0070665_1000141667	3300005548	Switchgrass Rhizosphere	MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF*
Ga0070665_1002678472	3300005548	Switchgrass Rhizosphere	MDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRIF*
Ga0066661_103770701	3300005554	Soil	KEIQSPKLTANFLLWIGLFLLAMFLLIAQFVWKVF*
Ga0066670_100193593	3300005560	Soil	MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF*
Ga0066702_100103703	3300005575	Soil	MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAQFVWKVF*
Ga0070762_102411241	3300005602	Soil	MNKKEIESPKLTADFLIWTTVFILLLFALLAHFVWKVF*
Ga0070740_102297522	3300005607	Surface Soil	MDKKQINSPKLTANFLVWISLFLLAMFLLIAHFVWRIF*
Ga0070763_106825751	3300005610	Soil	MDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRMF*
Ga0068856_1000216512	3300005614	Corn Rhizosphere	MDKKEIESPKLTARFLVWITGFLIVLFALIAHFVWRVF*
Ga0068856_1001349694	3300005614	Corn Rhizosphere	MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRIF*
Ga0068856_1007933032	3300005614	Corn Rhizosphere	MDKKEIESPKLTANFLLSVGLFLLAMFLLIAHFAWHLF*
Ga0068866_100585743	3300005718	Miscanthus Rhizosphere	MDKKEIESPRLTARFLVWITGFLIVLFALIAHFVWRVF*
Ga0080027_101156652	3300005993	Prmafrost Soil	MDKKEIESPRLTARFLIWITGFMIVVFALIAHFVWRIF*
Ga0075017_1000652422	3300006059	Watersheds	MDRKEIESPKLTTNFLIWISAFLLLLFALLAHFV*
Ga0075017_1016385441	3300006059	Watersheds	MLTAMDKKEIESPKLTARFLIWITGFMIVVFALIAHFVWRVF*
Ga0075030_1011052602	3300006162	Watersheds	MDRKEIESPKLTTDFLIWISAFLLLLFALLAHFV*
Ga0097621_1017576412	3300006237	Miscanthus Rhizosphere	MQGAMDKKEIESPRLTASFLIWITGFMIVVFALIAHFVWRVF*
Ga0097621_1023774672	3300006237	Miscanthus Rhizosphere	MDKKEIESPKLTVNFLIWISAFMLLLFLLIGHFVWRIF*
Ga0066658_100227632	3300006794	Soil	MDKKEIQSPKLTANFLLWIGVFLLAMFLLIAHFVWKVF*
Ga0079221_103888842	3300006804	Agricultural Soil	VDKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF*
Ga0079220_101878272	3300006806	Agricultural Soil	MDKKEIQSPKLTANFLLWIGLFLLAMFLLIGHFVWKVF*
Ga0075434_1001168903	3300006871	Populus Rhizosphere	VAEGVSCPMDKKEIESPKLTARFLVWITGFLIVLFALIAHFVWRVF*
Ga0073928_1000036439	3300006893	Iron-Sulfur Acid Spring	MNKKEIESPKLTANFLIYIGVFVLLLFAVLAHFVWKLF*
Ga0073928_103001371	3300006893	Iron-Sulfur Acid Spring	MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRMF*
Ga0102924_10110332	3300007982	Iron-Sulfur Acid Spring	MNKKEIESPKLTANFLLWIGAFVLLLFAVLAHFVWKLF*
Ga0099829_104178232	3300009038	Vadose Zone Soil	MDKKEIESPKLTGRFLIWMSAFMLLLFALIAHFVWKVV*
Ga0099830_105324772	3300009088	Vadose Zone Soil	MDKKEIESPKLTDRFLIWISAFMLLLFALIAHFVWKVV*
Ga0099828_108793252	3300009089	Vadose Zone Soil	MDKKEIESPKLTGRFLIWISAFMLLLFALIAHFVWKVV*
