| Basic Information | |
|---|---|
| Family ID | F062850 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MDKKEIESPKLTANFLIWISAFMLLLFALIAHFVWKVF |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.08 % |
| % of genes near scaffold ends (potentially truncated) | 21.54 % |
| % of genes from short scaffolds (< 2000 bps) | 74.62 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.308 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (10.769 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.846 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.94% β-sheet: 0.00% Coil/Unstructured: 56.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF00924 | MS_channel | 4.62 |
| PF09900 | DUF2127 | 3.08 |
| PF00575 | S1 | 3.08 |
| PF01865 | PhoU_div | 2.31 |
| PF13226 | DUF4034 | 1.54 |
| PF00005 | ABC_tran | 1.54 |
| PF10129 | OpgC_C | 1.54 |
| PF11645 | PDDEXK_5 | 1.54 |
| PF00275 | EPSP_synthase | 1.54 |
| PF14417 | MEDS | 1.54 |
| PF01979 | Amidohydro_1 | 1.54 |
| PF00072 | Response_reg | 1.54 |
| PF10727 | Rossmann-like | 0.77 |
| PF01039 | Carboxyl_trans | 0.77 |
| PF10091 | Glycoamylase | 0.77 |
| PF13657 | Couple_hipA | 0.77 |
| PF00762 | Ferrochelatase | 0.77 |
| PF04909 | Amidohydro_2 | 0.77 |
| PF14716 | HHH_8 | 0.77 |
| PF11345 | DUF3147 | 0.77 |
| PF01726 | LexA_DNA_bind | 0.77 |
| PF13520 | AA_permease_2 | 0.77 |
| PF13147 | Obsolete Pfam Family | 0.77 |
| PF03725 | RNase_PH_C | 0.77 |
| PF08447 | PAS_3 | 0.77 |
| PF13202 | EF-hand_5 | 0.77 |
| PF12867 | DinB_2 | 0.77 |
| PF03466 | LysR_substrate | 0.77 |
| PF13580 | SIS_2 | 0.77 |
| PF02572 | CobA_CobO_BtuR | 0.77 |
| PF05532 | CsbD | 0.77 |
| PF13561 | adh_short_C2 | 0.77 |
| PF01384 | PHO4 | 0.77 |
| PF14450 | FtsA | 0.77 |
| PF03726 | PNPase | 0.77 |
| PF05977 | MFS_3 | 0.77 |
| PF12732 | YtxH | 0.77 |
| PF00144 | Beta-lactamase | 0.77 |
| PF06127 | Mpo1-like | 0.77 |
| PF07238 | PilZ | 0.77 |
| PF08388 | GIIM | 0.77 |
| PF13189 | Cytidylate_kin2 | 0.77 |
| PF13581 | HATPase_c_2 | 0.77 |
| PF00133 | tRNA-synt_1 | 0.77 |
| PF00563 | EAL | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 4.62 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 4.62 |
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 2.31 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 1.54 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.77 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.77 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.77 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 0.77 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.77 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.77 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.77 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.77 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.77 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.77 |
| COG2109 | ATP:corrinoid adenosyltransferase | Coenzyme transport and metabolism [H] | 0.77 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.77 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.77 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.77 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.77 |
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 0.77 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.31 % |
| Unclassified | root | N/A | 37.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_11283062 | Not Available | 1013 | Open in IMG/M |
| 2170459016|G1P06HT02FTW2A | Not Available | 666 | Open in IMG/M |
| 3300001160|JGI12654J13325_1010825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
| 3300005335|Ga0070666_10890979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300005437|Ga0070710_11291316 | Not Available | 542 | Open in IMG/M |
| 3300005529|Ga0070741_10000088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 340702 | Open in IMG/M |
| 3300005529|Ga0070741_10262396 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300005529|Ga0070741_10318662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1453 | Open in IMG/M |
| 3300005533|Ga0070734_10426081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 757 | Open in IMG/M |
| 3300005534|Ga0070735_10130869 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300005534|Ga0070735_10146937 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300005534|Ga0070735_10255945 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300005536|Ga0070697_101775789 | Not Available | 552 | Open in IMG/M |
| 3300005541|Ga0070733_10014984 | All Organisms → cellular organisms → Bacteria | 4868 | Open in IMG/M |
| 3300005542|Ga0070732_10107197 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae | 1648 | Open in IMG/M |
| 3300005545|Ga0070695_100074335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2233 | Open in IMG/M |
| 3300005548|Ga0070665_100014166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 8012 | Open in IMG/M |
| 3300005548|Ga0070665_100267847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1710 | Open in IMG/M |
| 3300005554|Ga0066661_10377070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300005560|Ga0066670_10019359 | All Organisms → cellular organisms → Bacteria | 3131 | Open in IMG/M |
| 3300005575|Ga0066702_10010370 | All Organisms → cellular organisms → Bacteria | 4133 | Open in IMG/M |
| 3300005602|Ga0070762_10241124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300005607|Ga0070740_10229752 | Not Available | 765 | Open in IMG/M |
| 3300005610|Ga0070763_10682575 | Not Available | 600 | Open in IMG/M |
| 3300005614|Ga0068856_100021651 | Not Available | 6247 | Open in IMG/M |
| 3300005614|Ga0068856_100134969 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300005614|Ga0068856_100793303 | Not Available | 967 | Open in IMG/M |
| 3300005718|Ga0068866_10058574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1990 | Open in IMG/M |
| 3300005993|Ga0080027_10115665 | Not Available | 1013 | Open in IMG/M |
| 3300006059|Ga0075017_100065242 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300006059|Ga0075017_101638544 | Not Available | 508 | Open in IMG/M |
| 3300006162|Ga0075030_101105260 | Not Available | 623 | Open in IMG/M |
| 3300006237|Ga0097621_101757641 | Not Available | 591 | Open in IMG/M |
| 3300006237|Ga0097621_102377467 | Not Available | 507 | Open in IMG/M |
| 3300006794|Ga0066658_10022763 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300006804|Ga0079221_10388884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300006806|Ga0079220_10187827 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300006871|Ga0075434_100116890 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
| 3300006893|Ga0073928_10000364 | All Organisms → cellular organisms → Bacteria | 107154 | Open in IMG/M |
| 3300006893|Ga0073928_10300137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
| 3300007982|Ga0102924_1011033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 7639 | Open in IMG/M |
| 3300009038|Ga0099829_10417823 | Not Available | 1110 | Open in IMG/M |