Ga0105240_101599971	3300009093	Corn Rhizosphere	YPDAMDKKEIESPKLTARFLIWITGFLIVLFALIAHVVWRIF*
Ga0105240_103845502	3300009093	Corn Rhizosphere	MNKKEIESPKLTANFLVWIGLFLVLMLLLAHYVLKFF*
Ga0105247_112047952	3300009101	Switchgrass Rhizosphere	YPDAMDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRIF*
Ga0105237_105802411	3300009545	Corn Rhizosphere	MDKKEIQSPKLTANFLLWIGLFLLAMFALIAHFVWRIF*
Ga0126376_130648222	3300010359	Tropical Forest Soil	MDKKEINSPKLTARFLIWISGFVLLMLVVAHFLLKWF*
Ga0134125_107575152	3300010371	Terrestrial Soil	MDKKEIESPKLTANFLVWIGLFLVLMVLVAHFLLKFF*
Ga0134126_106060442	3300010396	Terrestrial Soil	MNKKEIESPKLTANFLVWIGLFLLLLVALAHFALRLF*
Ga0126383_106674331	3300010398	Tropical Forest Soil	MDKKEIESPELTANFLLWIGLFLLAMFLLIAHFAWHLF*
Ga0134122_100318511	3300010400	Terrestrial Soil	MDKKEIESPKLTARFLIWITGFLIVLFARIAHFVGRGF*
Ga0126361_107236293	3300010876	Boreal Forest Soil	MNKKEIESPKLTANFLIWTTVFILLLFALLAHFVWKVF*
Ga0150983_153089611	3300011120	Forest Soil	MNKKEIESPKLTANFLIWTAVFILLLSALLAHFVWKVF*
Ga0137392_112328631	3300011269	Vadose Zone Soil	MDKKEIESPKLTGNFLIWISAFMLLLFALLAHFVWKVF*
Ga0137393_117559742	3300011271	Vadose Zone Soil	MDKKEIESPKLTVHFLIWITAFLLLLFALLAHFVWKVF
Ga0137389_100108823	3300012096	Vadose Zone Soil	MDKEEIESPKLTGNFLTWISAFMLLLFALLAHFVWKVF*
Ga0134056_11707043	3300012397	Grasslands Soil	MNKKEIESPKLTGNFLVWIGLFVLLLAAIAHFMFKLF*
Ga0150984_1153893162	3300012469	Avena Fatua Rhizosphere	KKEIESPKLTANFLLWIGLFLLAMFLLIAHFAWHLF*
Ga0150984_1225043631	3300012469	Avena Fatua Rhizosphere	SGPNHIRMDKKEIKSPKLTAHFLLWIGLFLLAMFALIAHFVWRIF*
Ga0164307_116185061	3300012987	Soil	MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKV
Ga0164306_104212901	3300012988	Soil	KEIESPKLTARFLVWITGFLIVLFALIAHFVWRVF*
Ga0157373_109041641	3300013100	Corn Rhizosphere	PMDKKEIESPKLTARFLVWITGFLIVLFALIAHFVWRDF*
Ga0157369_100345557	3300013105	Corn Rhizosphere	MNKKEIESPKLTANFLVWIGLFLLLLVALAHFALKLF*
Ga0157378_102835552	3300013297	Miscanthus Rhizosphere	DKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF*
Ga0157372_100041032	3300013307	Corn Rhizosphere	MNKKEIESPKLTANFLVWIGLFVLLLAAVAHFVLKLF*
Ga0181528_107952692	3300014167	Bog	VNKKEIDSPKLTANFLLWIVLFLIAMFALIAHFVLRLF*
Ga0163163_100678832	3300014325	Switchgrass Rhizosphere	MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVI*
Ga0167653_10353451	3300015162	Glacier Forefield Soil	MDKKEINSPKLTLNFLVWIGGFMLLLFALIAHFVWNVI*
Ga0187820_10382122	3300017924	Freshwater Sediment	MDKKEIESPKLTARFLIWITGFVIVLFALIAHFVWRVF
Ga0187820_12146462	3300017924	Freshwater Sediment	MDKKQIESSKLTANFLLWIGLFLLAMFLLIAHFAWHLF