| 3300009088|Ga0099830_10532477 | Not Available | 960 | Open in IMG/M |
| 3300009089|Ga0099828_10879325 | Not Available | 801 | Open in IMG/M |
| 3300009093|Ga0105240_10159997 | All Organisms → cellular organisms → Bacteria | 2676 | Open in IMG/M |
| 3300009093|Ga0105240_10384550 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300009101|Ga0105247_11204795 | Not Available | 603 | Open in IMG/M |
| 3300009545|Ga0105237_10580241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300010359|Ga0126376_13064822 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010371|Ga0134125_10757515 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300010396|Ga0134126_10606044 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300010398|Ga0126383_10667433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
| 3300010400|Ga0134122_10031851 | Not Available | 3991 | Open in IMG/M |
| 3300010876|Ga0126361_10723629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1887 | Open in IMG/M |
| 3300011120|Ga0150983_15308961 | Not Available | 502 | Open in IMG/M |
| 3300011269|Ga0137392_11232863 | Not Available | 607 | Open in IMG/M |
| 3300011271|Ga0137393_11755974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 509 | Open in IMG/M |
| 3300012096|Ga0137389_10010882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6063 | Open in IMG/M |
| 3300012397|Ga0134056_1170704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfamplus → Desulfamplus magnetovallimortis | 558 | Open in IMG/M |
| 3300012469|Ga0150984_115389316 | Not Available | 517 | Open in IMG/M |
| 3300012469|Ga0150984_122504363 | Not Available | 645 | Open in IMG/M |
| 3300012987|Ga0164307_11618506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300012988|Ga0164306_10421290 | Not Available | 1008 | Open in IMG/M |
| 3300013100|Ga0157373_10904164 | Not Available | 655 | Open in IMG/M |
| 3300013105|Ga0157369_10034555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5547 | Open in IMG/M |
| 3300013297|Ga0157378_10283555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1597 | Open in IMG/M |
| 3300013307|Ga0157372_10004103 | All Organisms → cellular organisms → Bacteria | 15620 | Open in IMG/M |
| 3300014167|Ga0181528_10795269 | Not Available | 531 | Open in IMG/M |
| 3300014325|Ga0163163_10067883 | Not Available | 3547 | Open in IMG/M |
| 3300015162|Ga0167653_1035345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300017924|Ga0187820_1038212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1267 | Open in IMG/M |
| 3300017924|Ga0187820_1214646 | Not Available | 605 | Open in IMG/M |
| 3300017930|Ga0187825_10332348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300017936|Ga0187821_10072568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300017936|Ga0187821_10298049 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 640 | Open in IMG/M |
| 3300017994|Ga0187822_10236371 | Not Available | 623 | Open in IMG/M |
| 3300018034|Ga0187863_10089832 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300018431|Ga0066655_10486446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300018468|Ga0066662_11593648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300019878|Ga0193715_1097110 | Not Available | 595 | Open in IMG/M |
| 3300019881|Ga0193707_1020464 | Not Available | 2194 | Open in IMG/M |
| 3300020002|Ga0193730_1031603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1534 | Open in IMG/M |
| 3300020004|Ga0193755_1226466 | Not Available | 517 | Open in IMG/M |
| 3300020579|Ga0210407_10371003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300020582|Ga0210395_10178060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1593 | Open in IMG/M |
| 3300020583|Ga0210401_10037861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4581 | Open in IMG/M |
| 3300021170|Ga0210400_11469049 | Not Available | 541 | Open in IMG/M |
| 3300021171|Ga0210405_11210226 | Not Available | 559 | Open in IMG/M |
| 3300021178|Ga0210408_10424826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300021181|Ga0210388_11811884 | Not Available | 503 | Open in IMG/M |
| 3300021405|Ga0210387_10982609 | Not Available | 740 | Open in IMG/M |
| 3300021407|Ga0210383_10544139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1002 | Open in IMG/M |
| 3300021560|Ga0126371_12246054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300022557|Ga0212123_10000124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 261125 | Open in IMG/M |
| 3300022557|Ga0212123_10007815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16740 | Open in IMG/M |
| 3300024288|Ga0179589_10323105 | Not Available | 697 | Open in IMG/M |
| 3300025899|Ga0207642_10195909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1112 | Open in IMG/M |
| 3300025913|Ga0207695_10072860 | All Organisms → cellular organisms → Bacteria | 3502 | Open in IMG/M |
| 3300025913|Ga0207695_10376050 | Not Available | 1306 | Open in IMG/M |
| 3300025913|Ga0207695_11420088 | Not Available | 574 | Open in IMG/M |
| 3300025923|Ga0207681_10212094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
| 3300025928|Ga0207700_10961339 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 765 | Open in IMG/M |
| 3300025929|Ga0207664_10744914 | Not Available | 881 | Open in IMG/M |
| 3300025932|Ga0207690_10671839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300026023|Ga0207677_10804175 | Not Available | 842 | Open in IMG/M |
| 3300026497|Ga0257164_1082746 | Not Available | 544 | Open in IMG/M |
| 3300027537|Ga0209419_1104443 | Not Available | 565 | Open in IMG/M |
| 3300027591|Ga0209733_1173767 | Not Available | 513 | Open in IMG/M |
| 3300027706|Ga0209581_1176261 | Not Available | 683 | Open in IMG/M |
| 3300027727|Ga0209328_10039244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1456 | Open in IMG/M |
| 3300027773|Ga0209810_1267181 | Not Available | 652 | Open in IMG/M |
| 3300027867|Ga0209167_10044210 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300027895|Ga0209624_10002044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15190 | Open in IMG/M |
| 3300027895|Ga0209624_10452578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300027986|Ga0209168_10000643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 31699 | Open in IMG/M |
| 3300029987|Ga0311334_10195870 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300030862|Ga0265753_1004057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1577 | Open in IMG/M |
| 3300031716|Ga0310813_10309012 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300031902|Ga0302322_100372023 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300031962|Ga0307479_10049258 | Not Available | 4048 | Open in IMG/M |
| 3300031962|Ga0307479_10417184 | Not Available | 1327 | Open in IMG/M |
| 3300031996|Ga0308176_10113391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2410 | Open in IMG/M |
| 3300032180|Ga0307471_101165960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300032782|Ga0335082_11728819 | Not Available | 500 | Open in IMG/M |
| 3300032783|Ga0335079_10000103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 97979 | Open in IMG/M |
| 3300032783|Ga0335079_10033277 | All Organisms → cellular organisms → Bacteria | 5918 | Open in IMG/M |
| 3300032783|Ga0335079_10210669 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300032829|Ga0335070_11642049 | Not Available | 584 | Open in IMG/M |
| 3300032895|Ga0335074_10007850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 14813 | Open in IMG/M |
| 3300034268|Ga0372943_1104654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 530 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 10.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.62% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.08% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.54% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.77% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.77% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.77% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.77% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0100.00002140 | 2162886012 | Miscanthus Rhizosphere | MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF |
| 2ZMR_01332570 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MDKKEIESPKLTARFLVWITGFLIVLFALIAHFVWRVF |
| JGI12654J13325_10108253 | 3300001160 | Forest Soil | MNKKEIESPKLTANFLIWISAFMLLLFALLAHFVWKVF* |
| Ga0070666_108909791 | 3300005335 | Switchgrass Rhizosphere | ILNMDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF* |
| Ga0070710_112913161 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKKEIESPKLTANFLVWIGLFVVLLVLVAHYILKPSRREF |
| Ga0070741_10000088209 | 3300005529 | Surface Soil | MDKKEINSPKLTGRFLMFITGFVLLMLVVAHFLLRWF* |
| Ga0070741_102623964 | 3300005529 | Surface Soil | MNKNGMNKKEIESPKLTANFLVWIGLFVLLMVLVAHYIFKFF* |
| Ga0070741_103186622 | 3300005529 | Surface Soil | MVSGMDKKQINSPKLTVNFLVWIGLFLLAMVLLIAHFVWRIF* |
| Ga0070734_104260812 | 3300005533 | Surface Soil | MNKKEIESPKLTANFLIWVGLFLFAMFALIAHFVLRWF* |
| Ga0070735_101308695 | 3300005534 | Surface Soil | MQTFYTFQPLRNGMDKKEIESPKLTANFLVWIGLFLVLMVLVAHFFLKFF* |
| Ga0070735_101469372 | 3300005534 | Surface Soil | MDKKEIESPKLTANFLVWIGSFLVLMVLVAHFLLKFF* |
| Ga0070735_102559453 | 3300005534 | Surface Soil | MNKKEIESPKLTANFLVWIGLFVFLMLLVAHYVLKFF* |
| Ga0070697_1017757892 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TLQELPKAILTLDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF* |
| Ga0070733_100149844 | 3300005541 | Surface Soil | MNKKEIESPKLTANFLLWISAFLLLLFAALAHFVWKIF* |
| Ga0070732_101071972 | 3300005542 | Surface Soil | MDKKQIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF* |
| Ga0070695_1000743353 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VMDKKEIESPRLTARFLIWITGFMIVVFALIAHFVWRVF* |
| Ga0070665_1000141667 | 3300005548 | Switchgrass Rhizosphere | MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF* |
| Ga0070665_1002678472 | 3300005548 | Switchgrass Rhizosphere | MDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRIF* |
| Ga0066661_103770701 | 3300005554 | Soil | KEIQSPKLTANFLLWIGLFLLAMFLLIAQFVWKVF* |
| Ga0066670_100193593 | 3300005560 | Soil | MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF* |
| Ga0066702_100103703 | 3300005575 | Soil | MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAQFVWKVF* |
| Ga0070762_102411241 | 3300005602 | Soil | MNKKEIESPKLTADFLIWTTVFILLLFALLAHFVWKVF* |
| Ga0070740_102297522 | 3300005607 | Surface Soil | MDKKQINSPKLTANFLVWISLFLLAMFLLIAHFVWRIF* |
| Ga0070763_106825751 | 3300005610 | Soil | MDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRMF* |
| Ga0068856_1000216512 | 3300005614 | Corn Rhizosphere | MDKKEIESPKLTARFLVWITGFLIVLFALIAHFVWRVF* |
| Ga0068856_1001349694 | 3300005614 | Corn Rhizosphere | MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRIF* |
| Ga0068856_1007933032 | 3300005614 | Corn Rhizosphere | MDKKEIESPKLTANFLLSVGLFLLAMFLLIAHFAWHLF* |
| Ga0068866_100585743 | 3300005718 | Miscanthus Rhizosphere | MDKKEIESPRLTARFLVWITGFLIVLFALIAHFVWRVF* |
| Ga0080027_101156652 | 3300005993 | Prmafrost Soil | MDKKEIESPRLTARFLIWITGFMIVVFALIAHFVWRIF* |
| Ga0075017_1000652422 | 3300006059 | Watersheds | MDRKEIESPKLTTNFLIWISAFLLLLFALLAHFV* |
| Ga0075017_1016385441 | 3300006059 | Watersheds | MLTAMDKKEIESPKLTARFLIWITGFMIVVFALIAHFVWRVF* |
| Ga0075030_1011052602 | 3300006162 | Watersheds | MDRKEIESPKLTTDFLIWISAFLLLLFALLAHFV* |
| Ga0097621_1017576412 | 3300006237 | Miscanthus Rhizosphere | MQGAMDKKEIESPRLTASFLIWITGFMIVVFALIAHFVWRVF* |
| Ga0097621_1023774672 | 3300006237 | Miscanthus Rhizosphere | MDKKEIESPKLTVNFLIWISAFMLLLFLLIGHFVWRIF* |
| Ga0066658_100227632 | 3300006794 | Soil | MDKKEIQSPKLTANFLLWIGVFLLAMFLLIAHFVWKVF* |
| Ga0079221_103888842 | 3300006804 | Agricultural Soil | VDKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF* |
| Ga0079220_101878272 | 3300006806 | Agricultural Soil | MDKKEIQSPKLTANFLLWIGLFLLAMFLLIGHFVWKVF* |
| Ga0075434_1001168903 | 3300006871 | Populus Rhizosphere | VAEGVSCPMDKKEIESPKLTARFLVWITGFLIVLFALIAHFVWRVF* |
| Ga0073928_1000036439 | 3300006893 | Iron-Sulfur Acid Spring | MNKKEIESPKLTANFLIYIGVFVLLLFAVLAHFVWKLF* |
| Ga0073928_103001371 | 3300006893 | Iron-Sulfur Acid Spring | MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRMF* |
| Ga0102924_10110332 | 3300007982 | Iron-Sulfur Acid Spring | MNKKEIESPKLTANFLLWIGAFVLLLFAVLAHFVWKLF* |
| Ga0099829_104178232 | 3300009038 | Vadose Zone Soil | MDKKEIESPKLTGRFLIWMSAFMLLLFALIAHFVWKVV* |
| Ga0099830_105324772 | 3300009088 | Vadose Zone Soil | MDKKEIESPKLTDRFLIWISAFMLLLFALIAHFVWKVV* |
| Ga0099828_108793252 | 3300009089 | Vadose Zone Soil | MDKKEIESPKLTGRFLIWISAFMLLLFALIAHFVWKVV* |
| Ga0105240_101599971 | 3300009093 | Corn Rhizosphere | YPDAMDKKEIESPKLTARFLIWITGFLIVLFALIAHVVWRIF* |
| Ga0105240_103845502 | 3300009093 | Corn Rhizosphere | MNKKEIESPKLTANFLVWIGLFLVLMLLLAHYVLKFF* |
| Ga0105247_112047952 | 3300009101 | Switchgrass Rhizosphere | YPDAMDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRIF* |
| Ga0105237_105802411 | 3300009545 | Corn Rhizosphere | MDKKEIQSPKLTANFLLWIGLFLLAMFALIAHFVWRIF* |
| Ga0126376_130648222 | 3300010359 | Tropical Forest Soil | MDKKEINSPKLTARFLIWISGFVLLMLVVAHFLLKWF* |
| Ga0134125_107575152 | 3300010371 | Terrestrial Soil | MDKKEIESPKLTANFLVWIGLFLVLMVLVAHFLLKFF* |
| Ga0134126_106060442 | 3300010396 | Terrestrial Soil | MNKKEIESPKLTANFLVWIGLFLLLLVALAHFALRLF* |
| Ga0126383_106674331 | 3300010398 | Tropical Forest Soil | MDKKEIESPELTANFLLWIGLFLLAMFLLIAHFAWHLF* |
| Ga0134122_100318511 | 3300010400 | Terrestrial Soil | MDKKEIESPKLTARFLIWITGFLIVLFARIAHFVGRGF* |
| Ga0126361_107236293 | 3300010876 | Boreal Forest Soil | MNKKEIESPKLTANFLIWTTVFILLLFALLAHFVWKVF* |
| Ga0150983_153089611 | 3300011120 | Forest Soil | MNKKEIESPKLTANFLIWTAVFILLLSALLAHFVWKVF* |
| Ga0137392_112328631 | 3300011269 | Vadose Zone Soil | MDKKEIESPKLTGNFLIWISAFMLLLFALLAHFVWKVF* |
| Ga0137393_117559742 | 3300011271 | Vadose Zone Soil | MDKKEIESPKLTVHFLIWITAFLLLLFALLAHFVWKVF |
| Ga0137389_100108823 | 3300012096 | Vadose Zone Soil | MDKEEIESPKLTGNFLTWISAFMLLLFALLAHFVWKVF* |
| Ga0134056_11707043 | 3300012397 | Grasslands Soil | MNKKEIESPKLTGNFLVWIGLFVLLLAAIAHFMFKLF* |
| Ga0150984_1153893162 | 3300012469 | Avena Fatua Rhizosphere | KKEIESPKLTANFLLWIGLFLLAMFLLIAHFAWHLF* |
| Ga0150984_1225043631 | 3300012469 | Avena Fatua Rhizosphere | SGPNHIRMDKKEIKSPKLTAHFLLWIGLFLLAMFALIAHFVWRIF* |
| Ga0164307_116185061 | 3300012987 | Soil | MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKV |
| Ga0164306_104212901 | 3300012988 | Soil | KEIESPKLTARFLVWITGFLIVLFALIAHFVWRVF* |
| Ga0157373_109041641 | 3300013100 | Corn Rhizosphere | PMDKKEIESPKLTARFLVWITGFLIVLFALIAHFVWRDF* |
| Ga0157369_100345557 | 3300013105 | Corn Rhizosphere | MNKKEIESPKLTANFLVWIGLFLLLLVALAHFALKLF* |
| Ga0157378_102835552 | 3300013297 | Miscanthus Rhizosphere | DKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF* |
| Ga0157372_100041032 | 3300013307 | Corn Rhizosphere | MNKKEIESPKLTANFLVWIGLFVLLLAAVAHFVLKLF* |
| Ga0181528_107952692 | 3300014167 | Bog | VNKKEIDSPKLTANFLLWIVLFLIAMFALIAHFVLRLF* |
| Ga0163163_100678832 | 3300014325 | Switchgrass Rhizosphere | MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVI* |
| Ga0167653_10353451 | 3300015162 | Glacier Forefield Soil | MDKKEINSPKLTLNFLVWIGGFMLLLFALIAHFVWNVI* |
| Ga0187820_10382122 | 3300017924 | Freshwater Sediment | MDKKEIESPKLTARFLIWITGFVIVLFALIAHFVWRVF |
| Ga0187820_12146462 | 3300017924 | Freshwater Sediment | MDKKQIESSKLTANFLLWIGLFLLAMFLLIAHFAWHLF |
| Ga0187825_103323482 | 3300017930 | Freshwater Sediment | MDKKQIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF |
| Ga0187821_100725682 | 3300017936 | Freshwater Sediment | MDKKEIESPKLTANFLIWISAFMLLLFALIAHFVWKVF |
| Ga0187821_102980492 | 3300017936 | Freshwater Sediment | MNKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFAWRIF |
| Ga0187822_102363712 | 3300017994 | Freshwater Sediment | MDKKEIESPKLTANFLIWISAFMLLLFALVAHFVWKVF |
| Ga0187863_100898322 | 3300018034 | Peatland | VNKKEIESPKLTANFLLWMGLFLIAMFSLIAHFLLRLF |
| Ga0066655_104864462 | 3300018431 | Grasslands Soil | MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAHFVWKVF |
| Ga0066662_115936482 | 3300018468 | Grasslands Soil | MDKKEIQSPKLTANFLLWIGLFLLAMFLLIAQFVWKVF |
| Ga0193715_10971102 | 3300019878 | Soil | MDKKEIESSRLTANFLLWIGAFMILLFVLLAHFVWK |
| Ga0193707_10204642 | 3300019881 | Soil | MDKKEIESSKLTANFLLWIGAFMILLFVLLAHFVWKVF |
| Ga0193730_10316032 | 3300020002 | Soil | MDKKEIESSRLTANFLLWIGAFMILLFVLLAHFVWKVF |
| Ga0193755_12264662 | 3300020004 | Soil | MDKKEIESPKLTENFLLWIGLFMLVLFLLLAHFVWRVF |
| Ga0210407_103710032 | 3300020579 | Soil | MDKREIESPRLTANFLIWITAFVLLLFGLIAHFVWRIF |
| Ga0210395_101780601 | 3300020582 | Soil | MNKKEIESPKLTADFLIWTTVFILLLFALLAHFVWKVF |
| Ga0210401_100378616 | 3300020583 | Soil | MDKKEIESPKLTARFLIWISAFMLLLFALLAHFVWRVF |
| Ga0210400_114690491 | 3300021170 | Soil | MNKKEIESSKLTANFLLWIGVFVVLLFVVLAHFVWKLF |
| Ga0210405_112102261 | 3300021171 | Soil | MDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRMF |
| Ga0210408_104248262 | 3300021178 | Soil | MDKKEIESPKLTARFLIWITGLLIVLFALIAHFVWKMF |
| Ga0210388_118118842 | 3300021181 | Soil | VNKKEIESPKLTANFLLWIGLFLIAMFALIAHFVLRLF |
| Ga0210387_109826092 | 3300021405 | Soil | MNKKQIESPKLTANFLLFACIFLLGMFALIAHFVWRVF |
| Ga0210383_105441392 | 3300021407 | Soil | MLDTVDKKEIESPKLTARFLIWITGFMIVVFALIAHFVWRVF |
| Ga0126371_122460541 | 3300021560 | Tropical Forest Soil | MDKKQINSPKLTANFLIWISLFLLAMFLLIAHFVW |
| Ga0212123_10000124240 | 3300022557 | Iron-Sulfur Acid Spring | MNKKEIESPKLTANFLIYIGVFVLLLFAVLAHFVWKLF |
| Ga0212123_1000781515 | 3300022557 | Iron-Sulfur Acid Spring | MNKKEIESPKLTANFLLWIGAFVLLLFAVLAHFVWKLF |
| Ga0179589_103231052 | 3300024288 | Vadose Zone Soil | MDKKEIESPKLTANFLIWISAFMLLLFLLIGHFVWRIF |
| Ga0207642_101959092 | 3300025899 | Miscanthus Rhizosphere | MDKKEIESPRLTARFLVWITGFLIVLFALIAHFVWRVF |
| Ga0207695_100728604 | 3300025913 | Corn Rhizosphere | YPDAMDKKEIESPKLTARFLIWITGFLIVLFALIAHVVWRIF |
| Ga0207695_103760503 | 3300025913 | Corn Rhizosphere | LRYGMNKKEIESPKLTANFLVWIGLFLVLMLLLAHYVLKFF |
| Ga0207695_114200881 | 3300025913 | Corn Rhizosphere | AMDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRIF |
| Ga0207681_102120941 | 3300025923 | Switchgrass Rhizosphere | TMDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF |
| Ga0207700_109613391 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKQINSPKLTANFLLWIGLFLLAMFLLIAHFAWRLF |
| Ga0207664_107449142 | 3300025929 | Agricultural Soil | MNKKEIESPKLTANFLVWIGLFVVLLVLVAHYILKLF |
| Ga0207690_106718392 | 3300025932 | Corn Rhizosphere | SMDKKEIESPKLTARFLIWITGFLIVLFALIAHFVWRVF |
| Ga0207677_108041752 | 3300026023 | Miscanthus Rhizosphere | MDKKEIESPELTARFLIWITGFLIVLFALIAHFVWRIF |
| Ga0257164_10827462 | 3300026497 | Soil | MDKKEIESPKLTGRFLIWISAFMLLLFALIAHFVWKVV |
| Ga0209419_11044432 | 3300027537 | Forest Soil | MNKKEIESPKLTANFLIWTTVFILLLFALLAHFVWKVF |
| Ga0209733_11737671 | 3300027591 | Forest Soil | MNKKEIESSKLTANFLLWIGAFVVLLFALLAHFVWKFF |
| Ga0209581_11762611 | 3300027706 | Surface Soil | MDKKQINSPKLTANFLVWISLFLLAMFLLIAHFVWRIF |
| Ga0209328_100392442 | 3300027727 | Forest Soil | MNKKEIESPKLTANFLIWISAFMLLLFALLAHFVWKVF |
| Ga0209810_12671811 | 3300027773 | Surface Soil | MDKKEIESPKLTANFLVWIGLFLLAMFLLIARFAWHLF |
| Ga0209167_100442104 | 3300027867 | Surface Soil | MNKKEIESPKLTANFLLWISAFLLLLFAALAHFVWKIF |
| Ga0209624_1000204419 | 3300027895 | Forest Soil | VNKKEIESPKLTTNFLLWIGLFLIAMFALIAHFMLRLF |
| Ga0209624_104525782 | 3300027895 | Forest Soil | SWAMNKKEIESPKLTANFLIWTTVFILLLFALLAHFVWKVF |
| Ga0209168_100006434 | 3300027986 | Surface Soil | MDKKEIESPKLTANFLVWIGSFLVLMVLVAHFLLKFF |
| Ga0311334_101958702 | 3300029987 | Fen | MDKKEIESPKLTINFLIWITVFMLLMFGLLGHFVWKVF |
| Ga0265753_10040573 | 3300030862 | Soil | CAMNKKEIESPKLTADFLIWTTVFILLLFALLAHFVWKVF |
| Ga0310813_103090122 | 3300031716 | Soil | MDKKEIQSPKLTANFLLWISLFLLAMFLLIAHFVWKVF |
| Ga0302322_1003720231 | 3300031902 | Fen | RARTSGVSLAMDKKEIESPKLTINFLIWITVFMLLMFGLLGHFVWKVF |
| Ga0307479_100492583 | 3300031962 | Hardwood Forest Soil | MDKKEIESPKLTGNFLIWISAFMLLVFALLAHFVWKVF |
| Ga0307479_104171842 | 3300031962 | Hardwood Forest Soil | MDKKEVESPKLTARFLIWITGFMIVVFALIAHFVWRVF |
| Ga0308176_101133913 | 3300031996 | Soil | MDKKEIQSPKLTANFLLWIGLFLLAMFALIAHFVWRIF |
| Ga0307471_1011659602 | 3300032180 | Hardwood Forest Soil | LHNDKKEIESPKLTGNFLIWISAFMLLVFALLAHFVWKVF |
| Ga0335082_117288192 | 3300032782 | Soil | MNKKEIESPKLTANFLIWTSLFLLAVFALIAHFGLGLF |
| Ga0335079_1000010348 | 3300032783 | Soil | MDKKEINSPKLTANFLVWIGLFLLAMFLLIAHFVWRVF |
| Ga0335079_100332776 | 3300032783 | Soil | MDKKEINSPKLTARFLIFISGFVLLMLLVAHFLLRWF |
| Ga0335079_102106692 | 3300032783 | Soil | MDKKDINSPGLTANFLVWIGLFVLAMFAFIGHFIWKIF |
| Ga0335070_116420492 | 3300032829 | Soil | MDKKEIESPKLTARFLIWITGFMIVVFALIAHFVWRIF |
| Ga0335074_100078506 | 3300032895 | Soil | MHMDKKEIKSPKLTANFLLWTGLFLFAMFALIAHFVWHLF |
| Ga0372943_1104654_277_390 | 3300034268 | Soil | MNKKEIDSPKLTANFLVWVGLFVVLLAALAHFVLKLF |
| ⦗Top⦘ |