Ga0187825_103323482	3300017930	Freshwater Sediment	MDKKQIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF
Ga0187821_100725682	3300017936	Freshwater Sediment	MDKKEIESPKLTANFLIWISAFMLLLFALIAHFVWKVF
Ga0187821_102980492	3300017936	Freshwater Sediment	MNKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFAWRIF
Ga0187822_102363712	3300017994	Freshwater Sediment	MDKKEIESPKLTANFLIWISAFMLLLFALVAHFVWKVF
Ga0187863_100898322	3300018034	Peatland	VNKKEIESPKLTANFLLWMGLFLIAMFSLIAHFLLRLF
Ga0066655_104864462	3300018431	Grasslands Soil	MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF
Ga0066662_115936482	3300018468	Grasslands Soil	MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAQFVWKVF
Ga0193715_10971102	3300019878	Soil	MDKKEIESSRLTANFLLWIGAFMILLFVLLAHFVWK
Ga0193707_10204642	3300019881	Soil	MDKKEIESSKLTANFLLWIGAFMILLFVLLAHFVWKVF
Ga0193730_10316032	3300020002	Soil	MDKKEIESSRLTANFLLWIGAFMILLFVLLAHFVWKVF
Ga0193755_12264662	3300020004	Soil	MDKKEIESPKLTENFLLWIGLFMLVLFLLLAHFVWRVF
Ga0210407_103710032	3300020579	Soil	MDKREIESPRLTANFLIWITAFVLLLFGLIAHFVWRIF
Ga0210395_101780601	3300020582	Soil	MNKKEIESPKLTADFLIWTTVFILLLFALLAHFVWKVF
Ga0210401_100378616	3300020583	Soil	MDKKEIESPKLTARFLIWISAFMLLLFALLAHFVWRVF
Ga0210400_114690491	3300021170	Soil	MNKKEIESSKLTANFLLWIGVFVVLLFVVLAHFVWKLF
Ga0210405_112102261	3300021171	Soil	MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRMF
Ga0210408_104248262	3300021178	Soil	MDKKEIESPKLTARFLIWITGLLIVLFALIAHFVWKMF
Ga0210388_118118842	3300021181	Soil	VNKKEIESPKLTANFLLWIGLFLIAMFALIAHFVLRLF
Ga0210387_109826092	3300021405	Soil	MNKKQIESPKLTANFLLFACIFLLGMFALIAHFVWRVF
Ga0210383_105441392	3300021407	Soil	MLDTVDKKEIESPKLTARFLIWITGFMIVVFALIAHFVWRVF
Ga0126371_122460541	3300021560	Tropical Forest Soil	MDKKQINSPKLTANFLIWISLFLLAMFLLIAHFVW
Ga0212123_10000124240	3300022557	Iron-Sulfur Acid Spring	MNKKEIESPKLTANFLIYIGVFVLLLFAVLAHFVWKLF
Ga0212123_1000781515	3300022557	Iron-Sulfur Acid Spring	MNKKEIESPKLTANFLLWIGAFVLLLFAVLAHFVWKLF
Ga0179589_103231052	3300024288	Vadose Zone Soil	MDKKEIESPKLTANFLIWISAFMLLLFLLIGHFVWRIF
Ga0207642_101959092	3300025899	Miscanthus Rhizosphere	MDKKEIESPRLTARFLVWITGFLIVLFALIAHFVWRVF
Ga0207695_100728604	3300025913	Corn Rhizosphere	YPDAMDKKEIESPKLTARFLIWITGFLIVLFALIAHVVWRIF
Ga0207695_103760503	3300025913	Corn Rhizosphere	LRYGMNKKEIESPKLTANFLVWIGLFLVLMLLLAHYVLKFF
Ga0207695_114200881	3300025913	Corn Rhizosphere	AMDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRIF
Ga0207681_102120941	3300025923	Switchgrass Rhizosphere	TMDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF
Ga0207700_109613391	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MDKKQINSPKLTANFLLWIGLFLLAMFLLIAHFAWRLF
Ga0207664_107449142	3300025929	Agricultural Soil	MNKKEIESPKLTANFLVWIGLFVVLLVLVAHYILKLF
Ga0207690_106718392	3300025932	Corn Rhizosphere	SMDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF
Ga0207677_108041752	3300026023	Miscanthus Rhizosphere	MDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRIF
Ga0257164_10827462	3300026497	Soil	MDKKEIESPKLTGRFLIWISAFMLLLFALIAHFVWKVV
Ga0209419_11044432	3300027537	Forest Soil	MNKKEIESPKLTANFLIWTTVFILLLFALLAHFVWKVF
Ga0209733_11737671	3300027591	Forest Soil	MNKKEIESSKLTANFLLWIGAFVVLLFALLAHFVWKFF
Ga0209581_11762611	3300027706	Surface Soil	MDKKQINSPKLTANFLVWISLFLLAMFLLIAHFVWRIF
Ga0209328_100392442	3300027727	Forest Soil	MNKKEIESPKLTANFLIWISAFMLLLFALLAHFVWKVF
Ga0209810_12671811	3300027773	Surface Soil	MDKKEIESPKLTANFLVWIGLFLLAMFLLIARFAWHLF
Ga0209167_100442104	3300027867	Surface Soil	MNKKEIESPKLTANFLLWISAFLLLLFAALAHFVWKIF
Ga0209624_1000204419	3300027895	Forest Soil	VNKKEIESPKLTTNFLLWIGLFLIAMFALIAHFMLRLF
Ga0209624_104525782	3300027895	Forest Soil	SWAMNKKEIESPKLTANFLIWTTVFILLLFALLAHFVWKVF
Ga0209168_100006434	3300027986	Surface Soil	MDKKEIESPKLTANFLVWIGSFLVLMVLVAHFLLKFF
Ga0311334_101958702	3300029987	Fen	MDKKEIESPKLTINFLIWITVFMLLMFGLLGHFVWKVF
Ga0265753_10040573	3300030862	Soil	CAMNKKEIESPKLTADFLIWTTVFILLLFALLAHFVWKVF
Ga0310813_103090122	3300031716	Soil	MDKKEIQSPKLTANFLLWISLFLLAMFLLIAHFVWKVF
Ga0302322_1003720231	3300031902	Fen	RARTSGVSLAMDKKEIESPKLTINFLIWITVFMLLMFGLLGHFVWKVF
Ga0307479_100492583	3300031962	Hardwood Forest Soil	MDKKEIESPKLTGNFLIWISAFMLLVFALLAHFVWKVF
Ga0307479_104171842	3300031962	Hardwood Forest Soil	MDKKEVESPKLTARFLIWITGFMIVVFALIAHFVWRVF
Ga0308176_101133913	3300031996	Soil	MDKKEIQSPKLTANFLLWIGLFLLAMFALIAHFVWRIF
Ga0307471_1011659602	3300032180	Hardwood Forest Soil	LHNDKKEIESPKLTGNFLIWISAFMLLVFALLAHFVWKVF
Ga0335082_117288192	3300032782	Soil	MNKKEIESPKLTANFLIWTSLFLLAVFALIAHFGLGLF
Ga0335079_1000010348	3300032783	Soil	MDKKEINSPKLTANFLVWIGLFLLAMFLLIAHFVWRVF
Ga0335079_100332776	3300032783	Soil	MDKKEINSPKLTARFLIFISGFVLLMLLVAHFLLRWF
Ga0335079_102106692	3300032783	Soil	MDKKDINSPGLTANFLVWIGLFVLAMFAFIGHFIWKIF
Ga0335070_116420492	3300032829	Soil	MDKKEIESPKLTARFLIWITGFMIVVFALIAHFVWRIF
Ga0335074_100078506	3300032895	Soil	MHMDKKEIKSPKLTANFLLWTGLFLFAMFALIAHFVWHLF
Ga0372943_1104654_277_390	3300034268	Soil	MNKKEIDSPKLTANFLVWVGLFVVLLAALAHFVLKLF

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F062850

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences